1SQXJ

Crystal structure analysis of bovine bc1 with stigmatellin a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
60
structure length
60
Chain Sequence
APTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 22
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1sqxJ00
3CWBJ 1KYOI 1KB9I 1P84I 1L0NJ 3L72J 2IBZI 4PD4I 3L71J 1SQBJ 3H1JJ 1BE3J 2FYUJ 1NTZJ 3BCCJ 4D6TJ 3TGUJ 3H1IJ 1L0LJ 1SQVJ 3L73J 5KLVJ 3L70J 1SQQJ 3H1HJ 3CX5I 1EZVI 3CXHI 1NU1J 3H1LJ 1BGYJ 3L74J 1BCCJ 2BCCJ 1NTKJ 1SQXJ 4U3FJ 1SQPJ 1PP9J 3H1KJ 3L75J 1NTMJ
chains in the Genus database with same CATH superfamily
1HGVA 1QGKB 3GLMA 1NAFA 1AJYA 2RN0A 5CCHA 3II6A 1X79B 2ZJSE 2C9NY 4KHXA 4N78D 3WUUA 2JO1A 1VQ8P 1M90Q 3L70G 1KQGB 3CMEP 1EDKA 1KB9E 1YYCA 2VRSA 4QMAA 3CCLP 4GT1A 3O6QA 1SQBE 3QH9A 2W8ZA 2WSCJ 3MZWB 5AVSB 3TGUJ 3TNUA 2V7QJ 1EZVG 3TGUD 2E5YA 3B8EB 1JY3O 2HYNA 1GK4A 5B5EE 4IFFA 1FE6A 1VF5C 3H1HG 1PPJD 5KLIC 1Q86Q 1N73A 2P2UA 1SQVG 1FDMA 2CPSA 3Q2YA 3HRNA 3L71D 1AVOA 1PV3A 2PGDA 3V4WA 3FX0A 4DCKA 3L74D 3V2QA 4MN4C 1KILE 3FWNA 4YTPC 4W80A 3RK3B 1KQFB 2Q3EA 3K5BA 1PP9J 3M91A 1VQ5P 1E5WA 1OZHA 3H1JG 3L75J 1NTMJ 4U3FD 1ZR4A 3M9QA 1FAVA 3I55P 2Z5IA 1KTMA 2RKLA 4NPDA 3AEFC 3AEGC 1XTCC 1Q7YQ 4W7ZA 4C7NA 1RF1B 2YKPA 3RK3D 2HLOA 5AW6B 1FZCA 1HH0A 5KAIH 2KS1A 3H32A 3WU2E 4AUWA 1NU1G 1PGQA 1UIXA 2G8YA 2KNCB 2FXPA 2QRXA 2R32A 2OARA 3EQ2A 3I5CA 3L73J 2AXTE 1Y9BA 3I56P 1LP1B 3L70J 3SWKA 1SQBK 2J5UA 3WUVA 3HD7D 3F5HA 4EI2A 5DJUB 5KTBA 1YIJP 3RK3E 1JCCA 2H43A 1JMMA 2WSFJ 3L37A 3VN0A 1OVRA 1KD1Q 1IFIA 1BCCG 2Q5UA 2FFDA 4UB6H 5KKZB 1AFOA 1LT1A 2PP6A 3B5NC 1SQQD 3MUDC 4L73A 5TISH 1IJDB 1L0LD 1U57A 1LGHB 2OQQA 2M5AA 3GG2A 2C0XA 2O01N 4BRYB 1VQOP 3VP8A 1JUNA 1GW4A 2ZYGA 4H0LB 2RMZA 3BCCG 2ITAA 4RO0A 1FZCC 2FYUG 1SQVE 3CCSP 1BE3J 1L0ND 2E74B 1T6AA 2XZRA 1OVUA 2W90A 2KS1B 3IR9A 3AE9C 2ZAEB 3TGUE 4PV1B 1FZEA 1M8OB 3HD7A 3H1KD 1NKNA 3H1JD 4XE5B 5AW3B 3RK2B 1CI6A 3OJAB 1PGJA 2QVAA 5CMZA 3VMXA 1EQ7A 3MIWA 3BATA 4IL6E 3CCEP 2O3JA 4PJ0E 2JDIH 4RESB 4RJTA 3WUTA 1VQKP 2KUBA 1MZ9A 2W83C 2N1TA 2K9YA 2QIWA 3W68A 1RQVA 3L4FA 2WZ7A 1KILC 3AEDC 1PP9E 1SQPE 2HG5D 3GHGC 4WVZA 1QEXA 1N2DC 5APXA 3GW6A 1BGYD 3W67A 1YQ3C 4Y99C 1ZOYC 3CCVP 1S3JA 2CPBA 2ZYAA 4IL6X 1LT9C 1QVGO 3SFEC 2E43A 1P84E 1LJ2A 1K04A 2O01H 1FZAA 1KYOE 4HYTB 3H1IJ 2MKVA 5B66H 1A02F 5KLVJ 3IF4A 1J1DC 3KZIH 1RF1A 3MUDA 1SQQK 3TF5A 1GL2D 2ZFCA 2KXPB 3JCUE 5KJ7C 3ABVC 4IOIH 3U1CA 2IBZG 2KLVA 1L4AB 