1SQXH

Crystal structure analysis of bovine bc1 with stigmatellin a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
67
structure length
67
Chain Sequence
ELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 17
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1sqxH00
1L0LH 2FYUH 3L72H 3BCCH 2A06H 5KLVH 3L75H 3L73H 4U3FH 1NU1H 3L71H 1BE3H 3TGUH 4PD4F 1PP9H 1KB9F 1PPJH 2IBZH 4D6TH 1SQQH 3L70H 2BCCH 1BGYH 3H1LH 1SQPH 1NTZH 1SQBH 1NTMH 3H1HH 1NTKH 1BCCH 1EZVH 1SQXH 1L0NH 3CX5F 1SQVH 3H1JH 3CWBH 3CXHF 1KYOF 3L74H 3H1IH 1P84F 3H1KH
chains in the Genus database with same CATH superfamily
2F93B 1KD1W 1WJZA 2Y0PA 1Z5VA 1QHTA 5B3SC 1IBKB 4FLWA 2YC0A 1TGOA 4PDRA 4DR7B 5H5NA 2BSKA 3AG3C 5GTHZ 2WA3A 1EFRG 2XAHA 3CRAA 1U96A 5H6QA 5EK0A 4DV2B 1JFFB 5IYZB 1XOUA 1N0JA 1L8DA 2HVJC 3CJHB 1R1BA 4BWAA 2KG7B 1P49A 3BCCH 5GTIZ 4B3MO 3CCMV 4YXWG 1EN5A 1KP2A 3AG1C 3BAAA 3UO2A 1AI7A 3WB0A 1NBMG 1RSOB 1NVPB 4KL1A 3N27A 3E8HA 2UXBO 1VQ5V 5L3DA 4YIOA 2HG5C 5FLXN 4WBNB 4OXSA 2FYUH 4HBNA 1YTFB 3EFFK 3CD6V 3OMIB 5L3FA 1XQ8A 4EFEA 4TV9B 1US6A 3L70H 1OCZC 1F51A 4AQYB 1HWYA 4CBCA 1GO3F 1CPYA 3SPHA 4KUMA 4DV0B 1NT2B 2Z0AA 1YTFD 1F4MA 2JDIG 1SETA 1TVKA 1RFYA 3DC5A 1M4UA 3FB6C 1I94O 4PA4A 4BW5A 4IIJA 1QU7A 1WPXA 4DR4B 5CMUA 1QCEA 2CGOA 3LSUA 2LQTA 2XAGA 1M1KW 3CS5A 2GV9A 1PNKA 1TAEA 4B7KA 4WFHA 1YIJV 4EB6A 4DV6O 4PDLA 3FD9A 4JI1B 3KCXA 2ITCC 3CCEV 4WFGA 2ZM6O 5CA0B 4EB6B 4O4HB 1MABG 4EFBA 5FPRA 1N0NA 1JA8A 1NS1A 1JVMA 1Y6XA 4UUJC 3T1YO 1H2MA 3QG5A 4PDMA 4JI6B 2Q7HA 3AG3B 5LP6A 1SQFA 3CRRA 3ETDA 1Q3EA 4JAAA 1NQTA 4ZOLB 4I0XB 2YSUB 2WPDG 3WG7B 5LXTA 1MZEA 4RUEA 1HNXO 2QWPB 4J11A 3DTUB 1I5XA 2IW5A 4I0XA 1PL0A 3UT5A 4X64O 3CMAV 4JI2O 4X89A 3CXHF 2OWOA 5KHJA 4P2ZA 1VF5B 2Y69C 4PHZA 1T5EA 3VQVA 4DV4O 1XDCA 2JGDA 5B1OA 1WN7A 3K9SA 3RGBA 5BMVB 3KG2A 5LHHA 2A79B 2CH7A 1FFTB 4H37A 4ZOLA 2HP8A 1PPJH 2XAQA 1FXHA 2ZNJA 4YHHB 5IJ9B 3FYEB 4K3AA 2MW2B 4IGGA 4MVMA 2ZKOA 1J95A 2GTAA 4LF7O 1WP7A 2GTSA 2ZM6B 1NH2B 2DWEC 3G80A 3ZRSA 1EN6A 2JGUA 4JZ2A 3AK2A 5IDJA 3ZS8C 1RP3B 2JIZG 3BRCA 2KQXA 1BT8A 4JTAB 4RUFA 2UUCO 1NR1A 2JK5C 1CXZB 1MSDA 4Q20A 3A0BZ 2YI9A 2DQ0A 4UB8Z 2YICA 4XDLA 3RYCB 2Y0IA 1P7GA 1M56B 4ABMA 1NU1H 3FB8C 3CE2A 5C93A 3HKBA 4QIWF 4YJ2B 4O4LA 1BHAA 1NTMH 5B1BB 1Q6IA 3KKYA 4N23A 4JI3B 1Q8IA 3CCUV 1X4TA 3DSQA 1GN2A 4JI3O 3L75H 4LFAB 1YJWV 2Q8VA 4MTXA 4J9ZB 4R8CA 4X66O 4I50B 4X1YA 3K04A 1Y76A 1HNZB 4ZKIA 4MS2A 4PDVA 4O4IA 3E2EA 4DR7O 1FYJA 4CH6A 4JI1O 4ZI7B 1AI4A 3OTOO 2PUSA 2WLLA 3AK1A 4FLVA 5L3EA 5JQGB 4MVOA 2N74A 4EKWA 1GH6A 1HNWB 4CH5A 4YJ3A 3K5NA 3B09A 3G67A 4D6TH 1TUBA 2QJ1A 1K92A 3LDCA 3PJSK 4KXRA 3T2MA 1HNZO 1QLEC 3E8FA 3SR2C 3H1IH 1QLNA 1GN6A 3APOA 1N33B 1AJQA 4D7TA 4DV1B 1GK9A 2A06H 2KKWA 4JI7O 4FFBA 1BE3H 3PN1A 1COWG 1Q82W 3UCSC 2DQ3A 2YXHA 5LYJB 1N4CA 3RYHB 2OCHA 1SQXH 2YIDA 4JZGA 2ILMA 1KMIZ 1EBOA 2P4KA 1NR7A 2UUBB 1FFXA 2EJ7A 5CA1A 2FMLA 4FJCC 4DRXB 2BTOA 4P9OA 2YIBA 3E8GA 4YJ3B 5EYPB 2BE3A 1E1RG 5F2VO 1VQPV 4CS3A 4DV7B 2EZPA 4WFFA 1SESA 1MMMA 1Y74A 5FL7G 4LF8B 4K0KB 4IHJB 1TUBB 1VF6A 3L72H 3M7MX 1FFXB 4UB6Z 3K5LA 3JARA 3CRCA 2EILB 3I55V 4NKGB 1XI1A 5HFMA 2WLMA 1SQQH 1SF9A 3JD0A 5IWAO 4LBEC 2ZQMA 2QSAA 4DXWA 2JEXA 4B3SB 1V54C 1XNQB 3JCUZ 3OFNG 3OEEG 1I94B 2Y4TA 1KP3A 1KKDA 3HR0A 4MTGA 3ABMB 3R65A 4OPAA 4B3RB 5JJJB 3OMAB 3VOUA 4AHCA 3OTOB 2O57A 1IZ3A 1L0NH 4GT1A 3E22A 3GWOA 2KB1A 5EIBD 2YIAA 5LOVA 3SPGA 2EBOA 5CBGA 4LF9B 3ZMUA 5FNVA 4LH7A 3AK3A 4RQEA 3WG7C 5A9GA 1E1QG 1AILA 2PTMA 5LL6Y 4DR6B 2CH7B 2PYLA 1I0HA 3HKDA 4I9WA 5CN0A 2ETNA 5BR8B 2EIMC 3VQYA 5IJ9A 1GM8A 5J2TB 2QDOA 2ZR2A 2QGNA 4XDKA 3AG2B 3H9VA 2AGAA 2QEXV 3J7AU 3ABLB 4IHJA 1XREA 3ASNC 4LNUB 3K59A 1OCCB 1OCOB 1OCRC 4FM2A 3CCRV 3BABA 2FKXA 1XMQO 2HVKC 4QE7A 4LP8A 5KAIZ 1WP8A 3ZHRA 4MW3A 3W7UA 3C3SA 2WLJA 5CBHA 3SJAC 1JX9A 2QE7G 4JTDB 2LW7A 2G38A 1Q5OA 4AILC 3O65A 1WA8B 4X1KA 2EIMB 4GX5A 