1SQXH

Crystal structure analysis of bovine bc1 with stigmatellin a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
67
structure length
67
Chain Sequence
ELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 17
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1sqxH00
1PPJH 2IBZH 1SQPH 1NTKH 2A06H 3L70H 1L0LH 1NTMH 3L74H 2BCCH 4PD4F 3L72H 3H1KH 1SQXH 3CWBH 3L71H 3H1JH 1BE3H 3H1IH 3H1HH 1EZVH 1SQQH 3L73H 1KYOF 1SQBH 4D6TH 1BGYH 3TGUH 1P84F 4U3FH 1L0NH 2FYUH 1NTZH 3BCCH 3L75H 5KLVH 1SQVH 3CX5F 3H1LH 1PP9H 1BCCH 1KB9F 1NU1H 3CXHF
chains in the Genus database with same CATH superfamily
2R72A 5CA1A 3W7SA 2HVKC 4LP8A 1XMQO 2ODMA 1SZXA 3NXSA 2WLNA 4JTCB 4IHJB 3ETEA 2FB5A 1NTZH 1IZ3A 3T1HO 4YY3O 1S5HC 4IIJA 2QKSA 2EULA 3LNMB 3K3WA 1BMFG 4J7JA 1YVWA 4EB6B 1QLNA 3ZN1A 3CCRV 2OWOA 1RSOB 1EN4A 3AK2A 1GO3F 3CE2A 1JQ0A 1RPOA 1KBHA 3T2MA 2ZNJA 3LSSA 3U0ZA 4FJCC 2IH1C 1XL6A 2VQEB 3ABMC 1T5EA 1THZA 2ZKOA 1KKCA 4WFGA 4JI6O 4X66O 5BR8B 3L74H 4DV1O 4X8AA 4GCZA 5H2FZ 5LA6A 3OT7A 2YUAA 1SQXH 2WWWA 4Q20A 3MD0A 1FAFA 3T1YB 2CK3G 1FD9A 2CGOA 4JI5O 1V54C 5GTIZ 4PA6A 2AZ0A 4KXRA 4RWUA 2UXXA 4PA9A 5JWPA 4TUYA 2KQXA 2EBOA 1XHXA 3AG2B 4K0KO 3L73H 2CH7A 4IGGA 3OGCC 5D5PA 1IURA 3L75H 5ITZB 1Y4MA 5KHHA 4DRXB 3ETQA 4EFEA 4X9QA 3RYIA 5CBFA 4DR7O 2FL4A 3ZJZA 1WJZA 2LQTA 5IDJA 2EILB 1J95A 3ZS8C 5JH7A 3LNNA 1IBLO 3F5TA 2Q67A 4PI2A 3T4DA 4LF9O 3JAWB 1QLEB 1AR1B 2XNDG 2YXHA 3IFXA 4B3SB 3IJ4A 1AI4A 3WG7B 1Y76A 1SQVH 4B3RB 5JJJB 4LR3A 1VQ9V 4U3JA 3B09A 1SETA 5CN0A 4HZ3A 4DR1B 4JZGA 2CTQA 4DYLA 3HKCB 4YHHO 1R3LC 5IY5B 1ZSPA 4DXWA 1ROPA 4GKKB 5IE9A 5KX5B 1NH2D 4JI0B 4P30A 4LF5B 1ZAUA 3PJSK 2R9AA 1L0NH 4TV9B 2CDYA 5LMUB 2UUCO 1VQKV 1R6KA 3X2QC 3C3TA 2IW5A 2K9PA 2PYLA 1TUBA 2R70A 2QWQB 1L0LH 4FZ0A 4XDJA 3SPJA 3K5OA 4J80A 4PDMA 5DEDA 5CA0A 1KECA 4DV2B 4CC5A 1EZVH 4MW3A 3AG3C 4JASA 1ZUQA 2ZIMA 3D8CA 1RM1C 1GAXA 3T1CA 3AG1C 1R3KC 3KCXA 2ILMA 3RYCB 2JS3A 3AG1B 1N0NA 1XNQB 4LFBB 2RJZA 3JCZA 2V1DA 3K0GA 2Y0IA 4CC6A 3E2EA 3CWBH 2NNUA 1VQOV 1FFXB 3QO7A 5FPRA 2W0FC 2ITCC 2HFEC 4D6TH 3Q4HB 3GWOA 1Q6HA 4B3TB 4O4LB 2OCCB 4JAAA 4TSFG 4MW8A 1FPOA 3UKMA 2DYSC 3SPCA 1ZX3A 3JD2A 4CS4A 1N34B 3OTFA 1HW7A 1JFFB 2ZR3A 4LH6A 4QPKA 4UXNA 3CCUV 1R3JC 1GK9A 4J7KA 5J2TA 4DV0O 4DK0A 3MAQA 2YS8A 3RN4A 1GM8A 1P4RA 1NKDA 4YJ2A 5CBGA 2EIMB 3ZMTA 4JTDB 4FMTA 2JJ2G 1K5SA 4NTWA 3K58A 2JEUA 2QKCA 2LJ2A 3ZHQA 2QM8A 3HKEA 1M56C 4I5SA 1BGYH 2ADPA 3QF7A 3QTCA 4GX2A 1DGSA 5CA0B 3DGEA 4QNHB 4OPHA 3F7VC 4UVAA 2UUBO 3D3QA 2BE3A 4RO2A 1CEZA 5TISZ 2QTSA 4DR4O 3HKDB 1P49A 5IYCO 3JAKA 5JVDA 3JAKB 4DR1O 2B9ZA 4MSWC 1XNRO 3MHSC 4P9OA 2P4KA 3QO8A 1V55C 1XOUA 1N33O 2GDSA 2CUGA 2ARHA 2Q0AA 3G67A 3SYQA 3CCLV 4X1KB 4ZI7B 5LMUO 1K9MW 1XMQB 1GN4A 2DN9A 1S77D 4QJFB 1RP3B 3P3NA 3APQA 4EKWA 1O9HA 1AB3A 1SQQH 4PDLA 2EIJC 2Y69B 3QO5A 4DV2O 2EIJB 3I56V 1G4YB 3K06A 2QSAA 4K35A 5J2TB 1YTFD 1EN6A 4OXSA 4X1IA 1Y74A 4LF7B 3UQ8A 2E75B 2VWKA 4AI8A 3CRCA 4CH3A 1YJNV 3LDEA 2WLLB 3M99B 2WA4A 2ZDIA 1IVSA 1P84F 1URFA 4O4IB 4K8ZA 2UXDB 1PL4A 1WA8A 3RYFB 1IBMO 2Z5UA 1BQ0A 2XTAA 2P5OA 4CH5A 4NR1A 3L70H 4F6RA 1Q90D 5BZBA 4DR3B 1R6TA 4AHCA 3FX7A 1UFIA 5CA3A 1HWYA 3S3XA 3OM3B 3JD4A 3G6BA 4LFAB 3TGUH 1QHTA 4KUMA 5E79Z 4BWAA 3TJTA 1YTFB 2ZT9B 3D3IA 4PELA 4YY3B 2IJJA 2QKAA 4XDKA 3IAYA 1GM7A 3ASNC 4K0KB 2ZE5A 4FLWA 2PGGA 3EHBB 2WSSG 1AI6A 4FVMA 3RW0A 4H13B 3OGIB 3IC9A 4JI7O 1MA1A 3JYCA 1JOYA 3SYOA 5LMNB 3DSQA 3BHPA 4W4LA 1IBLB 5IY5C 1J5EB 1NTKH 3CJHB 5IT9N 1NTMH 1OCOC 3E22A 2ZE7A 4JI6B 2X6BA 4J9YB 5KA5A 1TVKB 2HP8A 2UUAB 2B1GA 2B1IA 2XHBA 3JARA 2OT5A 1XMOO 1EN5A 3E8BA 1MG1A 5LHIA 4GKKO 5GONA 1YCIA 4AQYB 3DXRB 4ZHQB 5KMGB 2QDOA 2EINC 4GLXA 5EBWC 3BY6A 3JD3A 3MDSA 4J11A 4K8XA 1X4TA 2DYRC 2UUCB 1B3QA 3OR7C 1H2NA 2YIDA 3H9VA 4DV7B 1BS3A 3CMEV 1FFTB 2D3OW 4UCTA 4BIUA 3EFFK 1MZFA 3HR0A 1MABG 4X1YA 1VF6A 1PL0A 4CH4A 1GRJA 2IU0A 5FL7G 4I4TA 4O4JB 