3CXHI 1K9MQ 2QJPB 3IAOA 4ASWA 2FXMA 4YXWH 1G1JA 1NTKJ 1TU3F 1D7MA 1W2EA 3H1IG 3AE6C 2Y9YA 2A06E 2O1KA 1A02J 1H0TB 2Q9IA 3CWBE 1L0NK 2R5BA 2N1TB 2WMMA 1LTGC 1SQXE 3H1LG 3HE5A 1DH3A 3HTKA 2E75B 1ZLLA 2HPCB 1U7JA 3L72G 1L4AA 3JC22 4HKZH 3H1KE 1PIXA 3H32B 3H6PA 1SVFA 3L71E 4PD4D 1EDLA 1KV4A 2Z4EA 2K1AA 1L0LK 2B89A 2QEXP 1BE3G 1SQXK 1HF9A 1KB9H 1NTKG 2FYUK 1L0NE 2FYUJ 3RL0D 3L70E 4C7NB 5K5GB 3E7KA 4KJMA 2QJKB 1YJWP 2NZ2A 1HBWA 1OX3A 1RF1C 3OW2O 1S1CX 2IFMA 1LWUC 4YXDC 4JQ0D 2SPZA 5KAFH 2JWAA 2ZVOB 2QSIA 1PZQA 3AE4C 1KZUB 3OAKA 4OWFA 5H2FH 3A0HE 4GDOA 1S5LH 3RL0C 5KLVG 3D6ZA 1AQ5A 2E74D 2BEZF 1RY3A 5DJTB 2WPSA 3V5BA 1KFNA 1BCCJ 1Q81Q 2WT7A 1NTKK 1ZMEC 1FZBA 1OIPA 1JO5A 1QL2A 2YXQB 1EXJA 2E76C 4U3FE 1W5CE 1PGOA 1OWAA 1GTWA 1M7LA 1QX8A 1CI6B 3CPWO 1GL2A 2QJKC 2K9JA 1NU1D 4L76A 2NRGA 1ZW0A 5AVYB 3B5NB 2M8RA 1AA0A 1KILB 1IZNB 3P7KA 5CCHC 1WT6A 3PJSK 2J58A 4L75A 5KLIB 1YTZI 3V2PA 3A0BE 1Q82Q 2ZYDA 1NTZE 4ZNCA 1MV8A 1FC2C 2PRRA 2ZXEB 2M3EA 3H1IE 1FDIA 5CBOA 1T8ZA 4DOJA 1MUUA 5APYA 2NPSD 2FYZA 1SQQG 3B5ND 2OYHA 3CWBG 2HPCA 2M5AB 1OFCX 2YMKA 1VQPP 3SSUA 4WY4B 4TLFA 3CXHE 2W27A 1NO4A 1OW6A 3RK2D 1KMIZ 4N78E 1T2KC 1IFJA 1RE4C 1Z56A 1M1JC 4PV1D 1KYOD 3Q3DA 1X0TA 2FFDB 1VDFA 2W6BA 5KLVD 1JY2N 4GOEA 3V2NA 3BRTB 3HUSA 4Y28J 3U59A 3GF7A 4WY4A 2AEJA 3TK1A 1FZCB 1PPJE 1T3UA 4L74A 3Q5SA 1NJIQ 1PP9D 3A7OA 3MGNA 2K37A 3VTPC 1YJ9P 1NTKD 3EFGA 3VMZA 1SQBJ 3H1JJ 5AW1B 3VMYA 4NPFX 2KNCA 1SQBD 3AE1C 5KLVE 3H25A 3CMAP 2OYIA 1NYHA 4D6TJ 4DT0A 5AVWB 1M1JA 2FYUE 1H89A 1IO4A 1VQ7P 3AEAC 1VQ6P 4IFDK 1FJKA 3B5NA 1NVOA 1YBKA 5AW9B 3RL0g 1Q90D 2GUVA 3GF3A 4LC1A 3EFFK 1GDTA 1M56D 3LW5H 1OVVA 1NU1J 2KOGA 1YQ4C 2H8PD 2OGUA 1JMBA 4DZOA 1LTIC 2BCCJ 1SQXJ 1RH5B 4R4MA 2KZIA 2FYNB 1N7SC 4W7YA 5BU8B 1VQLP 2PFXA 3RK2C 3TSIA 3L36A 3CD6P 3H1HD 1S9KD 2C9LY 1OW7A 5AW0B 2NPSA 1KYOI 2Y9ZA 4JPZB 1L0NJ 3BRVB 1NOHA 4GIFA 2XNDH 4PD4H 3SFDC 5KJ7D 1YJNP 2LXBA 3UIAA 4A7PA 2B87A 3TNUB 2HODB 4O9BA 3BCCJ 2NPSB 3M9BA 4GODA 1BGYG 1LTAC 1SQVJ 2Q6QA 2WVRA 3G6EP 3HE4B 2M3BA 1IC2A 2ZT9D 2FYNC 4WY4D 3SWFA 5AVTB 4AQRD 3WMM0 1N8RQ 4R4LA 1L0LE 3T97B 2Q1KA 1VL2A 5AW4B 5BU5A 5APWA 3GHGB 1SFCB 1JTHB 5CJ4A 5GTIH 4GOFA 1ZR2A 1CSBA 1FOSE 1JEKA 2QG4A 2KZJA 1GZLA 2YO3A 1URQD 2YNYA 5GTHE 1CW5A 2BCCG 2JEEA 1AQTA 1SP4A 2OYHB 1M1KQ 3M0AA 3CC7P 3CL3D 3FXDA 2BEQD 3F89A 1N73B 1VQ9P 3NFQA 2WTYA 2Y0EA 3S9OA 2R5DA 1UIIA 3P8CE 2A06D 3P8CD 3H1KG 1GU4A 1ZP0C 1EZVE 4H0LD 3KHUA 4BWNA 