2YUAA 2EIKC 3JD1A 3EXAA 1P84F 4X1KB 2ZNIA 4JV5O 1M93A 1G4YB 5IJ0B 3K5OA 2R9AA 2BOCC 2DWDC 1W59A 3IGAC 3AEIA 2PY5A 4RAIA 5FPOA 4DV4B 1VQ9V 4G28B 5JJNB 4CC6A 5EC2C 2P22C 1OCZB 5CA3A 3CCLV 1TUEB 3CB2A 1MNGA 3T1CA 4UV9A 2Q4PA 2IM9A 4AQYO 5CA0A 2JVDA 4LF8O 3IC7A 3ZMZA 2EIKB 3Q4HA 3H1LH 3SJBC 4DV5B 5E1AC 2E5LO 3E86A 4PA6A 1Q86W 3ZRXA 1N34B 2IJJA 2OCCB 3A0HZ 3HKDB 5IYCO 3J81N 4FLYA 1S5HC 3T4DA 2PYJA 1XNRO 3ZMSA 1G6UA 3BPZA 3JD3A 4H0LB 3TJTA 1FD9A 1M9NA 3D3IA 1Z5WA 1N36B 4BR6A 1QVGU 1Q43A 1I08A 5IY5C 3CCQV 2LGWA 1FJGB 3OE7G 3RN4A 1IBKO 3JD2A 5JQGA 1SS3A 1D5NA 2EIJB 2ODMA 2CTRA 2HEPA 5EIBC 4J9YB 1FXVA 1AR5A 3STZC 1R6NA 2ZXWC 2EINC 2B1IA 4G27B 4WF9V 4O4IB 1NTZH 1Q7YW 4KHPO 2CAZC 5EBLC 5KHKA 2E75B 1YDXA 1W0JG 4LR3A 1GN3A 4LF6O 2QTSA 1B06A 1PM9A 4KHPB 1NKDA 5IYZA 2R72A 4H44B 2Q7EA 3CRMA 3U10A 2AXTZ 2YIBD 1N8RW 5LMNB 2ADPA 2E5LB 2V4DA 4PI2A 2M7WA 2P6JA 5H2FZ 1FKAO 5LHIA 2HLDG 3CCJV 4NR1A 1R3KC 2DMXA 1ZUQA 3IJ4A 3ASOC 4H13B 5BMVA 3MHSC 1VF7A 2W0XA 1AB3A 4TWKA 5KMGA 3H01A 1ZL8B 4WFBV 2NN4A 1X59A 5LYJA 2P90A 2P5OA 3RYHA 2DN9A 4QJFB 5D5PA 1WA8A 3ICXA 1EN4A 1FJGO 2JGDB 1IBLO 3BFRA 3L71H 3TXSA 2K1EA 1PNLA 2LW1A 4OGQB 4R7CA 4IL6Z 4DW0A 1BQ0A 3LSSA 4ICGA 1YJNV 3SPIA 1VQNV 1VQKV 3M8AA 2Z3YA 4LF4B 2NR5A 2ZR3A 1W0KG 2N04A 3L9DA 3WFVA 3L74H 3FX7A 2WLHA 1Y67A 3CPWU 1VMGA 2PI5A 4DR1O 5IWAB 1PL4A 3OAAG 3RYIB 5CB4A 2R9IA 4UV8A 1WB8A 1WLEA 2OCCC 1AJPA 3A8TA 5B3SB 2EULA 3A0RA 1AVMA 3JARB 1KBHA 2UXCO 3CC7V 4W4LA 1VF6C 3HKEA 3D36C 5H6RA 1F4NA 2F4VB 4UCTA 4QE9A 4MVQA 1S5JA 1VARA 4PD4F 2WLLB 2ZE7A 3CHXA 2ZIOA 1EZJA 1Z2GA 4DUYB 1S72V 2LFSA 3OUFA 1JMKC 3D3QA 3F5TA 4X62B 2ZE5A 2UUAO 2CGNA 2QA4V 2ZE8A 3AG2C 3ETEA 2UXBB 2X6BA 4FZ0A 1KKCA 4LFCO 2ITDC 4X20A 3F7VC 2QR4A 5LMNO 1R73A 2HKOA 3T1YB 4FVMA 2XTAA 4O2AB 1GM7A 2B1GA 4CH4A 4K35A 4A5UB 3W7TA 5C8YA 3E22B 5KX5B 1BS3A 4WBNA 4LF6B 4LF4O 1SQBH 5BR8O 2WLIA 4D7SA 4J7KA 2E74B 3K03A 5DECA 1GTOA 5LHGA 1D2DA 1UFIA 4B3MB 4ASUG 1DK1A 4ZI7A 5JCOC 3OGIB 3DXRA 3LNMB 4IYIA 4X20B 3QTCA 1VIBA 3B8NA 4O2BA 1SC5B 4X1IA 5C8YB 1UJWB 4QNHB 4PI0A 3VBBA 3ML0A 1ZX3A 3CP1A 1V55C 4PJ0Z 3CWBH 3Q4HB 4PA9A 4Z2WA 4LFBO 4NTWA 5KHIA 3THOA 2YEVA 4ZHQA 4MVUA 3JAWB 4JYBA 2Q0OC 4DR2O 1A32A 4NXMO 4U7OA 1XMOO 1J5EO 4UCSA 3QO5A 1FXKB 2Q5ZA 3LSQA 1RM1C 2LJ2A 3QO8A 1HNXB 3RT3C 4TQFA 1R3JC 5LA6A 5KUMA 4F6EA 4Q6GA 5KX5A 3JD4A 1Q6UA 4UVAA 4UCRA 1K7DA 2RCVA 3B4SA 3UKMA 4FM0A 2ZD9A 3G6EV 5KHHA 2QM8A 3UO3A 1O9GA 5EZYB 4JI4B 4FLZA 4DRXA 3ABMC 4F6RB 4FMTA 1Y74B 2L6LA 4I5SA 1QR9A 4BIOA 3BY6A 3JYCA 5EC1C 3VQXA 4JV5B 1K3EA 4P9PA 1I5YA 1K33A 2Y4UA 4RO2A 3FFQA 5LGUA 4I55B 4DUZO 4FZ1A 2DYSB 5B1BC 4QPKA 2EIJC 4FLXA 4JI0O 4DV6B 2JJ2G 4C7UA 5E79Z 2AW9A 4DR4O 3SYPA 2HJFC 1Y4MA 1VQ4V 3IFXA 1CP9A 2EX3A 1SKVA 1K4DC 4TT3G 3CC2V 4NYKA 1V9PA 4FIPC 3RBZA 1O9HA 1XUQA 2ZE6A 2YI8A 1YJ9V 4B3TB 1WPBA 5H9CA 4FFKA 4LFCB 1KUQA 1Y66A 2C2AA 3RVZA 1WB7A 3UQ8A 1XBLA 2AZ0A 4LWSA 5LP6B 3JASA 4FLUA 1NZ6A 3CC4V 1NJIW 5KMGB 2X6AA 2UXDB 2DYSC 2QM4A 2IBZH 2WLNA 4JI8B 4GKKO 5LA6B 3W7XA 2Q6AA 2GSMB 4UCOA 1VQLV 5B5EZ 3RFRA 1I7FA 1XMQB 4JI8O 4GKKB 1N32B 3H1JH 5FNVB 2VQFO 2A3QA 1JFFA 4LF5O 4DV3B 2B9ZA 1IX9A 2P67A 5DN6G 4DR2B 1VEWA 4DR5O 3K08A 3IC9A 2Q9LA 4BAYA 1YXBA 1S77D 4DR1B 4DV2O 4XDJA 2OYQA 3G71V 1P4RA 2XAJA 5K1XA 3BA8A 4JTCB 2F95B 2WLKA 2P06A 1YHQV 4YY3B 3W7WA 4DR6O 1IXBA 4BW9A 4X1IB 2BSKB 2QWNB 1ENVA 1FXKC 2N05A 1HP8A 2W0FC 1PKXA 1M90W 4NB5A 4MSWC 1JOYA 4TV8B 3M99B 2AZ2A 1AR1B 3X2QC 4Z1MG 2NNUA 2YXYA 4CH3A 1IBMO 5A2QN 4E2LA 1VQ7V 2GBOA 3SPJA 1SZTA 2QKSA 1H38A 3B40A 1PP9H 4TV9A 1LR1A 2DOSA 2JEUA 4JGSA 3K58A 3RYCA 1M57B 2IU3A 2B5UA 3SYCA 4LFAO 2YXLA 5IJ0A 3LDEA 4B7EA 3ZN1A 3SYOA 2CTWA 2XT9A 3K0GA 1IURA 4K0KO 4X1YB 3CMEV 3ZJZA 2F4VO 2VWKA 3ABUA 4JF3A 3RW0A 2VQEO 3ABTA 1TVKB 5JWPA 5LGNA 3ZCCA 3K3WA 2HHHO 1R3LC 3ETQA 3OT7A 1N34O 5DEDA 1XMOB 4O4LB 2UUAB 3SGIA 3FKSG 4JI6O 3ZBHA 1IBMB 2YEVB 1N33O 