4JF3A 4IYHA 2EZPA 4NTYA 2E5LB 1JPXA 1K33A 4LFBO 3AG4B 2RDCA 3AG4C 2CTPA 3HB3B 2ZDIC 2ZXWC 1N36B 4PD4F 4QGPA 1F23A 3E89A 4WFEA 1EM1A 2P6JA 4DW0A 3JSNA 2HHHB 2YI9A 1OCCC 3E35A 5CMUA 2ZQMA 4UB6Z 2LFRA 3ZIAG 4EB6A 3CYOA 3ZRSA 5EZYA 3B2EE 1EZJA 1JX9A 1M56B 2MK3A 5CB4A 2BTQA 2LW7A 2Q6AA 1BHBA 4JI7B 3E8HA 2XAGA 4NTXA 3ABTA 1IBKB 4FLUA 4RQFA 2M7WA 1JMKC 1AROP 1QVGU 2XUMA 5EYPB 1Q8IA 1H2GA 2EILC 2UU9O 1XNQO 2EZOA 2YEVB 3BRCA 4H33A 3FB6C 1U97A 2GTAA 3SYAA 5EYPA 4MVOA 1RFYA 1MZEA 2R9IA 1UJWB 2ZR2A 4G27B 2UUAO 1I5YA 1FFXA 4B3TO 4FFBB 1TUEB 4G28B 1DTOA 1H2SB 3ML0A 1PM9A 4JYYA 1XMOB 4HAMA 3OEEG 1SQGA 3ZMSA 2ZM6B 1D2DA 3RYCA 1N32B 3VQVA 5K1XA 1FYJA 4GKJO 2EIKC 3WFVA 5KUMA 1K3EA 3KCYA 2CH7B 1GM9A 4DV0B 2VS0A 4UB8Z 2A9HA 3AG2C 4KHPB 1JJOA 4PV1B 1H2MA 4FZ1A 1TUBB 4TWKA 2YI8A 2GUZA 2EJRA 3W7XA 1OCRC 3OFNG 1R1BA 2V4DA 4TQDA 2E3CA 1W59A 4LNUB 4FLYA 4MTOA 1XUQA 1K92A 4LF7O 4I50A 4WFBV 1QLEC 2AXTZ 3BPZA 4D7TA 2UUBB 1PNLA 2EJ7A 2FMLA 4JTAB 5IJ9B 1HNWO 5LP6B 2MW2B 3L72H 4JZ2A 4X1YB 4F4LA 2YC0A 4UCRA 1N36O 5KUKA 2JS5A 4ICGA 3H1HH 4DW1A 1GN3A 1XNRB 1Y74B 3SPIA 5IWAB 5B5EZ 2HHHO 1PNMA 1N33B 4EFBA 4YIPA 1AR5A 2YICA 3CMAV 2JGUA 5JCOA 5LGNA 3VQWA 2QJ1A 1TGOA 4LFCB 1SERA 1Q86W 1QU7A 2Q5ZA 3CPWU 2WLIB 3ABLC 4UCOA 5LYJA 1OZ0A 1AJPA 2OIEA 1D5NA 3APOA 2QWRB 1ENVA 2V7QG 1JA8A 3CCSV 4NVPA 4DR2B 2DWEC 4JV5B 1Y67A 1WB7A 1R73A 4N23A 4NB5A 3S3WA 3X2QB 5HFMA 4PI0A 4ABMA 3B4SA 2P06A 2RQ6A 3JASA 2UXNA 3F5WC 2YXYA 1HDJA 1SKVA 1XQ8A 4FM1A 5EIBD 3JATB 2VWJA 4Z1VA 1ORQC 1RM1B 4J41A 5KHIA 1OHHG 3ZN0A 3CC7V 1KYOF 4I55A 1COWG 3CX5F 4X64O 2Q68A 4L87A 5IJ9A 2E74B 1M9NA 1PD3A 2DMXA 3FAVB 3W7UA 1OCZC 1V9PA 4FK5C 4FFBA 4WF9V 4NXNO 1VEWA 1S72V 2Q8VA 4DV4O 2Q69A 3G80A 2XASA 3ZRWB 1MMMA 4CH6A 4O4HB 2LP7A 4G2KA 3ASOC 4CBCA 5L3DA 4MT8A 3ABKB 5LGTA 4YXWG 4JI1O 4PHZA 3CD6V 1SF9A 5CBHA 2WLLA 5CA1B 5LL6Y 4DV3O 3ICXA 2F4VB 1J5EO 3H1KH 4JI2B 3J7AU 2DQ3A 2E5LO 4D7SA 4HNAA 1MNGA 4HYOA 1DK1A 1WP8A 4OX9B 3RYHB 4R6ZA 4YJ2B 3ZRXA 2Q73A 1RSOA 1XBLA 1Y6XA 4MVQA 1YHQV 3FYEB 2Z0AA 4RAIA 1KD1W 1M57B 2YIAA 1M57C 1ZWIC 1ZL8B 1JVMA 2PI4A 3TXQA 1LUVA 4MTGA 3W7TA 1TAEA 1RPRA 2PUSA 5L3EA 3E22B 3WB2A 5GW7A 4LBEC 4R50A 4JPRA 3CEIA 1VQ5V 1F4MA 1NT2B 1VQLV 3JD0A 3B8MA 1AILA 4DR2O 5IJ0B 5KHGA 1I94O 3HKBA 3JALB 1N8RW 4DR6B 2GBOA 5EIBC 1KU9A 1S5JA 4J10A 4TT3G 4UUJC 3STLC 1M4UA 4N21A 2BOBC 3M8AA 1AR4A 3SJQC 1SC5B 4R7CA 4E4EA 2VQEO 2CE4A 2RNBA 4BW5A 1GH6A 1I08A 1K4DC 5LGUA 1VF6C 3UO2A 3RYHA 3LUTB 4DV1B 1E79G 5L3CA 4GT1A 1N0JA 5LHGA 2GV9A 2ITDC 3ZX6A 5C8YA 3ZEDA 3EVKA 3K79A 1GKFA 3JAMN 2L35A 3RYIB 1BCCH 3BA9A 1NR7A 2W6JG 2WLMA 3T1YO 3U11A 4YJ3B 1L1FA 1KMIZ 1KQSU 2HJDA 3GB7C 1N32O 1SA0A 2A3QA 3HPLC 3JCUZ 4A5UB 4GKJB 2A7WA 2X6AA 4NYKA 4FLZA 2DYRB 2N05A 3QNEA 4DV4B 1IX9A 2WLIA 4MVRA 3L9DA 3W7WA 1ZL8A 4LF8O 1FJGB 1SQFA 3AK1A 3ZHRA 5B1AC 4H37A 2W0XA 3SJBC 3WB0A 2IJHA 3SJAC 4B3MO 1ZLZA 3FAVA 4DR5B 3SYPA 2KG7B 1PKXA 4JYBA 2UU9B 1YEWA 2AZ2A 2AHZA 2CTWA 4DV3B 2YXLA 4PJ0Z 3A0RA 4KFMA 4QIWF 3DXRA 5IYZB 3ZMVA 1GN2A 5FPOA 4H0LB 1YSCA 4DUYB 4KL1A 1R3IC 1GMGA 1W0KG 4GX0A 3AK3A 3ZHUA 1NBMG 2AHYA 1YJ9V 3BABA 2OIGA 2P22C 3D36A 1VQNV 2ZM6O 2GTSA 1BSMA 2RN9A 4LNUA 4Z2WA 4JYAO 1K97A 3FYIB 2F66C 1P7BA 4H44B 3UT5B 3O65A 3CC4V 1XL4A 1IXBA 4CS3A 3OE7G 5H9CA 2F43G 2ZCEA 2A79B 4O2AA 2LFSA 1F51A 3C3SA 4LWSB 3OUFA 3SR2C 3RFRA 3J81N 3OTOB 3TXSA 2NN4A 1BHAA 4DO2A 5EK0A 1AVMA 1QNMA 5DECA 4RUFA 1XHZA 1HNWB 2CTRA 2WAMA 1HNXB 3SJCC 3K08A 2WLJA 3KKYA 3CRRA 2HKOA 1OV9A 1TA8A 2K1EA 5KMGA 4UVBA 4F6EA 4IL6Z 2DOSA 1HR0O 1S5LZ 1GTOA 3RBZA 1WPXA 1VARA 3OMAB 4LH7A 5AG2A 2KSDA 4MVMA 2Y69C 1G1XB 3UT5A 4X64B 3ABMB 4PA3A 4LFCO 4O4HA 5KAIZ 3BCCH 5J9PC 3ASOB 3FB7C 1B04A 2NR5A 5A9GA 5IYDO 1K5QA 1S76D 4QPJA 3ZHSA 5D5QA 1OJHA 2IJKA 2RMKB 4IYIA 1VQMV 2XAQA 1PPJH 3A8TA 3CRAA 4LF8B 5JCOC 1FJGO 1O9GA 5LA6B 4DR5O 1FXKA 3CRMA 2JRIA 3N2KB 2QE7G 4P2ZA 4RUEA 1BT8A 1KB9F 