1NGMB 1N86A 3AE2C 1RE3A 1XTGB 2FY8A 3WU2H 1FBMA 3H1HE 2OTJP 1IFPA 1SQBG 2A45G 2HODA 1G1IA 2AXTH 3E1IA 1FU1A 2FBWC 1U7MA 1LTSC 2P67A 3M0DA 3N7NA 4LGDE 5E79E 1PP9G 1KC8Q 3CX5E 1BGYJ 1H0TA 1NTZK 2OTKE 3L74E 1JTHA 2CK3H 2L5GB 3PRJA 1JY3N 1NHLA 3C8VA 3ITKA 3T97A 1VF5D 3R2PA 2KIKA 1E79H 1USEA 2OYIC 2XV5A 3OA7A 3H1JE 2YMYA 3QWOC 4BXLA 3L72J 1EXIA 3BASA 3HD7B 4PD4I 2E76B 4JF7A 1R5LA 5EFWB 1CZQA 1RHZB 1KILA 3FWLA 2KK7A 2WITA 2YIUC 5CHXA 3ZDMA 4H44B 3LIDA 1PFIA 2IZ0A 2MJZA 2QJPC 2ZT9B 3GMAA 3CCMP 1EC5A 2LKMA 2QJYB 3MTUE 1BE3D 1NU1E 2A06G 2V7QH 2W6JH 4I7ZB 1G2CA 3IFMA 1KFMA 3L35A 2BCCE 3CX5I 2I1KA 3AE8C 3CCJP 2IYPA 3V2RA 3CXHD 1IFMA 1DIPA 1KORA 1MFZA 3KXDA 4B86A 4HH2A 1HJBA 1GU5A 2OYHC 2L91A 3H1LD 4C46A 1LTJC 3L71G 4EOTA 1N73C 2K88A 1SQVD 1HGZA 1NU1K 2C0WA 2WPRA 1BCCE 4OGQB 1S2EA 3RL0B 2LXCB 1KN7A 4ASVA 2AEMA 1JOCA 1NH4A 1J1EB 2KSJA 2QM7A 2WQYC 5L8RJ 3D70A 1N7SB 1NTMG 1RF0C 1SFCD 2E75D 2IBZD 3IN6A 3RGUA 4UB8H 1MKMA 1PPJG 2IBZI 1FOSF 2O1JA 3FGAD 1P84H 2OYIB 1J1EC 3L70D 4WB4A 1QLED 1T3JA 5AW7B 1J2JB 2GUSA 3PHLA 1X22A 4Z1MH 2IFNA 1IFNA 3SWYA 1L0LJ 3LIEA 1RE3C 1SFCC 1N7SD 1R8EA 1DEBA 1NWQA 3H1HJ 1FZFA 1GMJA 1HVVA 1EZVI 2D2CD 5AW5B 2A45I 2K9JB 2N1TC 3C9IA 1IFDA 3AECC 4H13C 5KLVK 1JB0J 3CX5D 2GM4A 3L72D 3L75G 1FJPA 4UB6E 2WSFH 1LWUA 4EIJA 4OH8B 2P7JA 1SQPG 2W6AA 2Y0DA 2YO2A 3AEBC 1FS0E 4H13B 3R4YA 3H1ID 4U7JA 2Q7CA 2Q3IA 4KT0J 4LLHA 1X8YA 1LTJA 1NTZD 1SFCA 2BASA 4C7RA 2E42A 1LP1A 1GD2E 1M1JB 2AXCA 2WPVB 3Q5RA 2YKOA 2PAJA 1S4XA 2IX7C 1HJ0A 2ZT9C 1NTMK 1KQLA 3KDPB 3RK3C 1EDJA 4N6JA 3CC2P 4PD4E 1URQB 2G3AA 3MD0A 1SQPK 1OMIA 5AVXB 4HB1A 1NTZJ 1KILD 1USDA 3KYQA 4I6MC 1N7SA 2JP3A 3CI9A 1DD4A 2OTLP 5AVRB 1L2PA 1LNQA 2OYOA 2R3SA 4N3YB 4D6TE 3L73E 2KI7B 1BGYE 2IYOA 4IL6H 3AE3C 2JWDA 4PJ0H 4K35A 1FZGA 3CC4P 1S5LE 2KYVA 3MHVA 2A45H 1HTLC 2IBZE 2POHA 3PH0A 5KJ7A 1YITP 1NTME 4TT3H 1DD3A 5GTIE 1NKZB 1JY2O 1KB9D 2ZXXA 3CLQA 4ZKPA 2Z5HA 1BCCD 2JR8A 2V4HA 1VQ4P 4ZMDA 3V6IA 1GK6A 3Q1MA 4YPCA 1KB9I 1P84I 2I1JA 2FFDC 1LTTC 3TDKA 3U1AA 1S5LX 2H89C 2WSSH 1GW3A 2QE7H 3HUSC 1ZXGA 3G3ZA 3HE4A 1BSNA 1R5SA 3O6QB 4EDFA 1JCDA 2KP8A 4Y99B 1BE3E 1RQUA 2AEFA 3A0BH 1URQA 1L0NG 3KZIE 1SQXD 5B5EH 2B87B 2D2CB 2H88C 3BCCE 3PP5A 3BCCD 3D6YA 2JJLA 4GKGA 5CJ0A 2H7HA 1QVFO 3PTZA 1EDIA 1DEEG 3CXHH 1Y47A 1JY3P 3CX5H 2XU6A 1JY2P 3B71A 3LW5J 4U3FG 1JM0A 1AV1A 1PGPA 2XNXA 5AW2B 1YHQP 1YTZT 3GHGA 1BDDA 2XDJA 3L74G 4JYBA 1K8AQ 3FXEA 1FDOA 1ZRTD 5APTA 3KQGA 