2UUBO 3P3PA 1ZL8A 1K97A 1H8HG 2F1MA 4JAVA 2IJHA 1ZAUA 3KCYA 3HKCB 1R6TA 4X64B 5LP6C 2CE4A 2ZIMA 4GYCB 5J9PC 2UXNA 3P32A 3H1HH 3T1HO 1HR0O 2KG7A 2X7RB 2DW4A 5ITZB 3ZX6A 3JSLA 1M56C 1QR8A 2AHZA 4LC1A 4YJ2A 3ABKC 3S3XA 4FPPA 4OPHA 2JJ1G 4BIUA 3JAWA 5IT9N 2F43G 1AI6A 1AP6A 1HW7A 5KA5A 2JRIA 1KQSU 5LMUB 3OW2U 1F7YA 4GX1A 3SYAA 3R66A 4JPRA 5J2UA 2Z5UA 2P7TC 4H33A 5JH7A 4PELA 2GUZA 1JJ2U 1IBLB 3E89A 4UVCA 4DV7O 2V7QG 4X65O 3TK1A 3K57A 4HNAB 1L1FA 2ZDIA 5L3BA 3K0DA 4MT8A 1DF5A 1SERA 3MDSA 2QWOB 1GN4A 3ABKB 5KA6A 1SQVH 3CRQA 1K9MW 2VWJA 5AG2A 4MVSA 1DGSA 1URFA 2EZOA 4TUYB 1F23A 1KECA 2Q69A 4U3FH 2UU9O 2R70A 1BZKA 2Y48A 1NI8A 4K8ZA 2ZT9B 4I55A 4JASA 2JS3A 3HKCA 4K8XA 4DO2A 5B1AB 3SPCA 1H2LA 1H2GA 1HNWO 4KP4A 2VQFB 3K06A 5L3CA 1K5QA 4WCEV 2Q67A 3QO7A 3G6BA 2NLJC 4GKJB 1NH2D 3MHHC 3K5MA 1QQCA 4J7ZA 4X9QA 1PNMA 2A7WA 1VQOV 3FB7C 5LMUO 4MTOA 4GLXA 1SA0B 2D3OW 1OHHG 5IY5B 1Q81W 3A2FA 2RN9A 1YF2A 3UT5B 1LUVA 2H3OA 2GDSA 3GB7C 4U7NA 2CTPA 1SRYA 2HR3A 3CCVV 2EILC 3HKBB 1H2SB 3W7SA 4DR5B 4FK5C 4I4TA 3SDLA 1BCCH 1ZTEA 2Q7GA 3N2GA 4DV3O 3TCUA 4I7ZB 5B66Z 4B08A 1LNQA 3O9OA 4JI5B 4MTFA 4X88A 2DYRB 2XAFA 4O2AA 1PD3A 4DR3O 4CS2A 2FB5A 3AG4B 1B6QA 4BIZA 4JYAO 4YIPA 2BOBC 3ZRWB 4QGPA 3BVOA 4U3JA 4WFAV 3LDDA 1DLBA 1FXKA 1VQ8V 1RPRA 1ROPA 1BQZA 1VQMV 3QF7A 1YITV 5ITZA 1WNSA 3IAYA 4I50A 2Q0AA 3ZHUA 1XNQO 1ORQC 1QBZA 5DM6V 4JYCA 3OR6C 5KUKA 1Q6HA 1YVWA 1XNRB 1AI5A 1JPXA 2WLIB 2LFRA 2HHHB 3CYOA 4DYLA 1EM1A 2MK3A 4CS4A 1D5AA 4X65B 4UVBA 2X6CA 4GZRB 3N2KA 1YCIA 2LGQA 1VP7A 4ZHQB 1NVPD 2GHYA 4OX9B 5JVDB 2W6IG 1M57C 1OV9A 4I4TB 2WAMA 5BXZA 3S3WA 3HKEB 3P30A 1RSOA 4JYYA 4X8AA 4JI7B 3JCZA 1FPOA 1WAZA 2QTOA 3BHPA 1IDSA 2JS5A 4F6RA 1MG1A 2RJZA 4IT5A 3FYIB 2CK3G 2QWQB 4B3TO 5EBMC 4IIJB 1K34A 4GUNA 4HAMA 5EYPA 3U0ZA 2PF4E 2OIEA 2DYRC 5IE9A 3OR7C 3SJCC 4DV1O 3JALB 4W4KA 1S76D 4JI0B 2IU0A 4B3SO 3NXSA 5J2TA 2PGGA 3F5WC 4TQDA 3TGUH 4KFMA 1HR0B 3HPLC 1P7BA 2K9PA 2XOKG 3E35A 2F23A 1SQPH 4MVRA 1NTKH 4MVZA 1YSCA 5LXTB 2ATKC 2ZXWB 5CBFA 4FM1A 3CX5F 2Y69B 4DUZB 4B3RO 4XBFA 5JCOA 1MA1A 4U3JB 2VQEB 1Q90D 2IJKA 4DR3B 5K1PA 5LGTA 3F7YC 2RNBA 3BA9A 5KHGA 2BTQB 4YY3O 3D8CA 4LCUC 2F66C 5JJEB 2OIGA 4JI5O 1V55B 3JSNA 2A9HA 2IH1C 3ETGA 3RVYA 2CUGA 3CCSV 3JAMN 4DK0A 4NXMB 5D5QA 1KYOF 2OTLV 3OTFA 1UPGA 4ZIBA 3ASOB 5BZBA 4WFEA 3LNNA 3U11A 1N32O 5B1NA 2XHBA 3FAVA 1HDJA 4HZ3A 2UXCB 2DE0X 5TISZ 2UXDO 3TXQA 4LF7B 1SQGA 2FL4A 4E4EA 1JCHA 2P4VA 3TETA 3B8MA 2QKAA 3B2EE 4P30A 4NTYA 4G2KA 2RDCA 5J2UB 2Q68A 2WA4A 3ZHVA 1J5EB 4GX2A 2QWRB 2UXXA 1H2NA 3K9AA 3OD4A 4NTXA 2E3CA 1THZA 4PA7A 1B04A 4PA3A 2H8PC 2VRZA 4UFZA 3VQWA 1XHZA 1OZ0A 2E76B 4J7JA 1BHBA 3ZHQA 3CJHA 4X66B 4IYHA 4O4JA 2GUZB 4YHHO 2WSSG 4J10A 3RYFA 4DW1A 4O4JB 1FS0G 3ZEDA 3JAKB 1RM1B 2ARHA 3HB3B 3E8BA 1CEZA 1M5IA 1ZLZA 4LH6A 3L73H 1VQ6V 2XUMA 1SZXA 1JQ0A 4TOIA 3D36A 1OCCC 1OCOC 4LF9O 1BL8A 3ABLC 2RMKB 2V1DA 3ASNB 1ZSPA 3SJQC 5KAFZ 3CXCU 2QKCA 4CZZA 1R6KA 4QPJA 1RPOA 3T1HB 3JAKA 2FTKA 4UXNA 1BMFG 3X2QB 1L0LH 5GW7A 1KU9A 3RYIA 5CB4B 4R50A 1XILA 3RWRD 1S0VA 1MOFA 4UCVA 3JALA 2HJDA 1EZVH 4I9QA 3OEHG 1XL6A 1K73W 2ZINA 4JAUA 3AG7A 4GX0A 5B1AC 1K5SA 3SYQA 4L8JA 3JATB 2RQ6A 3RYFB 3N2GB 2WWWA 2HFEC 3QNEA 4J80A 1MZFA 1R3IC 3FB5C 3MD0A 4NVPA 4O4HA 3K79A 3J80N 3ZHTA 4HNAA 4DK1A 2BTQA 2Q73A 3STLC 1DF4A 4RWUA 2XASA 3WU2Z 3DXRB 2H94A 3QVNA 4PV1B 4LNUA 1QVFU 5HFLA 4TV8A 4DV0O 4F4LA 1XL4A 3NR7A 1KC8W 1TA8A 1QLEB 4JI4O 4DV5O 4NXNO 2LP7A 2BCCH 2R9RB 1YZBA 2OTJV 4EEQA 5GONB 3AG4C 4NXNB 3I56V 5JH7B 3OUSA 3GWKC 3H1KH 1OJHA 1YI2V 2ADQB 3B77A 4DUYO 3OM3B 2W6JG 2UUCB 1GRJA 3DC6A 1JJOA 2CDYA 5L3GA 2ZDIC 3OGCC 3WB2A 5LOVB 1W2BU 1XEQA 3ZHSA 1DTOA 1AR4A 1GMGA 1MSWD 2DJVA 3MAQA 1QNMA 1Y76B 1IVSA 1K8AW 2AHYA 3DGEA 3BEHA 3E83A 2IJIA 5EBWC 4UCUA 4JYAB 2X0LA 2PZSA 1JR9A 3KZIZ 1OCRB 1S3JA 2UU9B 4TUYA 2LO1A 2KSDA 4O2BB 3ZMVA 3JASB 3T4ZA 3EHBB 1FAFA 1GAXA 2A0LA 4JI2B 