4E2LA 2JGDA 2IBZH 5BMVA 1VMGA 3JALA 5DN6G 4WBNB 2JIZG 4Z1MG 4DUYO 1SRYA 5FNVB 2QM4A 4RQEA 5H6QA 2DWDC 4GX1A 4GZRB 4B3RO 4O2BB 3RWRD 3SPHA 3OR6C 1BQZA 1S3JA 1KP3A 3K59A 4MVZA 2KKWA 2Q4PA 4JYAB 3K9AA 3OW2U 4DV5O 2HJFC 2O57A 1QVFU 4JI0O 2XAFA 1I5XA 2ZE8A 4ZOLA 2HLDG 4X20B 1FXKC 1DF5A 2P4VA 3CHXA 3P3PA 2FYUH 2Q0OC 2WPDG 3SDLA 4DV6B 2OCHA 5CB4B 4JAUA 5KHJA 1QBZA 3F7YC 4R8CA 1YF2A 1OCOB 2Q7EA 2IH3C 3NR7A 1I94B 5EZYB 1XILA 5LXTB 4LWSA 4ZI7A 3CP1A 4NKGB 4EEQA 2DQ0A 2H94A 4KP4A 3JARB 2ZIOA 3ZBHA 5LP6C 3B8NA 5KA6A 3JASB 2R9RB 2Q9LA 4X89A 4GUNA 4X65O 1PNKA 4BIOA 2UXBO 1HR0B 2EX3A 4TV9A 2F23A 4I0XA 3LSQA 2X0LA 3D36C 3AEIA 4O4IA 5FNVA 1YI2V 1N34O 4LFAO 4WBNA 3LDDA 1Y66A 3UCSC 5B1AB 1VQ4V 5BMVB 4BAYA 4XDLA 3VQYA 3CXHF 3ETGA 3QG5A 2CGNA 4J9ZB 4ZIBA 2G38A 3CCQV 1UPGA 2LW1A 4X88A 3ZRVA 4X62O 3K57A 2OCCC 3QVNA 1M5IA 2ZNIA 5B1BC 2PYJA 5B1BB 4U3FH 5B3SC 2ZD9A 4MVUA 3H1LH 5B1OA 3CXCU 5JH7B 1SZTA 3AG7A 4U7OA 4P9PA 4BR6A 2DW4A 3GVMA 5LMNO 4I7ZB 5LHHA 3ABUA 1SS3A 4DUZB 1JFFA 3ETDA 4ZHQA 3ZMUA 2OTJV 4NXMO 1NJIW 1VP7A 1BE3H 3VQXA 1MOFA 4GX5A 3AG3B 3EXAA 4LCUC 4TV8B 4XBFA 3G71V 1AI7A 3HKCA 3R66A 1DLBA 4C7UA 3CCEV 1YDXA 1AJNA 4CZZA 3KG2A 1IXMA 2BTQB 1LUWA 2QM7A 4AQYO 1WB8A 4X1IB 5B66Z 1QR9A 3O9OA 4FFKA 4DK1A 1XREA 3P32A 2BTOA 2UXCO 3OAAG 2DYSB 5L3BA 4DV7O 1I7FA 3K0DA 2VQFB 3R65A 5GONB 3JSLA 1LNQA 1PV0A 1B6QA 4FIPC 1GN6A 4JI4O 3OTOO 4MS2A 1VQ8V 1TVKA 3BFRA 1W2BU 4B08A 4F6RB 1M90W 3IC7A 1HNXO 2WA3A 4PA7A 4TQFA 1Q6UA 3SPGA 2UXBB 3K04A 1MSWD 1XI1A 5E1AC 2Z3YA 4WFHA 1E1RG 4O4LA 5A2QN 1IBMB 4O4JA 3K5MA 2HG5C 1Q81W 4L8JA 4DR3O 3A0HZ 3HKEB 1Q6IA 2QGNA 1F7YA 1OCCB 1HNZB 3FKSG 5H5NA 2QTOA 4WFFA 1V54B 4FPPA 3CB2A 3BAAA 4WCEV 3K5NA 2BOCC 1Z2GA 2ZINA 3DC5A 3BVOA 1W0JG 3UM7A 4X20A 1H2LA 2OTLV 1Z5VA 4Q6GA 2ETNA 1N4CA 1K7DA 5BXZA 2WLHA 4PA4A 1WA8B 2IU3A 4JI3B 3RGBA 3Q4HA 4FM2A 4HBNA 4UCUA 2WLKA 3CRQA 4K3AA 1SA0B 3THOA 2EIKB 2KB1A 5DM6V 1AP5A 5JJNB 3N2GB 4YJ3A 4CS2A 5JVDB 1Q43A 1M93A 3UO3A 1KKDA 1H8EG 2PI5A 3A0BZ 1FXVA 3FB8C 4UV8A 1LR1A 2XAJA 3OMIB 2C2AA 3U10A 3BA8A 1Y76B 3N2KA 1BL8A 1VF5B 3RVYA 5LXTA 5JQGB 3CS5A 4DV5B 4ASUG 2JK5C 3IGAC 1ZTEA 4KHPO 4W4KA 2N74A 5LOVB 4FLTA 1Q3EA 2JVDA 1WPBA 2B5UA 3FB5C 3T1HB 1AJQA 2DE0X 2FKXA 5HFLA 2PY5A 4I9QA 2NLJC 5JJEB 1AP6A 3ASNB 5LYJB 2Q7HA 2YEVA 3LDCA 1CP9A 1NVPB 2Y0PA 4IHJA 3CJHA 1VQ6V 3TETA 3CCMV 4UV9A 3E8GA 4U7NA 4X65B 4JI8O 2H8PC 3RVZA 3E83A 2A0LA 4I9WA 1VQ7V 5B1NA 3CCJV 5IYBO 2HVJC 2FTKA 3ZCCA 1NU1H 1S0VA 3FD9A 3VOUA 4UCVA 3B40A 5LOVA 2N04A 1HP8A 4BW9A 3G6EV 2P67A 4JI5B 3CC2V 4LF6B 2D2CB 5EBLC 1K8AW 3WU2Z 2ZXWB 1VF7A 3OUSA 2PTMA 3JATA 4DV6O 1QQCA 2QWPB 4X62B 1YIJV 3ABLB 2PF4E 1L8DA 5BY1A 4I0XB 2EIMC 4JAVA 2LGQA 2ADQB 5EBMC 3H1JH 3H1IH 2EINB 2QA4V 1SQBH 4JV5O 1VQPV 1IBKO 1WAZA 2HR3A 4LC1A 3RYFA 4IT5A 2VRZA 4DUZO 1CPYA 1NR1A 2LGWA 3CCVV 2A06H 2Q7GA 4LF9B 1JCHA 2IJIA 4FLXA 2AGAA 2H3OA 4QE9A 1EFRG 5IYZA 3DTUB 1WN7A 3ZMZA 1YZBA 2BSKB 5F2VO 1NH2B 2Y4UA 1H8HG 2YDEA 3I5DA 3B77A 5FLXN 5C93A 4MTXA 4UVCA 1G6UA 1A32A 3BEHA 1X59A 4LF4O 2CAZC 2Y48A 4B7EA 1MSDA 2X6CA 3WB1A 2BCCH 4LF5O 4IIJB 2JJ1G 2P7TC 3L71H 3OMNB 4ZOLB 4NXNB 1F4NA 2ATKC 3P30A 4ZBMA 4GYCB 2X7RB 4X1KA 4TV8A 5J2UA 3PN1A 1OCRB 1H2KA 3GWKC 2VQFO 3SGIA 1NS1A 4J42A 2W6IG 3H01A 4DR7B 1EBOA 4JI1B 4FLVA 1FS0G 2F93B 1YXBA 1US6A 3OD4A 1CXZB 3ABKC 4UFZA 2F4VO 4NXMB 4J7ZA 5C8YB 1QCEA 5H6RA 4JI2O 3E8FA 3STZC 4MVSA 5LBQA 2QWOB 4JI8B 1SESA 1SQPH 3JD1A 1KC8W 1K34A 1P7GA 2JGDB 3OEHG 1D5AA 3RT3C 1NQTA 1V55B 5IWAO 1Q7YW 1FKAO 2E76B 5K1PA 1B06A 2L6LA 2DJVA 2LO1A 1XEQA 3WG7C 4LF6O 1QR8A 1WLEA 4JYCA 1FXKB 4PDRA 2JEXA 4JGSA 1WP7A 4OPAA 2UXCB 1IDSA 2QR4A 2Y4TA 1YITV 3M7MX 5L3GA 4I4TB 3HKDA 1NI8A 3KZIZ 1Q5OA 1I0HA 4DR6O 1JR9A 1XDCA 4JI4B 4UCSA 1FXHA 4OGQB 1JJ2U 5KX5A 4O2BA 3VBBA 4JI3O 3I55V 3JAWA 3FFQA 2HEPA 1NVPD 1U96A 3MHHC 2M6YA 2P90A 2QWNB 3G4SV 2ZE6A 1PP9H 4HNAB 3DC6A 1VIBA 1H38A 4DR4B 