2NPSC 1SS1A 4RKUJ 5CCGA 2O01J 2QJYC 1P84D 1J1DB 3L73G 4OGQC 2R44A 2WSEH 1AVYA 3RBZA 4D6TG 3CCQP 2J59M 2YXRB 5KAIE 3TYYA 1VQMP 1KQSO 4I1LA 2IZ1A 5APSA 1N7LA 1NTMD 2WPQA 1SQQE 3A2AA 5BVZA 5KAFE 3P32A 4H0LC 4WWIA 1JNMA 4XFJA 1M57D 3L73D 3HE5B 4D6TD 2FXOA 2M0BA 5H2FE 2GA1A 2YIUB 2UWJE 3A0HH 3G9RA 5KKZC 4BRYA 1BDCA 5CCGC 3H1LJ 1PL5A 3S4RA 2FKWB 1VF5B 1SQPJ 3MP7B 5CBNA 3M9HA 3NTNA 1S9KE 1Q2NA 1X9VA 1T2KD 1SLQA 3CWBD 3HD7C 5TISE 3M06A 2WT7B 3A3YB 1URQC 3CWBJ 3B4SA 4AYCA 4K3AA 3NXSA 5CCGD 3G4SP 2B9BA 4UB8E 1IK7A 2DW3A 2D2CC 2RH0A 3L71J 3VP9A 3VMAA 4XA4A 1SQXG 4CPGA 1RF0A 2N1TD 2ZVNB 1EZVD 3TGUG 3AE5C 3E1RA 2E5TA 1L4AC 2WSEJ 3L72E 2KLUA 1HUCA 4JBZA 1GL2C 3Q5PA 2R3CA 1NAYA 2WSCH 2N9BA 5AVUB 5TJHA 1IK9A 5M1BA 1ZN5A 5APUA 4NPEA 4IFMA 5AVQB 1LTJB 3VOPA 1OXZA 1H88A 1LT9A 1NTKE 2E74C 2Y0CA 2K3RA 2P58A 4H44C 2KSEA 4I2LC 3PLNA 1GL2B 1SQVK 3M0DC 3CCRP 1BSHA 4DJGA 3L74J 1LWUB 1ZV8A 1MFTA 2I8DA 3HTKB 1LTBC 3N4XA 2HFED 2E76D 4I7ZC 3L75E 3RBXA 1HWTC 1H8AA 3NMDA 3O8ZA 4OVNF 3H1KJ 5GTHH 1VQNP 4H44D 2P10A 3G71P 1ZRTE 2JKVA 5AVVB 1G2CB 3KPEA 2WWWA 4ZKUA 1DX7A 5CCHD 1YI2P 1K73Q 2IDBA 3AEEC 3BVHA 3P8MC 3D71A 2N9YB 2E75C 5APQA 1KYOH 4OGQD 5AW8B 3VYIA 3AE7C 1Y8AA 3JSVC 5B66E 3EWKA 2LR2A 3CCUP 1OW8A 5APVA 1S72P 3C1LA 2QM8A 5AVZB 1RE4A 1L4AD 1SQQJ 1WRGA 2B88A 2FYUD 3HUSB 3JCUH 4WBAA 5C39A 2HR3A 2BCCD 2P1JA 2XKMA 4JYCA 3S1KA 3V4QA 3A5TA 5E79H 3USSA 1K05A 4HJGH 1VPCA 2QA4P 2KB7P 1NTZG 4M3LA 1L0LG 4PV1C 3L75D 4U3FJ 1W2BO 1WMKA 3H1LE 4H13D 1QL1A 1LT9B 1SQPD 4EYYQ 2IPPA 4WY4C 2YKQA
chains in the Genus database with same CATH topology
3CWBJ 1KYOI 1KB9I 1P84I 1L0NJ 3L72J 2IBZI 4PD4I 3L71J 1SQBJ 3H1JJ 1BE3J 2FYUJ 1NTZJ 3BCCJ 4D6TJ 3TGUJ 3H1IJ 1L0LJ 1SQVJ 3L73J 5KLVJ 3L70J 1SQQJ 3H1HJ 3CX5I 1EZVI 3CXHI 1NU1J 3H1LJ 1BGYJ 3L74J 1BCCJ 2BCCJ 1NTKJ 1SQXJ 4U3FJ 1SQPJ 1PP9J 3H1KJ 3L75J 1NTMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWB J;  1KYO I;  1KB9 I;  1P84 I;  1L0N J;  3L72 J;  2IBZ I;  4PD4 I;  3L71 J;  1SQB J;  3H1J J;  1BE3 J;  2FYU J;  1NTZ J;  3BCC J;  4D6T J;  3TGU J;  3H1I J;  1L0L J;  1SQV J;  3L73 J;  5KLV J;  3L70 J;  1SQQ J;  3H1H J;  3CX5 I;  1EZV I;  3CXH I;  1NU1 J;  3H1L J;  1BGY J;  3L74 J;  1BCC J;  2BCC J;  1NTK J;  1SQX J;  4U3F J;  1SQP J;  1PP9 J;  3H1K J;  3L75 J;  1NTM J; 
#chains in the Genus database with same CATH topology