1N36O 3N2KB 4R6ZA 4ZBMA 1PV0A 1B3QA 3GVMA 4N21A 5GONA 5IYBO 1ZWIC 1YEWA 5EZYA 1GM9A 1V54B 1G8MA 2OT5A 5LBQA 2IH3C 3UM7A 3G4SV 4HYOA 4LF5B 4Z1VA 3FAVB 3CEIA 3ZRVA 5IYDO 2M6YA 1AP5A 1LUWA 3ZMTA 3ZIAG 2XNDG 3ZRWA 3LUTB 4LWSB 4FLTA 2QM7A 4X62O 2EINB 2CTQA 2PI4A 2D2CB 4CC5A 1SA0A 1BSMA 1U97A 2VS0A 3OMNB 1E79G 4MW8A 4GKJO 1G1XB 5CA1B 4J42A 4OX9O 1IXMA 4FFBB 1XHXA 1K4CC 1AROP 3P3NA 4RQFA 2YDEA 4J41A 5KLVH 2ZCEA 1S5LZ 3C3TA 1H2KA 3I5DA 1H8EG 1KB9F 1GKFA 4L87A 2L35A 4GCZA 4LFBB 4TSFG 3WB1A 1BGYH 2YS8A 3APQA 3AG1B 2EJRA 3C90A 3CSXA 5JVDA 1AJNA 3EVKA 3JATA 3ZN0A 5BY1A 4AI8A
chains in the Genus database with same CATH topology
1L0LH 2FYUH 3L72H 3BCCH 2A06H 5KLVH 3L75H 3L73H 4U3FH 1NU1H 3L71H 1BE3H 3TGUH 4PD4F 1PP9H 1KB9F 1PPJH 2IBZH 4D6TH 1SQQH 3L70H 2BCCH 1BGYH 3H1LH 1SQPH 1NTZH 1SQBH 1NTMH 3H1HH 1NTKH 1BCCH 1EZVH 1SQXH 1L0NH 3CX5F 1SQVH 3H1JH 3CWBH 3CXHF 1KYOF 3L74H 3H1IH 1P84F 3H1KH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0L H;  2FYU H;  3L72 H;  3BCC H;  2A06 H;  5KLV H;  3L75 H;  3L73 H;  4U3F H;  1NU1 H;  3L71 H;  1BE3 H;  3TGU H;  4PD4 F;  1PP9 H;  1KB9 F;  1PPJ H;  2IBZ H;  4D6T H;  1SQQ H;  3L70 H;  2BCC H;  1BGY H;  3H1L H;  1SQP H;  1NTZ H;  1SQB H;  1NTM H;  3H1H H;  1NTK H;  1BCC H;  1EZV H;  1SQX H;  1L0N H;  3CX5 F;  1SQV H;  3H1J H;  3CWB H;  3CXH F;  1KYO F;  3L74 H;  3H1I H;  1P84 F;  3H1K H; 
#chains in the Genus database with same CATH topology
 2F93 B;  1KD1 W;  1WJZ A;  2Y0P A;  1Z5V A;  1QHT A;  5B3S C;  1IBK B;  4FLW A;  2YC0 A;  1TGO A;  4PDR A;  4DR7 B;  5H5N A;  2BSK A;  3AG3 C;  5GTH Z;  2WA3 A;  1EFR G;  2XAH A;  3CRA A;  1U96 A;  5H6Q A;  5EK0 A;  4DV2 B;  1JFF B;  5IYZ B;  1XOU A;  1N0J A;  1L8D A;  2HVJ C;  3CJH B;  1R1B A;  4BWA A;  2KG7 B;  1P49 A;  3BCC H;  5GTI Z;  4B3M O;  3CCM V;  4YXW G;  1EN5 A;  1KP2 A;  3AG1 C;  3BAA A;  3UO2 A;  1AI7 A;  3WB0 A;  1NBM G;  1RSO B;  1NVP B;  4KL1 A;  3N27 A;  3E8H A;  2UXB O;  1VQ5 V;  5L3D A;  4YIO A;  2HG5 C;  5FLX N;  4WBN B;  4OXS A;  2FYU H;  4HBN A;  1YTF B;  3EFF K;  3CD6 V;  3OMI B;  5L3F A;  1XQ8 A;  4EFE A;  4TV9 B;  1US6 A;  3L70 H;  1OCZ C;  1F51 A;  4AQY B;  1HWY A;  4CBC A;  1GO3 F;  1CPY A;  3SPH A;  4KUM A;  4DV0 B;  1NT2 B;  2Z0A A;  1YTF D;  1F4M A;  2JDI G;  1SET A;  1TVK A;  1RFY A;  3DC5 A;  1M4U A;  3FB6 C;  1I94 O;  4PA4 A;  4BW5 A;  4IIJ A;  1QU7 A;  1WPX A;  4DR4 B;  5CMU A;  1QCE A;  2CGO A;  3LSU A;  2LQT A;  2XAG A;  1M1K W;  3CS5 A;  2GV9 A;  1PNK A;  1TAE A;  4B7K A;  4WFH A;  1YIJ V;  4EB6 A;  4DV6 O;  4PDL A;  3FD9 A;  4JI1 B;  3KCX A;  2ITC C;  3CCE V;  4WFG A;  2ZM6 O;  5CA0 B;  4EB6 B;  4O4H B;  1MAB G;  4EFB A;  5FPR A;  1N0N A;  1JA8 A;  1NS1 A;  1JVM A;  1Y6X A;  4UUJ C;  3T1Y O;  1H2M A;  3QG5 A;  4PDM A;  4JI6 B;  2Q7H A;  3AG3 B;  5LP6 A;  1SQF A;  3CRR A;  3ETD A;  1Q3E A;  4JAA A;  1NQT A;  4ZOL B;  4I0X B;  2YSU B;  2WPD G;  3WG7 B;  5LXT A;  1MZE A;  4RUE A;  1HNX O;  2QWP B;  4J11 A;  3DTU B;  1I5X A;  2IW5 A;  4I0X A;  1PL0 A;  3UT5 A;  4X64 O;  3CMA V;  4JI2 O;  4X89 A;  3CXH F;  2OWO A;  5KHJ A;  4P2Z A;  1VF5 B;  2Y69 C;  4PHZ A;  1T5E A;  3VQV A;  4DV4 O;  1XDC A;  2JGD A;  5B1O A;  1WN7 A;  3K9S A;  3RGB A;  5BMV B;  3KG2 A;  5LHH A;  2A79 B;  2CH7 A;  1FFT B;  4H37 A;  4ZOL A;  2HP8 A;  1PPJ H;  2XAQ A;  1FXH A;  2ZNJ A;  4YHH B;  5IJ9 B;  3FYE B;  4K3A A;  2MW2 B;  4IGG A;  4MVM A;  2ZKO A;  1J95 A;  2GTA A;  4LF7 O;  1WP7 A;  2GTS A;  2ZM6 B;  1NH2 B;  2DWE C;  3G80 A;  3ZRS A;  1EN6 A;  2JGU A;  4JZ2 A;  3AK2 A;  5IDJ A;  3ZS8 C;  1RP3 B;  2JIZ G;  3BRC A;  2KQX A;  1BT8 A;  4JTA B;  4RUF A;  2UUC O;  1NR1 A;  2JK5 C;  1CXZ B;  1MSD A;  4Q20 A;  3A0B Z;  2YI9 A;  2DQ0 A;  4UB8 Z;  2YIC A;  4XDL A;  3RYC B;  2Y0I A;  1P7G A;  1M56 B;  4ABM A;  1NU1 H;  3FB8 C;  3CE2 A;  5C93 A;  3HKB A;  4QIW