3A2FA 5EC2C 2YIBD 4X66B 5BR8O 1YJWV 1K73W 2RCVA 2YSUB 2KG7A 4LF4B 3J80N 1E1QG 3C90A 1HNZO 1BZKA 2JDIG 4I50B 2XAHA 2AW9A 4BIZA 2YIBA 4TUYB 3ZRWA 5ITZA 4FM0A 5KHKA 2F1MA 1OCZB 4ZKIA 5KAFZ 3LSUA 4O2AB 5KLVH 5LP6A 5IJ0A 2GHYA 3CSXA 4QE7A 5L3FA 3HKBB 3K5LA 4YIOA 2OYQA 3TK1A 3K9SA 1M1KW 4B3MB 4B7KA 5J2UB 1AI5A 1NZ6A 1R6NA 1KUQA 3SYCA 2GUZB 2PZSA 3ZHVA 4WFAV 1G8MA 1KP2A 4U3JB 5GTHZ 4PDVA 4MTFA 4I55B 4TOIA 5JQGA 2IM9A 1DF4A 1Z5WA 5B3SB 4B3SO 2GSMB 3T4ZA 1Q82W 3K03A 2QEXV 2XOKG 2XT9A 3E86A 1WNSA 2F95B 4OX9O 2UXDO 1K4CC 2BSKA 3TCUA 3ZHTA 3N27A 5EC1C 4AILC 4YHHB 4DRXA 3N2GA
chains in the Genus database with same CATH topology
1PPJH 2IBZH 1SQPH 1NTKH 2A06H 3L70H 1L0LH 1NTMH 3L74H 2BCCH 4PD4F 3L72H 3H1KH 1SQXH 3CWBH 3L71H 3H1JH 1BE3H 3H1IH 3H1HH 1EZVH 1SQQH 3L73H 1KYOF 1SQBH 4D6TH 1BGYH 3TGUH 1P84F 4U3FH 1L0NH 2FYUH 1NTZH 3BCCH 3L75H 5KLVH 1SQVH 3CX5F 3H1LH 1PP9H 1BCCH 1KB9F 1NU1H 3CXHF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PPJ H;  2IBZ H;  1SQP H;  1NTK H;  2A06 H;  3L70 H;  1L0L H;  1NTM H;  3L74 H;  2BCC H;  4PD4 F;  3L72 H;  3H1K H;  1SQX H;  3CWB H;  3L71 H;  3H1J H;  1BE3 H;  3H1I H;  3H1H H;  1EZV H;  1SQQ H;  3L73 H;  1KYO F;  1SQB H;  4D6T H;  1BGY H;  3TGU H;  1P84 F;  4U3F H;  1L0N H;  2FYU H;  1NTZ H;  3BCC H;  3L75 H;  5KLV H;  1SQV H;  3CX5 F;  3H1L H;  1PP9 H;  1BCC H;  1KB9 F;  1NU1 H;  3CXH F; 
#chains in the Genus database with same CATH topology
 2R72 A;  5CA1 A;  3W7S A;  2HVK C;  4LP8 A;  1XMQ O;  2ODM A;  1SZX A;  3NXS A;  2WLN A;  4JTC B;  4IHJ B;  3ETE A;  2FB5 A;  1NTZ H;  1IZ3 A;  3T1H O;  4YY3 O;  1S5H C;  4IIJ A;  2QKS A;  2EUL A;  3LNM B;  3K3W A;  1BMF G;  4J7J A;  1YVW A;  4EB6 B;  1QLN A;  3ZN1 A;  3CCR V;  2OWO A;  1RSO B;  1EN4 A;  3AK2 A;  1GO3 F;  3CE2 A;  1JQ0 A;  1RPO A;  1KBH A;  3T2M A;  2ZNJ A;  3LSS A;  3U0Z A;  4FJC C;  2IH1 C;  1XL6 A;  2VQE B;  3ABM C;  1T5E A;  1THZ A;  2ZKO A;  1KKC A;  4WFG A;  4JI6 O;  4X66 O;  5BR8 B;  3L74 H;  4DV1 O;  4X8A A;  4GCZ A;  5H2F Z;  5LA6 A;  3OT7 A;  2YUA A;  1SQX H;  2WWW A;  4Q20 A;  3MD0 A;  1FAF A;  3T1Y B;  2CK3 G;  1FD9 A;  2CGO A;  4JI5 O;  1V54 C;  5GTI Z;  4PA6 A;  2AZ0 A;  4KXR A;  4RWU A;  2UXX A;  4PA9 A;  5JWP A;  4TUY A;  2KQX A;  2EBO A;  1XHX A;  3AG2 B;  4K0K O;  3L73 H;  2CH7 A;  4IGG A;  3OGC C;  5D5P A;  1IUR A;  3L75 H;  5ITZ B;  1Y4M A;  5KHH A;  4DRX B;  3ETQ A;  4EFE A;  4X9Q A;  3RYI A;  5CBF A;  4DR7 O;  2FL4 A;  3ZJZ A;  1WJZ A;  2LQT A;  5IDJ A;  2EIL B;  1J95 A;  3ZS8 C;  5JH7 A;  3LNN A;  1IBL O;  3F5T A;  2Q67 A;  4PI2 A;  3T4D A;  4LF9 O;  3JAW B;  1QLE B;  1AR1 B;  2XND G;  2YXH A;  3IFX A;  4B3S B;  3IJ4 A;  1AI4 A;  3WG7 B;  1Y76 A;  1SQV H;  4B3R B;  5JJJ B;  4LR3 A;  1VQ9 V;  4U3J A;  3B09 A;  1SET A;  5CN0 A;  4HZ3 A;  4DR1 B;  4JZG A;  2CTQ A;  4DYL A;  3HKC B;  4YHH O;  1R3L C;  5IY5 B;  1ZSP A;  4DXW A;  1ROP A;  4GKK B;  5IE9 A;  5KX5 B;  1NH2 D;  4JI0 B;  4P30 A;  4LF5 B;  1ZAU A;  3PJS K;  2R9A A;  1L0N H;  4TV9 B;  2CDY A;  5LMU B;  2UUC O;  1VQK V;  1R6K A;  3X2Q C;  3C3T A;  2IW5 A;  2K9P A;  2PYL A;  1TUB A;  2R70 A;  2QWQ B;  1L0L H;  4FZ0 A;  4XDJ A;  3SPJ A;  3K5O A;  4J80 A;  4PDM A;  5DED A;  5CA0 A;  1KEC A;  4DV2 B;  4CC5 A;  1EZV H;  4MW3 A;  3AG3 C;  4JAS A;  1ZUQ A;  2ZIM A;  3D8C A;  1RM1 C;  1GAX A;  3T1C A;  3AG1 C;  1R3K C;  3KCX A;  2ILM A;  3RYC B;  2JS3 A;  3AG1 B;  1N0N A;  1XNQ B;  4LFB B;  2RJZ A;  3JCZ A;  2V1D A;  3K0G A;  2Y0I A;  4CC6 A;  3E2E A;  3CWB H;  2NNU A;  1VQO V;  1FFX B;  3QO7 A;  5FPR A;  2W0F C;  2ITC C;  2HFE C;  4D6T H;  3Q4H B;  3GWO A;  1Q6H A;  4B3T B;  4O4L B;  2OCC B;  4JAA A;  4TSF G;  4MW8 A;  1FPO A;  3UKM A;  2DYS C;  3SPC A;  1ZX3 A;  3JD2 A;  4CS4 A;  1N34 B;  3OTF A;  1HW7 A;  1JFF B;  2ZR3 A;  4LH6 A;  4QPK A;  4UXN A;  3CCU V;  1R3J C;  1GK9 