 1HGV A;  1QGK B;  3GLM A;  1NAF A;  1AJY A;  2RN0 A;  5CCH A;  3II6 A;  1X79 B;  2ZJS E;  2C9N Y;  4KHX A;  4N78 D;  3WUU A;  2JO1 A;  1VQ8 P;  1M90 Q;  3L70 G;  1KQG B;  3CME P;  1EDK A;  1KB9 E;  1YYC A;  2VRS A;  4QMA A;  3CCL P;  4GT1 A;  3O6Q A;  1SQB E;  3QH9 A;  2W8Z A;  2WSC J;  3MZW B;  5AVS B;  3TGU J;  3TNU A;  2V7Q J;  1EZV G;  3TGU D;  2E5Y A;  3B8E B;  1JY3 O;  2HYN A;  1GK4 A;  5B5E E;  4IFF A;  1FE6 A;  1VF5 C;  3H1H G;  1PPJ D;  5KLI C;  1Q86 Q;  1N73 A;  2P2U A;  1SQV G;  1FDM A;  2CPS A;  3Q2Y A;  3HRN A;  3L71 D;  1AVO A;  1PV3 A;  2PGD A;  3V4W A;  3FX0 A;  4DCK A;  3L74 D;  3V2Q A;  4MN4 C;  1KIL E;  3FWN A;  4YTP C;  4W80 A;  3RK3 B;  1KQF B;  2Q3E A;  3K5B A;  1PP9 J;  3M91 A;  1VQ5 P;  1E5W A;  1OZH A;  3H1J G;  3L75 J;  1NTM J;  4U3F D;  1ZR4 A;  3M9Q A;  1FAV A;  3I55 P;  2Z5I A;  1KTM A;  2RKL A;  4NPD A;  3AEF C;  3AEG C;  1XTC C;  1Q7Y Q;  4W7Z A;  4C7N A;  1RF1 B;  2YKP A;  3RK3 D;  2HLO A;  5AW6 B;  1FZC A;  1HH0 A;  5KAI H;  2KS1 A;  3H32 A;  3WU2 E;  4AUW A;  1NU1 G;  1PGQ A;  1UIX A;  2G8Y A;  2KNC B;  2FXP A;  2QRX A;  2R32 A;  2OAR A;  3EQ2 A;  3I5C A;  3L73 J;  2AXT E;  1Y9B A;  3I56 P;  1LP1 B;  3L70 J;  3SWK A;  1SQB K;  2J5U A;  3WUV A;  3HD7 D;  3F5H A;  4EI2 A;  5DJU B;  5KTB A;  1YIJ P;  3RK3 E;  1JCC A;  2H43 A;  1JMM A;  2WSF J;  3L37 A;  3VN0 A;  1OVR A;  1KD1 Q;  1IFI A;  1BCC G;  2Q5U A;  2FFD A;  4UB6 H;  5KKZ B;  1AFO A;  1LT1 A;  2PP6 A;  3B5N C;  1SQQ D;  3MUD C;  4L73 A;  5TIS H;  1IJD B;  1L0L D;  1U57 A;  1LGH B;  2OQQ A;  2M5A A;  3GG2 A;  2C0X A;  2O01 N;  4BRY B;  1VQO P;  3VP8 A;  1JUN A;  1GW4 A;  2ZYG A;  4H0L B;  2RMZ A;  3BCC G;  2ITA A;  4RO0 A;  1FZC C;  2FYU G;  1SQV E;  3CCS P;  1BE3 J;  1L0N D;  2E74 B;  1T6A A;  2XZR A;  1OVU A;  2W90 A;  2KS1 B;  3IR9 A;  3AE9 C;  2ZAE B;  3TGU E;  4PV1 B;  1FZE A;  1M8O B;  3HD7 A;  3H1K D;  1NKN A;  3H1J D;  4XE5 B;  5AW3 B;  3RK2 B;  1CI6 A;  3OJA B;  1PGJ A;  2QVA A;  5CMZ A;  3VMX A;  1EQ7 A;  3MIW A;  3BAT A;  4IL6 E;  3CCE P;  2O3J A;  4PJ0 E;  2JDI H;  4RES B;  4RJT A;  3WUT A;  1VQK P;  2KUB A;  1MZ9 A;  2W83 C;  2N1T A;  2K9Y A;  2QIW A;  3W68 A;  1RQV A;  3L4F A;  2WZ7 A;  1KIL C;  3AED C;  1PP9 E;  1SQP E;  2HG5 D;  3GHG C;  4WVZ A;  1QEX A;  1N2D C;  5APX A;  3GW6 A;  1BGY D;  3W67 A;  1YQ3 C;  4Y99 C;  1ZOY C;  3CCV P;  1S3J A;  2CPB A;  2ZYA A;  4IL6 X;  1LT9 C;  1QVG O;  3SFE C;  2E43 A;  1P84 E;  1LJ2 A;  1K04 A;  2O01 H;  1FZA A;  1KYO E;  4HYT