F;  4YJ2 B;  4O4L A;  1BHA A;  1NTM H;  5B1B B;  1Q6I A;  3KKY A;  4N23 A;  4JI3 B;  1Q8I A;  3CCU V;  1X4T A;  3DSQ A;  1GN2 A;  4JI3 O;  3L75 H;  4LFA B;  1YJW V;  2Q8V A;  4MTX A;  4J9Z B;  4R8C A;  4X66 O;  4I50 B;  4X1Y A;  3K04 A;  1Y76 A;  1HNZ B;  4ZKI A;  4MS2 A;  4PDV A;  4O4I A;  3E2E A;  4DR7 O;  1FYJ A;  4CH6 A;  4JI1 O;  4ZI7 B;  1AI4 A;  3OTO O;  2PUS A;  2WLL A;  3AK1 A;  4FLV A;  5L3E A;  5JQG B;  4MVO A;  2N74 A;  4EKW A;  1GH6 A;  1HNW B;  4CH5 A;  4YJ3 A;  3K5N A;  3B09 A;  3G67 A;  4D6T H;  1TUB A;  2QJ1 A;  1K92 A;  3LDC A;  3PJS K;  4KXR A;  3T2M A;  1HNZ O;  1QLE C;  3E8F A;  3SR2 C;  3H1I H;  1QLN A;  1GN6 A;  3APO A;  1N33 B;  1AJQ A;  4D7T A;  4DV1 B;  1GK9 A;  2A06 H;  2KKW A;  4JI7 O;  4FFB A;  1BE3 H;  3PN1 A;  1COW G;  1Q82 W;  3UCS C;  2DQ3 A;  2YXH A;  5LYJ B;  1N4C A;  3RYH B;  2OCH A;  1SQX H;  2YID A;  4JZG A;  2ILM A;  1KMI Z;  1EBO A;  2P4K A;  1NR7 A;  2UUB B;  1FFX A;  2EJ7 A;  5CA1 A;  2FML A;  4FJC C;  4DRX B;  2BTO A;  4P9O A;  2YIB A;  3E8G A;  4YJ3 B;  5EYP B;  2BE3 A;  1E1R G;  5F2V O;  1VQP V;  4CS3 A;  4DV7 B;  2EZP A;  4WFF A;  1SES A;  1MMM A;  1Y74 A;  5FL7 G;  4LF8 B;  4K0K B;  4IHJ B;  1TUB B;  1VF6 A;  3L72 H;  3M7M X;  1FFX B;  4UB6 Z;  3K5L A;  3JAR A;  3CRC A;  2EIL B;  3I55 V;  4NKG B;  1XI1 A;  5HFM A;  2WLM A;  1SQQ H;  1SF9 A;  3JD0 A;  5IWA O;  4LBE C;  2ZQM A;  2QSA A;  4DXW A;  2JEX A;  4B3S B;  1V54 C;  1XNQ B;  3JCU Z;  3OFN G;  3OEE G;  1I94 B;  2Y4T A;  1KP3 A;  1KKD A;  3HR0 A;  4MTG A;  3ABM B;  3R65 A;  4OPA A;  4B3R B;  5JJJ B;  3OMA B;  3VOU A;  4AHC A;  3OTO B;  2O57 A;  1IZ3 A;  1L0N H;  4GT1 A;  3E22 A;  3GWO A;  2KB1 A;  5EIB D;  2YIA A;  5LOV A;  3SPG A;  2EBO A;  5CBG A;  4LF9 B;  3ZMU A;  5FNV A;  4LH7 A;  3AK3 A;  4RQE A;  3WG7 C;  5A9G A;  1E1Q G;  1AIL A;  2PTM A;  5LL6 Y;  4DR6 B;  2CH7 B;  2PYL A;  1I0H A;  3HKD A;  4I9W A;  5CN0 A;  2ETN A;  5BR8 B;  2EIM C;  3VQY A;  5IJ9 A;  1GM8 A;  5J2T B;  2QDO A;  2ZR2 A;  2QGN A;  4XDK A;  3AG2 B;  3H9V A;  2AGA A;  2QEX V;  3J7A U;  3ABL B;  4IHJ A;  1XRE A;  3ASN C;  4LNU B;  3K59 A;  1OCC B;  1OCO B;  1OCR C;  4FM2 A;  3CCR V;  3BAB A;  2FKX A;  1XMQ O;  2HVK C;  4QE7 A;  4LP8 A;  5KAI Z;  1WP8 A;  3ZHR A;  4MW3 A;  3W7U A;  3C3S A;  2WLJ A;  5CBH A;  3SJA C;  1JX9 A;  2QE7 G;  4JTD B;  2LW7 A;  2G38 A;  1Q5O A;  4AIL C;  3O65 A;  1WA8 B;  4X1K A;  2EIM B;  4GX5 A;  2YUA A;  2EIK C;  3JD1 A;  3EXA A;  1P84 F;  4X1K B;  2ZNI A;  4JV5 O;  1M93 A;  1G4Y B;  5IJ0 B;  3K5O A;  2R9A A;  2BOC C;  2DWD C;  1W59 A;  3IGA C;  3AEI A;  2PY5 A;  4RAI A;  5FPO A;  4DV4 B;  1VQ9 V;  4G28 B;  5JJN B;  4CC6 A;  5EC2 C;  2P22 C;  1OCZ B;  5CA3 A;  3CCL V;  1TUE B;  3CB2 A;  1MNG A;  3T1C A;  4UV9 A;  2Q4P A;  2IM9 A;  4AQY O;  5CA0 A;  2JVD A;  4LF8 O;  3IC7 A;  3ZMZ A;  2EIK B;  3Q4H A;  3H1L H;  3SJB C;  4DV5 B;  5E1A C;  2E5L O;  3E86 A;  4PA6 A;  1Q86 W;  3ZRX A;  1N34 B;  2IJJ A;  2OCC B;  3A0H Z;  3HKD B;  5IYC O;  3J81 N;  4FLY A;  1S5H C;  3T4D A;  2PYJ A;  1XNR O;  3ZMS A;  1G6U A;  3BPZ A;  3JD3 A;  4H0L B;  3TJT A;  1FD9 A;  1M9N A;  3D3I A;  1Z5W A;  1N36 B;  4BR6 A;  1QVG U;  1Q43 A;  1I08 A;  5IY5 C;  3CCQ V;  2LGW A;  1FJG B;  3OE7 G;  3RN4 A;  1IBK O;  3JD2 A;  5JQG A;  1SS3 A;  1D5N A;  2EIJ B;  2ODM A;  2CTR A;  2HEP A;  5EIB C;  4J9Y B;  1FXV A;  1AR5 A;  3STZ C;  1R6N A;  2ZXW C;  2EIN C;  2B1I A;  4G27 B;  4WF9 V;  4O4I B;  1NTZ H;  1Q7Y W;  4KHP O;  2CAZ C;  5EBL C;  5KHK A;  2E75 B;  1YDX A;  1W0J G;  4LR3 A;  1GN3 A;  4LF6 O;  2QTS A;  1B06 A;  1PM9 A;  4KHP B;  1NKD A;  5IYZ A;  2R72 A;  4H44 B;  2Q7E A;  3CRM A;  3U10 A;  2AXT Z;  2YIB D;  1N8R W;  5LMN B;  2ADP A;  2E5L B;  2V4D A;  4PI2 A;  2M7W A;  2P6J A;  5H2F Z;  1FKA O;  5LHI A;  2HLD G;  3CCJ V;  4NR1 A;  1R3K C;  2DMX A;  