A;  4J7K A;  5J2T A;  4DV0 O;  4DK0 A;  3MAQ A;  2YS8 A;  3RN4 A;  1GM8 A;  1P4R A;  1NKD A;  4YJ2 A;  5CBG A;  2EIM B;  3ZMT A;  4JTD B;  4FMT A;  2JJ2 G;  1K5S A;  4NTW A;  3K58 A;  2JEU A;  2QKC A;  2LJ2 A;  3ZHQ A;  2QM8 A;  3HKE A;  1M56 C;  4I5S A;  1BGY H;  2ADP A;  3QF7 A;  3QTC A;  4GX2 A;  1DGS A;  5CA0 B;  3DGE A;  4QNH B;  4OPH A;  3F7V C;  4UVA A;  2UUB O;  3D3Q A;  2BE3 A;  4RO2 A;  1CEZ A;  5TIS Z;  2QTS A;  4DR4 O;  3HKD B;  1P49 A;  5IYC O;  3JAK A;  5JVD A;  3JAK B;  4DR1 O;  2B9Z A;  4MSW C;  1XNR O;  3MHS C;  4P9O A;  2P4K A;  3QO8 A;  1V55 C;  1XOU A;  1N33 O;  2GDS A;  2CUG A;  2ARH A;  2Q0A A;  3G67 A;  3SYQ A;  3CCL V;  4X1K B;  4ZI7 B;  5LMU O;  1K9M W;  1XMQ B;  1GN4 A;  2DN9 A;  1S77 D;  4QJF B;  1RP3 B;  3P3N A;  3APQ A;  4EKW A;  1O9H A;  1AB3 A;  1SQQ H;  4PDL A;  2EIJ C;  2Y69 B;  3QO5 A;  4DV2 O;  2EIJ B;  3I56 V;  1G4Y B;  3K06 A;  2QSA A;  4K35 A;  5J2T B;  1YTF D;  1EN6 A;  4OXS A;  4X1I A;  1Y74 A;  4LF7 B;  3UQ8 A;  2E75 B;  2VWK A;  4AI8 A;  3CRC A;  4CH3 A;  1YJN V;  3LDE A;  2WLL B;  3M99 B;  2WA4 A;  2ZDI A;  1IVS A;  1P84 F;  1URF A;  4O4I B;  4K8Z A;  2UXD B;  1PL4 A;  1WA8 A;  3RYF B;  1IBM O;  2Z5U A;  1BQ0 A;  2XTA A;  2P5O A;  4CH5 A;  4NR1 A;  3L70 H;  4F6R A;  1Q90 D;  5BZB A;  4DR3 B;  1R6T A;  4AHC A;  3FX7 A;  1UFI A;  5CA3 A;  1HWY A;  3S3X A;  3OM3 B;  3JD4 A;  3G6B A;  4LFA B;  3TGU H;  1QHT A;  4KUM A;  5E79 Z;  4BWA A;  3TJT A;  1YTF B;  2ZT9 B;  3D3I A;  4PEL A;  4YY3 B;  2IJJ A;  2QKA A;  4XDK A;  3IAY A;  1GM7 A;  3ASN C;  4K0K B;  2ZE5 A;  4FLW A;  2PGG A;  3EHB B;  2WSS G;  1AI6 A;  4FVM A;  3RW0 A;  4H13 B;  3OGI B;  3IC9 A;  4JI7 O;  1MA1 A;  3JYC A;  1JOY A;  3SYO A;  5LMN B;  3DSQ A;  3BHP A;  4W4L A;  1IBL B;  5IY5 C;  1J5E B;  1NTK H;  3CJH B;  5IT9 N;  1NTM H;  1OCO C;  3E22 A;  2ZE7 A;  4JI6 B;  2X6B A;  4J9Y B;  5KA5 A;  1TVK B;  2HP8 A;  2UUA B;  2B1G A;  2B1I A;  2XHB A;  3JAR A;  2OT5 A;  1XMO O;  1EN5 A;  3E8B A;  1MG1 A;  5LHI A;  4GKK O;  5GON A;  1YCI A;  4AQY B;  3DXR B;  4ZHQ B;  5KMG B;  2QDO A;  2EIN C;  4GLX A;  5EBW C;  3BY6 A;  3JD3 A;  3MDS A;  4J11 A;  4K8X A;  1X4T A;  2DYR C;  2UUC B;  1B3Q A;  3OR7 C;  1H2N A;  2YID A;  3H9V A;  4DV7 B;  1BS3 A;  3CME V;  1FFT B;  2D3O W;  4UCT A;  4BIU A;  3EFF K;  1MZF A;  3HR0 A;  1MAB G;  4X1Y A;  1VF6 A;  1PL0 A;  4CH4 A;  1GRJ A;  2IU0 A;  5FL7 G;  4I4T A;  4O4J B;  4JF3 A;  4IYH A;  2EZP A;  4NTY A;  2E5L B;  1JPX A;  1K33 A;  4LFB O;  3AG4 B;  2RDC A;  3AG4 C;  2CTP A;  3HB3 B;  2ZDI C;  2ZXW C;  1N36 B;  4PD4 F;  4QGP A;  1F23 A;  3E89 A;  4WFE A;  1EM1 A;  2P6J A;  4DW0 A;  3JSN A;  2HHH B;  2YI9 A;  1OCC C;  3E35 A;  5CMU A;  2ZQM A;  4UB6 Z;  2LFR A;  3ZIA G;  4EB6 A;  3CYO A;  3ZRS A;  5EZY A;  3B2E E;  1EZJ A;  1JX9 A;  1M56 B;  2MK3 A;  5CB4 A;  2BTQ A;  2LW7 A;  2Q6A A;  1BHB A;  4JI7 B;  3E8H A;  2XAG A;  4NTX A;  3ABT A;  1IBK B;  4FLU A;  4RQF A;  2M7W A;  1JMK C;  1ARO P;  1QVG U;  2XUM A;  5EYP B;  1Q8I A;  1H2G A;  2EIL C;  2UU9 O;  1XNQ O;  2EZO A;  2YEV B;  3BRC A;  4H33 A;  3FB6 C;  1U97 A;  2GTA A;  3SYA A;  5EYP A;  4MVO A;  1RFY A;  1MZE A;  2R9I A;  1UJW B;  2ZR2 A;  4G27 B;  2UUA O;  1I5Y A;  1FFX A;  4B3T O;  4FFB B;  1TUE B;  4G28 B;  1DTO A;  1H2S B;  3ML0 A;  1PM9 A;  4JYY A;  1XMO B;  4HAM A;  3OEE G;  1SQG A;  3ZMS A;  2ZM6 B;  1D2D A;  3RYC A;  1N32 B;  3VQV A;  5K1X A;  1FYJ A;  4GKJ O;  2EIK C;  3WFV A;  5KUM A;  1K3E A;  3KCY A;  2CH7 B;  1GM9 A;  4DV0 B;  2VS0 A;  4UB8 Z;  2A9H A;  3AG2 C;  4KHP B;  1JJO A;  4PV1 B;  1H2M A;  4FZ1 A;  1TUB B;  4TWK A;  2YI8 A;  2GUZ A;  2EJR A;  3W7X A;  1OCR C;  3OFN G;  1R1B A;  2V4D A;  4TQD A;  2E3C A;  1W59 A;  4LNU B;  4FLY A;  4MTO A;  1XUQ A;  1K92 A;  4LF7 O;  4I50 A;  4WFB V;  1QLE C;  2AXT Z;  3BPZ A;  4D7T A;  