B;  3H1I J;  2MKV A;  5B66 H;  1A02 F;  5KLV J;  3IF4 A;  1J1D C;  3KZI H;  1RF1 A;  3MUD A;  1SQQ K;  3TF5 A;  1GL2 D;  2ZFC A;  2KXP B;  3JCU E;  5KJ7 C;  3ABV C;  4IOI H;  3U1C A;  2IBZ G;  2KLV A;  1L4A B;  3CXH I;  1K9M Q;  2QJP B;  3IAO A;  4ASW A;  2FXM A;  4YXW H;  1G1J A;  1NTK J;  1TU3 F;  1D7M A;  1W2E A;  3H1I G;  3AE6 C;  2Y9Y A;  2A06 E;  2O1K A;  1A02 J;  1H0T B;  2Q9I A;  3CWB E;  1L0N K;  2R5B A;  2N1T B;  2WMM A;  1LTG C;  1SQX E;  3H1L G;  3HE5 A;  1DH3 A;  3HTK A;  2E75 B;  1ZLL A;  2HPC B;  1U7J A;  3L72 G;  1L4A A;  3JC2 2;  4HKZ H;  3H1K E;  1PIX A;  3H32 B;  3H6P A;  1SVF A;  3L71 E;  4PD4 D;  1EDL A;  1KV4 A;  2Z4E A;  2K1A A;  1L0L K;  2B89 A;  2QEX P;  1BE3 G;  1SQX K;  1HF9 A;  1KB9 H;  1NTK G;  2FYU K;  1L0N E;  2FYU J;  3RL0 D;  3L70 E;  4C7N B;  5K5G B;  3E7K A;  4KJM A;  2QJK B;  1YJW P;  2NZ2 A;  1HBW A;  1OX3 A;  1RF1 C;  3OW2 O;  1S1C X;  2IFM A;  1LWU C;  4YXD C;  4JQ0 D;  2SPZ A;  5KAF H;  2JWA A;  2ZVO B;  2QSI A;  1PZQ A;  3AE4 C;  1KZU B;  3OAK A;  4OWF A;  5H2F H;  3A0H E;  4GDO A;  1S5L H;  3RL0 C;  5KLV G;  3D6Z A;  1AQ5 A;  2E74 D;  2BEZ F;  1RY3 A;  5DJT B;  2WPS A;  3V5B A;  1KFN A;  1BCC J;  1Q81 Q;  2WT7 A;  1NTK K;  1ZME C;  1FZB A;  1OIP A;  1JO5 A;  1QL2 A;  2YXQ B;  1EXJ A;  2E76 C;  4U3F E;  1W5C E;  1PGO A;  1OWA A;  1GTW A;  1M7L A;  1QX8 A;  1CI6 B;  3CPW O;  1GL2 A;  2QJK C;  2K9J A;  1NU1 D;  4L76 A;  2NRG A;  1ZW0 A;  5AVY B;  3B5N B;  2M8R A;  1AA0 A;  1KIL B;  1IZN B;  3P7K A;  5CCH C;  1WT6 A;  3PJS K;  2J58 A;  4L75 A;  5KLI B;  1YTZ I;  3V2P A;  3A0B E;  1Q82 Q;  2ZYD A;  1NTZ E;  4ZNC A;  1MV8 A;  1FC2 C;  2PRR A;  2ZXE B;  2M3E A;  3H1I E;  1FDI A;  5CBO A;  1T8Z A;  4DOJ A;  1MUU A;  5APY A;  2NPS D;  2FYZ A;  1SQQ G;  3B5N D;  2OYH A;  3CWB G;  2HPC A;  2M5A B;  1OFC X;  2YMK A;  1VQP P;  3SSU A;  4WY4 B;  4TLF A;  3CXH E;  2W27 A;  1NO4 A;  1OW6 A;  3RK2 D;  1KMI Z;  4N78 E;  1T2K C;  1IFJ A;  1RE4 C;  1Z56 A;  1M1J C;  4PV1 D;  1KYO D;  3Q3D A;  1X0T A;  2FFD B;  1VDF A;  2W6B A;  5KLV D;  1JY2 N;  4GOE A;  3V2N A;  3BRT B;  3HUS A;  4Y28 J;  3U59 A;  3GF7 A;  4WY4 A;  2AEJ A;  3TK1 A;  1FZC B;  1PPJ E;  1T3U A;  4L74 A;  3Q5S A;  1NJI Q;  1PP9 D;  3A7O A;  3MGN A;  2K37 A;  3VTP C;  1YJ9 P;  1NTK D;  3EFG A;  3VMZ A;  1SQB J;  3H1J J;  5AW1 B;  3VMY A;  4NPF X;  2KNC A;  1SQB D;  3AE1 C;  5KLV E;  3H25 A;  3CMA P;  2OYI A;  