1ZUQ A;  3IJ4 A;  3ASO C;  4H13 B;  5BMV A;  3MHS C;  1VF7 A;  2W0X A;  1AB3 A;  4TWK A;  5KMG A;  3H01 A;  1ZL8 B;  4WFB V;  2NN4 A;  1X59 A;  5LYJ A;  2P90 A;  2P5O A;  3RYH A;  2DN9 A;  4QJF B;  5D5P A;  1WA8 A;  3ICX A;  1EN4 A;  1FJG O;  2JGD B;  1IBL O;  3BFR A;  3L71 H;  3TXS A;  2K1E A;  1PNL A;  2LW1 A;  4OGQ B;  4R7C A;  4IL6 Z;  4DW0 A;  1BQ0 A;  3LSS A;  4ICG A;  1YJN V;  3SPI A;  1VQN V;  1VQK V;  3M8A A;  2Z3Y A;  4LF4 B;  2NR5 A;  2ZR3 A;  1W0K G;  2N04 A;  3L9D A;  3WFV A;  3L74 H;  3FX7 A;  2WLH A;  1Y67 A;  3CPW U;  1VMG A;  2PI5 A;  4DR1 O;  5IWA B;  1PL4 A;  3OAA G;  3RYI B;  5CB4 A;  2R9I A;  4UV8 A;  1WB8 A;  1WLE A;  2OCC C;  1AJP A;  3A8T A;  5B3S B;  2EUL A;  3A0R A;  1AVM A;  3JAR B;  1KBH A;  2UXC O;  3CC7 V;  4W4L A;  1VF6 C;  3HKE A;  3D36 C;  5H6R A;  1F4N A;  2F4V B;  4UCT A;  4QE9 A;  4MVQ A;  1S5J A;  1VAR A;  4PD4 F;  2WLL B;  2ZE7 A;  3CHX A;  2ZIO A;  1EZJ A;  1Z2G A;  4DUY B;  1S72 V;  2LFS A;  3OUF A;  1JMK C;  3D3Q A;  3F5T A;  4X62 B;  2ZE5 A;  2UUA O;  2CGN A;  2QA4 V;  2ZE8 A;  3AG2 C;  3ETE A;  2UXB B;  2X6B A;  4FZ0 A;  1KKC A;  4LFC O;  2ITD C;  4X20 A;  3F7V C;  2QR4 A;  5LMN O;  1R73 A;  2HKO A;  3T1Y B;  4FVM A;  2XTA A;  4O2A B;  1GM7 A;  2B1G A;  4CH4 A;  4K35 A;  4A5U B;  3W7T A;  5C8Y A;  3E22 B;  5KX5 B;  1BS3 A;  4WBN A;  4LF6 B;  4LF4 O;  1SQB H;  5BR8 O;  2WLI A;  4D7S A;  4J7K A;  2E74 B;  3K03 A;  5DEC A;  1GTO A;  5LHG A;  1D2D A;  1UFI A;  4B3M B;  4ASU G;  1DK1 A;  4ZI7 A;  5JCO C;  3OGI B;  3DXR A;  3LNM B;  4IYI A;  4X20 B;  3QTC A;  1VIB A;  3B8N A;  4O2B A;  1SC5 B;  4X1I A;  5C8Y B;  1UJW B;  4QNH B;  4PI0 A;  3VBB A;  3ML0 A;  1ZX3 A;  3CP1 A;  1V55 C;  4PJ0 Z;  3CWB H;  3Q4H B;  4PA9 A;  4Z2W A;  4LFB O;  4NTW A;  5KHI A;  3THO A;  2YEV A;  4ZHQ A;  4MVU A;  3JAW B;  4JYB A;  2Q0O C;  4DR2 O;  1A32 A;  4NXM O;  4U7O A;  1XMO O;  1J5E O;  4UCS A;  3QO5 A;  1FXK B;  2Q5Z A;  3LSQ A;  1RM1 C;  2LJ2 A;  3QO8 A;  1HNX B;  3RT3 C;  4TQF A;  1R3J C;  5LA6 A;  5KUM A;  4F6E A;  4Q6G A;  5KX5 A;  3JD4 A;  1Q6U A;  4UVA A;  4UCR A;  1K7D A;  2RCV A;  3B4S A;  3UKM A;  4FM0 A;  2ZD9 A;  3G6E V;  5KHH A;  2QM8 A;  3UO3 A;  1O9G A;  5EZY B;  4JI4 B;  4FLZ A;  4DRX A;  3ABM C;  4F6R B;  4FMT A;  1Y74 B;  2L6L A;  4I5S A;  1QR9 A;  4BIO A;  3BY6 A;  3JYC A;  5EC1 C;  3VQX A;  4JV5 B;  1K3E A;  4P9P A;  1I5Y A;  1K33 A;  2Y4U A;  4RO2 A;  3FFQ A;  5LGU A;  4I55 B;  4DUZ O;  4FZ1 A;  2DYS B;  5B1B C;  4QPK A;  2EIJ C;  4FLX A;  4JI0 O;  4DV6 B;  2JJ2 G;  4C7U A;  5E79 Z;  2AW9 A;  4DR4 O;  3SYP A;  2HJF C;  1Y4M A;  1VQ4 V;  3IFX A;  1CP9 A;  2EX3 A;  1SKV A;  1K4D C;  4TT3 G;  3CC2 V;  4NYK A;  1V9P A;  4FIP C;  3RBZ A;  1O9H A;  1XUQ A;  2ZE6 A;  2YI8 A;  1YJ9 V;  4B3T B;  1WPB A;  5H9C A;  4FFK A;  4LFC B;  1KUQ A;  1Y66 A;  2C2A A;  3RVZ A;  1WB7 A;  3UQ8 A;  1XBL A;  2AZ0 A;  4LWS A;  5LP6 B;  3JAS A;  4FLU A;  1NZ6 A;  3CC4 V;  1NJI W;  5KMG B;  2X6A A;  2UXD B;  2DYS C;  2QM4 A;  2IBZ H;  2WLN A;  4JI8 B;  4GKK O;  5LA6 B;  3W7X A;  2Q6A A;  2GSM B;  4UCO A;  1VQL V;  5B5E Z;  3RFR A;  1I7F A;  1XMQ B;  4JI8 O;  4GKK B;  1N32 B;  3H1J H;  5FNV B;  2VQF O;  2A3Q A;  1JFF A;  4LF5 O;  4DV3 B;  2B9Z A;  1IX9 A;  2P67 A;  5DN6 G;  4DR2 B;  1VEW A;  4DR5 O;  3K08 A;  3IC9 A;  2Q9L A;  4BAY A;  1YXB A;  1S77 D;  4DR1 B;  4DV2 O;  4XDJ A;  2OYQ A;  3G71 V;  1P4R A;  2XAJ A;  5K1X A;  3BA8 A;  4JTC B;  2F95 B;  2WLK A;  2P06 A;  1YHQ V;  4YY3 B;  3W7W A;  4DR6 O;  1IXB A;  4BW9 A;  4X1I B;  2BSK B;  2QWN B;  1ENV A;  1FXK C;  2N05 A;  1HP8 A;  2W0F C;  1PKX A;  1M90 W;  4NB5 A;  4MSW C;  1JOY A;  4TV8 B;  3M99 B;  2AZ2 A;  1AR1 B;  3X2Q C;  4Z1M G;  2NNU A;  2YXY A;  4CH3 A;  1IBM O;  5A2Q N;  4E2L A;  1VQ7 V;  2GBO A;  3SPJ A;  1SZT A;  2QKS A;  1H38 A;  3B40 A;  1PP9 H;  