2UUB B;  1PNL A;  2EJ7 A;  2FML A;  4JTA B;  5IJ9 B;  1HNW O;  5LP6 B;  2MW2 B;  3L72 H;  4JZ2 A;  4X1Y B;  4F4L A;  2YC0 A;  4UCR A;  1N36 O;  5KUK A;  2JS5 A;  4ICG A;  3H1H H;  4DW1 A;  1GN3 A;  1XNR B;  1Y74 B;  3SPI A;  5IWA B;  5B5E Z;  2HHH O;  1PNM A;  1N33 B;  4EFB A;  4YIP A;  1AR5 A;  2YIC A;  3CMA V;  2JGU A;  5JCO A;  5LGN A;  3VQW A;  2QJ1 A;  1TGO A;  4LFC B;  1SER A;  1Q86 W;  1QU7 A;  2Q5Z A;  3CPW U;  2WLI B;  3ABL C;  4UCO A;  5LYJ A;  1OZ0 A;  1AJP A;  2OIE A;  1D5N A;  3APO A;  2QWR B;  1ENV A;  2V7Q G;  1JA8 A;  3CCS V;  4NVP A;  4DR2 B;  2DWE C;  4JV5 B;  1Y67 A;  1WB7 A;  1R73 A;  4N23 A;  4NB5 A;  3S3W A;  3X2Q B;  5HFM A;  4PI0 A;  4ABM A;  3B4S A;  2P06 A;  2RQ6 A;  3JAS A;  2UXN A;  3F5W C;  2YXY A;  1HDJ A;  1SKV A;  1XQ8 A;  4FM1 A;  5EIB D;  3JAT B;  2VWJ A;  4Z1V A;  1ORQ C;  1RM1 B;  4J41 A;  5KHI A;  1OHH G;  3ZN0 A;  3CC7 V;  1KYO F;  4I55 A;  1COW G;  3CX5 F;  4X64 O;  2Q68 A;  4L87 A;  5IJ9 A;  2E74 B;  1M9N A;  1PD3 A;  2DMX A;  3FAV B;  3W7U A;  1OCZ C;  1V9P A;  4FK5 C;  4FFB A;  4WF9 V;  4NXN O;  1VEW A;  1S72 V;  2Q8V A;  4DV4 O;  2Q69 A;  3G80 A;  2XAS A;  3ZRW B;  1MMM A;  4CH6 A;  4O4H B;  2LP7 A;  4G2K A;  3ASO C;  4CBC A;  5L3D A;  4MT8 A;  3ABK B;  5LGT A;  4YXW G;  4JI1 O;  4PHZ A;  3CD6 V;  1SF9 A;  5CBH A;  2WLL A;  5CA1 B;  5LL6 Y;  4DV3 O;  3ICX A;  2F4V B;  1J5E O;  3H1K H;  4JI2 B;  3J7A U;  2DQ3 A;  2E5L O;  4D7S A;  4HNA A;  1MNG A;  4HYO A;  1DK1 A;  1WP8 A;  4OX9 B;  3RYH B;  4R6Z A;  4YJ2 B;  3ZRX A;  2Q73 A;  1RSO A;  1XBL A;  1Y6X A;  4MVQ A;  1YHQ V;  3FYE B;  2Z0A A;  4RAI A;  1KD1 W;  1M57 B;  2YIA A;  1M57 C;  1ZWI C;  1ZL8 B;  1JVM A;  2PI4 A;  3TXQ A;  1LUV A;  4MTG A;  3W7T A;  1TAE A;  1RPR A;  2PUS A;  5L3E A;  3E22 B;  3WB2 A;  5GW7 A;  4LBE C;  4R50 A;  4JPR A;  3CEI A;  1VQ5 V;  1F4M A;  1NT2 B;  1VQL V;  3JD0 A;  3B8M A;  1AIL A;  4DR2 O;  5IJ0 B;  5KHG A;  1I94 O;  3HKB A;  3JAL B;  1N8R W;  4DR6 B;  2GBO A;  5EIB C;  1KU9 A;  1S5J A;  4J10 A;  4TT3 G;  4UUJ C;  3STL C;  1M4U A;  4N21 A;  2BOB C;  3M8A A;  1AR4 A;  3SJQ C;  1SC5 B;  4R7C A;  4E4E A;  2VQE O;  2CE4 A;  2RNB A;  4BW5 A;  1GH6 A;  1I08 A;  1K4D C;  5LGU A;  1VF6 C;  3UO2 A;  3RYH A;  3LUT B;  4DV1 B;  1E79 G;  5L3C A;  4GT1 A;  1N0J A;  5LHG A;  2GV9 A;  2ITD C;  3ZX6 A;  5C8Y A;  3ZED A;  3EVK A;  3K79 A;  1GKF A;  3JAM N;  2L35 A;  3RYI B;  1BCC H;  3BA9 A;  1NR7 A;  2W6J G;  2WLM A;  3T1Y O;  3U11 A;  4YJ3 B;  1L1F A;  1KMI Z;  1KQS U;  2HJD A;  3GB7 C;  1N32 O;  1SA0 A;  2A3Q A;  3HPL C;  3JCU Z;  4A5U B;  4GKJ B;  2A7W A;  2X6A A;  4NYK A;  4FLZ A;  2DYR B;  2N05 A;  3QNE A;  4DV4 B;  1IX9 A;  2WLI A;  4MVR A;  3L9D A;  3W7W A;  1ZL8 A;  4LF8 O;  1FJG B;  1SQF A;  3AK1 A;  3ZHR A;  5B1A C;  4H37 A;  2W0X A;  3SJB C;  3WB0 A;  2IJH A;  3SJA C;  4B3M O;  1ZLZ A;  3FAV A;  4DR5 B;  3SYP A;  2KG7 B;  1PKX A;  4JYB A;  2UU9 B;  1YEW A;  2AZ2 A;  2AHZ A;  2CTW A;  4DV3 B;  2YXL A;  4PJ0 Z;  3A0R A;  4KFM A;  4QIW F;  3DXR A;  5IYZ B;  3ZMV A;  1GN2 A;  5FPO A;  4H0L B;  1YSC A;  4DUY B;  4KL1 A;  1R3I C;  1GMG A;  1W0K G;  4GX0 A;  3AK3 A;  3ZHU A;  1NBM G;  2AHY A;  1YJ9 V;  3BAB A;  2OIG A;  2P22 C;  3D36 A;  1VQN V;  2ZM6 O;  2GTS A;  1BSM A;  2RN9 A;  4LNU A;  4Z2W A;  4JYA O;  1K97 A;  3FYI B;  2F66 C;  1P7B A;  4H44 B;  3UT5 B;  3O65 A;  3CC4 V;  1XL4 A;  1IXB A;  4CS3 A;  3OE7 G;  5H9C A;  2F43 G;  2ZCE A;  2A79 B;  4O2A A;  2LFS A;  1F51 A;  3C3S A;  4LWS B;  3OUF A;  3SR2 C;  3RFR A;  3J81 N;  3OTO B;  3TXS A;  2NN4 A;  1BHA A;  4DO2 A;  5EK0 A;  1AVM A;  1QNM A;  5DEC A;  4RUF A;  1XHZ A;  1HNW B;  2CTR A;  2WAM A;  1HNX B;  3SJC C;  3K08 A;  2WLJ A;  3KKY A;  3CRR A;  2HKO A;  1OV9 A;  1TA8 A;  2K1E A;  5KMG A;  4UVB A;  4F6E A;  4IL6 Z;  2DOS A;  1HR0 O;  1S5L Z;  1GTO