1NYH A;  4D6T J;  4DT0 A;  5AVW B;  1M1J A;  2FYU E;  1H89 A;  1IO4 A;  1VQ7 P;  3AEA C;  1VQ6 P;  4IFD K;  1FJK A;  3B5N A;  1NVO A;  1YBK A;  5AW9 B;  3RL0 g;  1Q90 D;  2GUV A;  3GF3 A;  4LC1 A;  3EFF K;  1GDT A;  1M56 D;  3LW5 H;  1OVV A;  1NU1 J;  2KOG A;  1YQ4 C;  2H8P D;  2OGU A;  1JMB A;  4DZO A;  1LTI C;  2BCC J;  1SQX J;  1RH5 B;  4R4M A;  2KZI A;  2FYN B;  1N7S C;  4W7Y A;  5BU8 B;  1VQL P;  2PFX A;  3RK2 C;  3TSI A;  3L36 A;  3CD6 P;  3H1H D;  1S9K D;  2C9L Y;  1OW7 A;  5AW0 B;  2NPS A;  1KYO I;  2Y9Z A;  4JPZ B;  1L0N J;  3BRV B;  1NOH A;  4GIF A;  2XND H;  4PD4 H;  3SFD C;  5KJ7 D;  1YJN P;  2LXB A;  3UIA A;  4A7P A;  2B87 A;  3TNU B;  2HOD B;  4O9B A;  3BCC J;  2NPS B;  3M9B A;  4GOD A;  1BGY G;  1LTA C;  1SQV J;  2Q6Q A;  2WVR A;  3G6E P;  3HE4 B;  2M3B A;  1IC2 A;  2ZT9 D;  2FYN C;  4WY4 D;  3SWF A;  5AVT B;  4AQR D;  3WMM 0;  1N8R Q;  4R4L A;  1L0L E;  3T97 B;  2Q1K A;  1VL2 A;  5AW4 B;  5BU5 A;  5APW A;  3GHG B;  1SFC B;  1JTH B;  5CJ4 A;  5GTI H;  4GOF A;  1ZR2 A;  1CSB A;  1FOS E;  1JEK A;  2QG4 A;  2KZJ A;  1GZL A;  2YO3 A;  1URQ D;  2YNY A;  5GTH E;  1CW5 A;  2BCC G;  2JEE A;  1AQT A;  1SP4 A;  2OYH B;  1M1K Q;  3M0A A;  3CC7 P;  3CL3 D;  3FXD A;  2BEQ D;  3F89 A;  1N73 B;  1VQ9 P;  3NFQ A;  2WTY A;  2Y0E A;  3S9O A;  2R5D A;  1UII A;  3P8C E;  2A06 D;  3P8C D;  3H1K G;  1GU4 A;  1ZP0 C;  1EZV E;  4H0L D;  3KHU A;  4BWN A;  1NGM B;  1N86 A;  3AE2 C;  1RE3 A;  1XTG B;  2FY8 A;  3WU2 H;  1FBM A;  3H1H E;  2OTJ P;  1IFP A;  1SQB G;  2A45 G;  2HOD A;  1G1I A;  2AXT H;  3E1I A;  1FU1 A;  2FBW C;  1U7M A;  1LTS C;  2P67 A;  3M0D A;  3N7N A;  4LGD E;  5E79 E;  1PP9 G;  1KC8 Q;  3CX5 E;  1BGY J;  1H0T A;  1NTZ K;  2OTK E;  3L74 E;  1JTH A;  2CK3 H;  2L5G B;  3PRJ A;  1JY3 N;  1NHL A;  3C8V A;  3ITK A;  3T97 A;  1VF5 D;  3R2P A;  2KIK A;  1E79 H;  1USE A;  2OYI C;  2XV5 A;  3OA7 A;  3H1J E;  2YMY A;  3QWO C;  4BXL A;  3L72 J;  1EXI A;  3BAS A;  3HD7 B;  4PD4 I;  2E76 B;  4JF7 A;  1R5L A;  5EFW B;  1CZQ A;  1RHZ B;  1KIL A;  3FWL A;  2KK7 A;  2WIT A;  2YIU C;  5CHX A;  3ZDM A;  4H44 B;  3LID A;  1PFI A;  2IZ0 A;  2MJZ A;  2QJP C;  2ZT9 B;  3GMA A;  3CCM P;  1EC5 A;  2LKM A;  2QJY B;  3MTU E;  1BE3 D;  1NU1 E;  2A06 G;  2V7Q H;  2W6J H;  4I7Z B;  1G2C A;  3IFM A;  1KFM A;  3L35 A;  2BCC E;  3CX5 I;  2I1K A;  3AE8 C;  3CCJ P;  2IYP A;  3V2R A;  3CXH D;  1IFM A;  1DIP A;  1KOR A;  