4TV9 A;  1LR1 A;  2DOS A;  2JEU A;  4JGS A;  3K58 A;  3RYC A;  1M57 B;  2IU3 A;  2B5U A;  3SYC A;  4LFA O;  2YXL A;  5IJ0 A;  3LDE A;  4B7E A;  3ZN1 A;  3SYO A;  2CTW A;  2XT9 A;  3K0G A;  1IUR A;  4K0K O;  4X1Y B;  3CME V;  3ZJZ A;  2F4V O;  2VWK A;  3ABU A;  4JF3 A;  3RW0 A;  2VQE O;  3ABT A;  1TVK B;  5JWP A;  5LGN A;  3ZCC A;  3K3W A;  2HHH O;  1R3L C;  3ETQ A;  3OT7 A;  1N34 O;  5DED A;  1XMO B;  4O4L B;  2UUA B;  3SGI A;  3FKS G;  4JI6 O;  3ZBH A;  1IBM B;  2YEV B;  1N33 O;  2UUB O;  3P3P A;  1ZL8 A;  1K97 A;  1H8H G;  2F1M A;  4JAV A;  2IJH A;  1ZAU A;  3KCY A;  3HKC B;  1R6T A;  4X64 B;  5LP6 C;  2CE4 A;  2ZIM A;  4GYC B;  5J9P C;  2UXN A;  3P32 A;  3H1H H;  3T1H O;  1HR0 O;  2KG7 A;  2X7R B;  2DW4 A;  5ITZ B;  3ZX6 A;  3JSL A;  1M56 C;  1QR8 A;  2AHZ A;  4LC1 A;  4YJ2 A;  3ABK C;  3S3X A;  4FPP A;  4OPH A;  2JJ1 G;  4BIU A;  3JAW A;  5IT9 N;  2F43 G;  1AI6 A;  1AP6 A;  1HW7 A;  5KA5 A;  2JRI A;  1KQS U;  5LMU B;  3OW2 U;  1F7Y A;  4GX1 A;  3SYA A;  3R66 A;  4JPR A;  5J2U A;  2Z5U A;  2P7T C;  4H33 A;  5JH7 A;  4PEL A;  2GUZ A;  1JJ2 U;  1IBL B;  3E89 A;  4UVC A;  4DV7 O;  2V7Q G;  4X65 O;  3TK1 A;  3K57 A;  4HNA B;  1L1F A;  2ZDI A;  5L3B A;  3K0D A;  4MT8 A;  1DF5 A;  1SER A;  3MDS A;  2QWO B;  1GN4 A;  3ABK B;  5KA6 A;  1SQV H;  3CRQ A;  1K9M W;  2VWJ A;  5AG2 A;  4MVS A;  1DGS A;  1URF A;  2EZO A;  4TUY B;  1F23 A;  1KEC A;  2Q69 A;  4U3F H;  2UU9 O;  2R70 A;  1BZK A;  2Y48 A;  1NI8 A;  4K8Z A;  2ZT9 B;  4I55 A;  4JAS A;  2JS3 A;  3HKC A;  4K8X A;  4DO2 A;  5B1A B;  3SPC A;  1H2L A;  1H2G A;  1HNW O;  4KP4 A;  2VQF B;  3K06 A;  5L3C A;  1K5Q A;  4WCE V;  2Q67 A;  3QO7 A;  3G6B A;  2NLJ C;  4GKJ B;  1NH2 D;  3MHH C;  3K5M A;  1QQC A;  4J7Z A;  4X9Q A;  1PNM A;  2A7W A;  1VQO V;  3FB7 C;  5LMU O;  4MTO A;  4GLX A;  1SA0 B;  2D3O W;  1OHH G;  5IY5 B;  1Q81 W;  3A2F A;  2RN9 A;  1YF2 A;  3UT5 B;  1LUV A;  2H3O A;  2GDS A;  3GB7 C;  4U7N A;  2CTP A;  1SRY A;  2HR3 A;  3CCV V;  2EIL C;  3HKB B;  1H2S B;  3W7S A;  4DR5 B;  4FK5 C;  4I4T A;  3SDL A;  1BCC H;  1ZTE A;  2Q7G A;  3N2G A;  4DV3 O;  3TCU A;  4I7Z B;  5B66 Z;  4B08 A;  1LNQ A;  3O9O A;  4JI5 B;  4MTF A;  4X88 A;  2DYR B;  2XAF A;  4O2A A;  1PD3 A;  4DR3 O;  4CS2 A;  2FB5 A;  3AG4 B;  1B6Q A;  4BIZ A;  4JYA O;  4YIP A;  2BOB C;  3ZRW B;  4QGP A;  3BVO A;  4U3J A;  4WFA V;  3LDD A;  1DLB A;  1FXK A;  1VQ8 V;  1RPR A;  1ROP A;  1BQZ A;  1VQM V;  3QF7 A;  1YIT V;  5ITZ A;  1WNS A;  3IAY A;  4I50 A;  2Q0A A;  3ZHU A;  1XNQ O;  1ORQ C;  1QBZ A;  5DM6 V;  4JYC A;  3OR6 C;  5KUK A;  1Q6H A;  1YVW A;  1XNR B;  1AI5 A;  1JPX A;  2WLI B;  2LFR A;  2HHH B;  3CYO A;  4DYL A;  1EM1 A;  2MK3 A;  4CS4 A;  1D5A A;  4X65 B;  4UVB A;  2X6C A;  4GZR B;  3N2K A;  1YCI A;  2LGQ A;  1VP7 A;  4ZHQ B;  1NVP D;  2GHY A;  4OX9 B;  5JVD B;  2W6I G;  1M57 C;  1OV9 A;  4I4T B;  2WAM A;  5BXZ A;  3S3W A;  3HKE B;  3P30 A;  1RSO A;  4JYY A;  4X8A A;  4JI7 B;  3JCZ A;  1FPO A;  1WAZ A;  2QTO A;  3BHP A;  1IDS A;  2JS5 A;  4F6R A;  1MG1 A;  2RJZ A;  4IT5 A;  3FYI B;  2CK3 G;  2QWQ B;  4B3T O;  5EBM C;  4IIJ B;  1K34 A;  4GUN A;  4HAM A;  5EYP A;  3U0Z A;  2PF4 E;  2OIE A;  2DYR C;  5IE9 A;  3OR7 C;  3SJC C;  4DV1 O;  3JAL B;  4W4K A;  1S76 D;  4JI0 B;  2IU0 A;  4B3S O;  3NXS A;  5J2T A;  2PGG A;  3F5W C;  4TQD A;  3TGU H;  4KFM A;  1HR0 B;  3HPL C;  1P7B A;  2K9P A;  2XOK G;  3E35 A;  2F23 A;  1SQP H;  4MVR A;  1NTK H;  4MVZ A;  1YSC A;  5LXT B;  2ATK C;  2ZXW B;  5CBF A;  4FM1 A;  3CX5 F;  2Y69 B;  4DUZ B;  4B3R O;  4XBF A;  5JCO A;  1MA1 A;  4U3J B;  2VQE B;  1Q90 D;  2IJK A;  4DR3 B;  5K1P A;  5LGT A;  3F7Y C;  2RNB A;  3BA9 A;  5KHG A;  2BTQ B;  4YY3 O;  3D8C A;  4LCU C;  2F66 C;  5JJE B;  2OIG A;  4JI5 O;  1V55 B;  3JSN A;  2A9H A;  2IH1 C;  3ETG A;  3RVY A;  2CUG A;  3CCS V;  3JAM