A;  3RBZ A;  1WPX A;  1VAR A;  3OMA B;  4LH7 A;  5AG2 A;  2KSD A;  4MVM A;  2Y69 C;  1G1X B;  3UT5 A;  4X64 B;  3ABM B;  4PA3 A;  4LFC O;  4O4H A;  5KAI Z;  3BCC H;  5J9P C;  3ASO B;  3FB7 C;  1B04 A;  2NR5 A;  5A9G A;  5IYD O;  1K5Q A;  1S76 D;  4QPJ A;  3ZHS A;  5D5Q A;  1OJH A;  2IJK A;  2RMK B;  4IYI A;  1VQM V;  2XAQ A;  1PPJ H;  3A8T A;  3CRA A;  4LF8 B;  5JCO C;  1FJG O;  1O9G A;  5LA6 B;  4DR5 O;  1FXK A;  3CRM A;  2JRI A;  3N2K B;  2QE7 G;  4P2Z A;  4RUE A;  1BT8 A;  1KB9 F;  4E2L A;  2JGD A;  2IBZ H;  5BMV A;  1VMG A;  3JAL A;  5DN6 G;  4WBN B;  2JIZ G;  4Z1M G;  4DUY O;  1SRY A;  5FNV B;  2QM4 A;  4RQE A;  5H6Q A;  2DWD C;  4GX1 A;  4GZR B;  4B3R O;  4O2B B;  3RWR D;  3SPH A;  3OR6 C;  1BQZ A;  1S3J A;  1KP3 A;  3K59 A;  4MVZ A;  2KKW A;  2Q4P A;  4JYA B;  3K9A A;  3OW2 U;  4DV5 O;  2HJF C;  2O57 A;  1QVF U;  4JI0 O;  2XAF A;  1I5X A;  2ZE8 A;  4ZOL A;  2HLD G;  4X20 B;  1FXK C;  1DF5 A;  2P4V A;  3CHX A;  3P3P A;  2FYU H;  2Q0O C;  2WPD G;  3SDL A;  4DV6 B;  2OCH A;  5CB4 B;  4JAU A;  5KHJ A;  1QBZ A;  3F7Y C;  4R8C A;  1YF2 A;  1OCO B;  2Q7E A;  2IH3 C;  3NR7 A;  1I94 B;  5EZY B;  1XIL A;  5LXT B;  4LWS A;  4ZI7 A;  3CP1 A;  4NKG B;  4EEQ A;  2DQ0 A;  2H94 A;  4KP4 A;  3JAR B;  2ZIO A;  3ZBH A;  5LP6 C;  3B8N A;  5KA6 A;  3JAS B;  2R9R B;  2Q9L A;  4X89 A;  4GUN A;  4X65 O;  1PNK A;  4BIO A;  2UXB O;  1HR0 B;  2EX3 A;  4TV9 A;  2F23 A;  4I0X A;  3LSQ A;  2X0L A;  3D36 C;  3AEI A;  4O4I A;  5FNV A;  1YI2 V;  1N34 O;  4LFA O;  4WBN A;  3LDD A;  1Y66 A;  3UCS C;  5B1A B;  1VQ4 V;  5BMV B;  4BAY A;  4XDL A;  3VQY A;  3CXH F;  3ETG A;  3QG5 A;  2CGN A;  4J9Z B;  4ZIB A;  2G38 A;  3CCQ V;  1UPG A;  2LW1 A;  4X88 A;  3ZRV A;  4X62 O;  3K57 A;  2OCC C;  3QVN A;  1M5I A;  2ZNI A;  5B1B C;  2PYJ A;  5B1B B;  4U3F H;  5B3S C;  2ZD9 A;  4MVU A;  3H1L H;  5B1O A;  3CXC U;  5JH7 B;  1SZT A;  3AG7 A;  4U7O A;  4P9P A;  4BR6 A;  2DW4 A;  3GVM A;  5LMN O;  4I7Z B;  5LHH A;  3ABU A;  1SS3 A;  4DUZ B;  1JFF A;  3ETD A;  4ZHQ A;  3ZMU A;  2OTJ V;  4NXM O;  1NJI W;  1VP7 A;  1BE3 H;  3VQX A;  1MOF A;  4GX5 A;  3AG3 B;  3EXA A;  4LCU C;  4TV8 B;  4XBF A;  3G71 V;  1AI7 A;  3HKC A;  3R66 A;  1DLB A;  4C7U A;  3CCE V;  1YDX A;  1AJN A;  4CZZ A;  3KG2 A;  1IXM A;  2BTQ B;  1LUW A;  2QM7 A;  4AQY O;  1WB8 A;  4X1I B;  5B66 Z;  1QR9 A;  3O9O A;  4FFK A;  4DK1 A;  1XRE A;  3P32 A;  2BTO A;  2UXC O;  3OAA G;  2DYS B;  5L3B A;  4DV7 O;  1I7F A;  3K0D A;  2VQF B;  3R65 A;  5GON B;  3JSL A;  1LNQ A;  1PV0 A;  1B6Q A;  4FIP C;  1GN6 A;  4JI4 O;  3OTO O;  4MS2 A;  1VQ8 V;  1TVK A;  3BFR A;  1W2B U;  4B08 A;  4F6R B;  1M90 W;  3IC7 A;  1HNX O;  2WA3 A;  4PA7 A;  4TQF A;  1Q6U A;  3SPG A;  2UXB B;  3K04 A;  1MSW D;  1XI1 A;  5E1A C;  2Z3Y A;  4WFH A;  1E1R G;  4O4L A;  5A2Q N;  1IBM B;  4O4J A;  3K5M A;  2HG5 C;  1Q81 W;  4L8J A;  4DR3 O;  3A0H Z;  3HKE B;  1Q6I A;  2QGN A;  1F7Y A;  1OCC B;  1HNZ B;  3FKS G;  5H5N A;  2QTO A;  4WFF A;  1V54 B;  4FPP A;  3CB2 A;  3BAA A;  4WCE V;  3K5N A;  2BOC C;  1Z2G A;  2ZIN A;  3DC5 A;  3BVO A;  1W0J G;  3UM7 A;  4X20 A;  1H2L A;  2OTL V;  1Z5V A;  4Q6G A;  2ETN A;  1N4C A;  1K7D A;  5BXZ A;  2WLH A;  4PA4 A;  1WA8 B;  2IU3 A;  4JI3 B;  3RGB A;  3Q4H A;  4FM2 A;  4HBN A;  4UCU A;  2WLK A;  3CRQ A;  4K3A A;  1SA0 B;  3THO A;  2EIK B;  2KB1 A;  5DM6 V;  1AP5 A;  5JJN B;  3N2G B;  4YJ3 A;  4CS2 A;  5JVD B;  1Q43 A;  1M93 A;  3UO3 A;  1KKD A;  1H8E G;  2PI5 A;  3A0B Z;  1FXV A;  3FB8 C;  4UV8 A;  1LR1 A;  2XAJ A;  3OMI B;  2C2A A;  3U10 A;  3BA8 A;  1Y76 B;  3N2K A;  1BL8 A;  1VF5 B;  3RVY A;  5LXT A;  5JQG B;  3CS5 A;  4DV5 B;  4ASU G;  2JK5 C;  3IGA C;  1ZTE A;  4KHP O;  4W4K A;  2N74 A;  5LOV B;  4FLT A;  1Q3E A;  2JVD A;  1WPB A;  2B5U A;  3FB5 C;  3T1H B;  1AJQ A;  2DE0 X;  2FKX A;  5HFL A;  2PY5 A;  4I9Q