N;  4DK0 A;  4NXM B;  5D5Q A;  1KYO F;  2OTL V;  3OTF A;  1UPG A;  4ZIB A;  3ASO B;  5BZB A;  4WFE A;  3LNN A;  3U11 A;  1N32 O;  5B1N A;  2XHB A;  3FAV A;  1HDJ A;  4HZ3 A;  2UXC B;  2DE0 X;  5TIS Z;  2UXD O;  3TXQ A;  4LF7 B;  1SQG A;  2FL4 A;  4E4E A;  1JCH A;  2P4V A;  3TET A;  3B8M A;  2QKA A;  3B2E E;  4P30 A;  4NTY A;  4G2K A;  2RDC A;  5J2U B;  2Q68 A;  2WA4 A;  3ZHV A;  1J5E B;  4GX2 A;  2QWR B;  2UXX A;  1H2N A;  3K9A A;  3OD4 A;  4NTX A;  2E3C A;  1THZ A;  4PA7 A;  1B04 A;  4PA3 A;  2H8P C;  2VRZ A;  4UFZ A;  3VQW A;  1XHZ A;  1OZ0 A;  2E76 B;  4J7J A;  1BHB A;  3ZHQ A;  3CJH A;  4X66 B;  4IYH A;  4O4J A;  2GUZ B;  4YHH O;  2WSS G;  4J10 A;  3RYF A;  4DW1 A;  4O4J B;  1FS0 G;  3ZED A;  3JAK B;  1RM1 B;  2ARH A;  3HB3 B;  3E8B A;  1CEZ A;  1M5I A;  1ZLZ A;  4LH6 A;  3L73 H;  1VQ6 V;  2XUM A;  1SZX A;  1JQ0 A;  4TOI A;  3D36 A;  1OCC C;  1OCO C;  4LF9 O;  1BL8 A;  3ABL C;  2RMK B;  2V1D A;  3ASN B;  1ZSP A;  3SJQ C;  5KAF Z;  3CXC U;  2QKC A;  4CZZ A;  1R6K A;  4QPJ A;  1RPO A;  3T1H B;  3JAK A;  2FTK A;  4UXN A;  1BMF G;  3X2Q B;  1L0L H;  5GW7 A;  1KU9 A;  3RYI A;  5CB4 B;  4R50 A;  1XIL A;  3RWR D;  1S0V A;  1MOF A;  4UCV A;  3JAL A;  2HJD A;  1EZV H;  4I9Q A;  3OEH G;  1XL6 A;  1K73 W;  2ZIN A;  4JAU A;  3AG7 A;  4GX0 A;  5B1A C;  1K5S A;  3SYQ A;  4L8J A;  3JAT B;  2RQ6 A;  3RYF B;  3N2G B;  2WWW A;  2HFE C;  3QNE A;  4J80 A;  1MZF A;  1R3I C;  3FB5 C;  3MD0 A;  4NVP A;  4O4H A;  3K79 A;  3J80 N;  3ZHT A;  4HNA A;  4DK1 A;  2BTQ A;  2Q73 A;  3STL C;  1DF4 A;  4RWU A;  2XAS A;  3WU2 Z;  3DXR B;  2H94 A;  3QVN A;  4PV1 B;  4LNU A;  1QVF U;  5HFL A;  4TV8 A;  4DV0 O;  4F4L A;  1XL4 A;  3NR7 A;  1KC8 W;  1TA8 A;  1QLE B;  4JI4 O;  4DV5 O;  4NXN O;  2LP7 A;  2BCC H;  2R9R B;  1YZB A;  2OTJ V;  4EEQ A;  5GON B;  3AG4 C;  4NXN B;  3I56 V;  5JH7 B;  3OUS A;  3GWK C;  3H1K H;  1OJH A;  1YI2 V;  2ADQ B;  3B77 A;  4DUY O;  3OM3 B;  2W6J G;  2UUC B;  1GRJ A;  3DC6 A;  1JJO A;  2CDY A;  5L3G A;  2ZDI C;  3OGC C;  3WB2 A;  5LOV B;  1W2B U;  1XEQ A;  3ZHS A;  1DTO A;  1AR4 A;  1GMG A;  1MSW D;  2DJV A;  3MAQ A;  1QNM A;  1Y76 B;  1IVS A;  1K8A W;  2AHY A;  3DGE A;  3BEH A;  3E83 A;  2IJI A;  5EBW C;  4UCU A;  4JYA B;  2X0L A;  2PZS A;  1JR9 A;  3KZI Z;  1OCR B;  1S3J A;  2UU9 B;  4TUY A;  2LO1 A;  2KSD A;  4O2B B;  3ZMV A;  3JAS B;  3T4Z A;  3EHB B;  1FAF A;  1GAX A;  2A0L A;  4JI2 B;  1N36 O;  3N2K B;  4R6Z A;  4ZBM A;  1PV0 A;  1B3Q A;  3GVM A;  4N21 A;  5GON A;  5IYB O;  1ZWI C;  1YEW A;  5EZY A;  1GM9 A;  1V54 B;  1G8M A;  2OT5 A;  5LBQ A;  2IH3 C;  3UM7 A;  3G4S V;  4HYO A;  4LF5 B;  4Z1V A;  3FAV B;  3CEI A;  3ZRV A;  5IYD O;  2M6Y A;  1AP5 A;  1LUW A;  3ZMT A;  3ZIA G;  2XND G;  3ZRW A;  3LUT B;  4LWS B;  4FLT A;  2QM7 A;  4X62 O;  2EIN B;  2CTQ A;  2PI4 A;  2D2C B;  4CC5 A;  1SA0 A;  1BSM A;  1U97 A;  2VS0 A;  3OMN B;  1E79 G;  4MW8 A;  4GKJ O;  1G1X B;  5CA1 B;  4J42 A;  4OX9 O;  1IXM A;  4FFB B;  1XHX A;  1K4C C;  1ARO P;  3P3N A;  4RQF A;  2YDE A;  4J41 A;  5KLV H;  2ZCE A;  1S5L Z;  3C3T A;  1H2K A;  3I5D A;  1H8E G;  1KB9 F;  1GKF A;  4L87 A;  2L35 A;  4GCZ A;  4LFB B;  4TSF G;  3WB1 A;  1BGY H;  2YS8 A;  3APQ A;  3AG1 B;  2EJR A;  3C90 A;  3CSX A;  5JVD A;  1AJN A;  3EVK A;  3JAT A;  3ZN0 A;  5BY1 A;  4AI8 A; 
#chains in the Genus database with same CATH homology
 1L0L H;  2FYU H;  3L72 H;  3BCC H;  2A06 H;  5KLV H;  3L75 H;  3L73 H;  4U3F H;  1NU1 H;  3L71 H;  1BE3 H;  3TGU H;  4PD4 F;  1PP9 H;  1KB9 F;  1PPJ H;  2IBZ H;  4D6T H;  1SQQ H;  3L70 H;  2BCC H;  1BGY H;  3H1L H;  1SQP H;  1NTZ H;  1SQB H;  1NTM H;  3H1H H;  1NTK H;  1BCC H;  1EZV H;  1SQX H;  1L0N H;  3CX5 F;  1SQV H;  3H1J H;  3CWB H;  3CXH F;  1KYO F;  3L74 H;  3H1I H;  1P84 F;  3H1K H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...