A;  2NLJ C;  5JJE B;  1AP6 A;  3ASN B;  5LYJ B;  2Q7H A;  2YEV A;  3LDC A;  1CP9 A;  1NVP B;  2Y0P A;  4IHJ A;  3CJH A;  1VQ6 V;  3TET A;  3CCM V;  4UV9 A;  3E8G A;  4U7N A;  4X65 B;  4JI8 O;  2H8P C;  3RVZ A;  3E83 A;  2A0L A;  4I9W A;  1VQ7 V;  5B1N A;  3CCJ V;  5IYB O;  2HVJ C;  2FTK A;  3ZCC A;  1NU1 H;  1S0V A;  3FD9 A;  3VOU A;  4UCV A;  3B40 A;  5LOV A;  2N04 A;  1HP8 A;  4BW9 A;  3G6E V;  2P67 A;  4JI5 B;  3CC2 V;  4LF6 B;  2D2C B;  5EBL C;  1K8A W;  3WU2 Z;  2ZXW B;  1VF7 A;  3OUS A;  2PTM A;  3JAT A;  4DV6 O;  1QQC A;  2QWP B;  4X62 B;  1YIJ V;  3ABL B;  2PF4 E;  1L8D A;  5BY1 A;  4I0X B;  2EIM C;  4JAV A;  2LGQ A;  2ADQ B;  5EBM C;  3H1J H;  3H1I H;  2EIN B;  2QA4 V;  1SQB H;  4JV5 O;  1VQP V;  1IBK O;  1WAZ A;  2HR3 A;  4LC1 A;  3RYF A;  4IT5 A;  2VRZ A;  4DUZ O;  1CPY A;  1NR1 A;  2LGW A;  3CCV V;  2A06 H;  2Q7G A;  4LF9 B;  1JCH A;  2IJI A;  4FLX A;  2AGA A;  2H3O A;  4QE9 A;  1EFR G;  5IYZ A;  3DTU B;  1WN7 A;  3ZMZ A;  1YZB A;  2BSK B;  5F2V O;  1NH2 B;  2Y4U A;  1H8H G;  2YDE A;  3I5D A;  3B77 A;  5FLX N;  5C93 A;  4MTX A;  4UVC A;  1G6U A;  1A32 A;  3BEH A;  1X59 A;  4LF4 O;  2CAZ C;  2Y48 A;  4B7E A;  1MSD A;  2X6C A;  3WB1 A;  2BCC H;  4LF5 O;  4IIJ B;  2JJ1 G;  2P7T C;  3L71 H;  3OMN B;  4ZOL B;  4NXN B;  1F4N A;  2ATK C;  3P30 A;  4ZBM A;  4GYC B;  2X7R B;  4X1K A;  4TV8 A;  5J2U A;  3PN1 A;  1OCR B;  1H2K A;  3GWK C;  2VQF O;  3SGI A;  1NS1 A;  4J42 A;  2W6I G;  3H01 A;  4DR7 B;  1EBO A;  4JI1 B;  4FLV A;  1FS0 G;  2F93 B;  1YXB A;  1US6 A;  3OD4 A;  1CXZ B;  3ABK C;  4UFZ A;  2F4V O;  4NXM B;  4J7Z A;  5C8Y B;  1QCE A;  5H6R A;  4JI2 O;  3E8F A;  3STZ C;  4MVS A;  5LBQ A;  2QWO B;  4JI8 B;  1SES A;  1SQP H;  3JD1 A;  1KC8 W;  1K34 A;  1P7G A;  2JGD B;  3OEH G;  1D5A A;  3RT3 C;  1NQT A;  1V55 B;  5IWA O;  1Q7Y W;  1FKA O;  2E76 B;  5K1P A;  1B06 A;  2L6L A;  2DJV A;  2LO1 A;  1XEQ A;  3WG7 C;  4LF6 O;  1QR8 A;  1WLE A;  4JYC A;  1FXK B;  4PDR A;  2JEX A;  4JGS A;  1WP7 A;  4OPA A;  2UXC B;  1IDS A;  2QR4 A;  2Y4T A;  1YIT V;  3M7M X;  5L3G A;  4I4T B;  3HKD A;  1NI8 A;  3KZI Z;  1Q5O A;  1I0H A;  4DR6 O;  1JR9 A;  1XDC A;  4JI4 B;  4UCS A;  1FXH A;  4OGQ B;  1JJ2 U;  5KX5 A;  4O2B A;  3VBB A;  4JI3 O;  3I55 V;  3JAW A;  3FFQ A;  2HEP A;  1NVP D;  1U96 A;  3MHH C;  2M6Y A;  2P90 A;  2QWN B;  3G4S V;  2ZE6 A;  1PP9 H;  4HNA B;  3DC6 A;  1VIB A;  1H38 A;  4DR4 B;  3A2F A;  5EC2 C;  2YIB D;  4X66 B;  5BR8 O;  1YJW V;  1K73 W;  2RCV A;  2YSU B;  2KG7 A;  4LF4 B;  3J80 N;  1E1Q G;  3C90 A;  1HNZ O;  1BZK A;  2JDI G;  4I50 B;  2XAH A;  2AW9 A;  4BIZ A;  2YIB A;  4TUY B;  3ZRW A;  5ITZ A;  4FM0 A;  5KHK A;  2F1M A;  1OCZ B;  4ZKI A;  5KAF Z;  3LSU A;  4O2A B;  5KLV H;  5LP6 A;  5IJ0 A;  2GHY A;  3CSX A;  4QE7 A;  5L3F A;  3HKB B;  3K5L A;  4YIO A;  2OYQ A;  3TK1 A;  3K9S A;  1M1K W;  4B3M B;  4B7K A;  5J2U B;  1AI5 A;  1NZ6 A;  1R6N A;  1KUQ A;  3SYC A;  2GUZ B;  2PZS A;  3ZHV A;  4WFA V;  1G8M A;  1KP2 A;  4U3J B;  5GTH Z;  4PDV A;  4MTF A;  4I55 B;  4TOI A;  5JQG A;  2IM9 A;  1DF4 A;  1Z5W A;  5B3S B;  4B3S O;  2GSM B;  3T4Z A;  1Q82 W;  3K03 A;  2QEX V;  2XOK G;  2XT9 A;  3E86 A;  1WNS A;  2F95 B;  4OX9 O;  2UXD O;  1K4C C;  2BSK A;  3TCU A;  3ZHT A;  3N27 A;  5EC1 C;  4AIL C;  4YHH B;  4DRX A;  3N2G A; 
#chains in the Genus database with same CATH homology
 1PPJ H;  2IBZ H;  1SQP H;  1NTK H;  2A06 H;  3L70 H;  1L0L H;  1NTM H;  3L74 H;  2BCC H;  4PD4 F;  3L72 H;  3H1K H;  1SQX H;  3CWB H;  3L71 H;  3H1J H;  1BE3 H;  3H1I H;  3H1H H;  1EZV H;  1SQQ H;  3L73 H;  1KYO F;  1SQB H;  4D6T H;  1BGY H;  3TGU H;  1P84 F;  4U3F H;  1L0N H;  2FYU H;  1NTZ H;  3BCC H;  3L75 H;  5KLV H;  1SQV H;  3CX5 F;  3H1L H;  1PP9 H;  1BCC H;  1KB9 F;  1NU1 H;  3CXH F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...