1MFZ A;  3KXD A;  4B86 A;  4HH2 A;  1HJB A;  1GU5 A;  2OYH C;  2L91 A;  3H1L D;  4C46 A;  1LTJ C;  3L71 G;  4EOT A;  1N73 C;  2K88 A;  1SQV D;  1HGZ A;  1NU1 K;  2C0W A;  2WPR A;  1BCC E;  4OGQ B;  1S2E A;  3RL0 B;  2LXC B;  1KN7 A;  4ASV A;  2AEM A;  1JOC A;  1NH4 A;  1J1E B;  2KSJ A;  2QM7 A;  2WQY C;  5L8R J;  3D70 A;  1N7S B;  1NTM G;  1RF0 C;  1SFC D;  2E75 D;  2IBZ D;  3IN6 A;  3RGU A;  4UB8 H;  1MKM A;  1PPJ G;  2IBZ I;  1FOS F;  2O1J A;  3FGA D;  1P84 H;  2OYI B;  1J1E C;  3L70 D;  4WB4 A;  1QLE D;  1T3J A;  5AW7 B;  1J2J B;  2GUS A;  3PHL A;  1X22 A;  4Z1M H;  2IFN A;  1IFN A;  3SWY A;  1L0L J;  3LIE A;  1RE3 C;  1SFC C;  1N7S D;  1R8E A;  1DEB A;  1NWQ A;  3H1H J;  1FZF A;  1GMJ A;  1HVV A;  1EZV I;  2D2C D;  5AW5 B;  2A45 I;  2K9J B;  2N1T C;  3C9I A;  1IFD A;  3AEC C;  4H13 C;  5KLV K;  1JB0 J;  3CX5 D;  2GM4 A;  3L72 D;  3L75 G;  1FJP A;  4UB6 E;  2WSF H;  1LWU A;  4EIJ A;  4OH8 B;  2P7J A;  1SQP G;  2W6A A;  2Y0D A;  2YO2 A;  3AEB C;  1FS0 E;  4H13 B;  3R4Y A;  3H1I D;  4U7J A;  2Q7C A;  2Q3I A;  4KT0 J;  4LLH A;  1X8Y A;  1LTJ A;  1NTZ D;  1SFC A;  2BAS A;  4C7R A;  2E42 A;  1LP1 A;  1GD2 E;  1M1J B;  2AXC A;  2WPV B;  3Q5R A;  2YKO A;  2PAJ A;  1S4X A;  2IX7 C;  1HJ0 A;  2ZT9 C;  1NTM K;  1KQL A;  3KDP B;  3RK3 C;  1EDJ A;  4N6J A;  3CC2 P;  4PD4 E;  1URQ B;  2G3A A;  3MD0 A;  1SQP K;  1OMI A;  5AVX B;  4HB1 A;  1NTZ J;  1KIL D;  1USD A;  3KYQ A;  4I6M C;  1N7S A;  2JP3 A;  3CI9 A;  1DD4 A;  2OTL P;  5AVR B;  1L2P A;  1LNQ A;  2OYO A;  2R3S A;  4N3Y B;  4D6T E;  3L73 E;  2KI7 B;  1BGY E;  2IYO A;  4IL6 H;  3AE3 C;  2JWD A;  4PJ0 H;  4K35 A;  1FZG A;  3CC4 P;  1S5L E;  2KYV A;  3MHV A;  2A45 H;  1HTL C;  2IBZ E;  2POH A;  3PH0 A;  5KJ7 A;  1YIT P;  1NTM E;  4TT3 H;  1DD3 A;  5GTI E;  1NKZ B;  1JY2 O;  1KB9 D;  2ZXX A;  3CLQ A;  4ZKP A;  2Z5H A;  1BCC D;  2JR8 A;  2V4H A;  1VQ4 P;  4ZMD A;  3V6I A;  1GK6 A;  3Q1M A;  4YPC A;  1KB9 I;  1P84 I;  2I1J A;  2FFD C;  1LTT C;  3TDK A;  3U1A A;  1S5L X;  2H89 C;  2WSS H;  1GW3 A;  2QE7 H;  3HUS C;  1ZXG A;  3G3Z A;  3HE4 A;  1BSN A;  1R5S A;  3O6Q B;  4EDF A;  1JCD A;  2KP8 A;  4Y99 B;  1BE3 E;  1RQU A;  2AEF A;  3A0B H;  1URQ A;  1L0N G;  3KZI E;  1SQX D;  5B5E H;  2B87 B;  2D2C B;  2H88 C;  3BCC E;  3PP5 A;  3BCC D;  3D6Y A;  2JJL A;  4GKG A;  5CJ0 A;  2H7H A;  1QVF O;  3PTZ A;  1EDI A;  1DEE G;  3CXH H;  1Y47 A;  1JY3 P;  3CX5 H;  2XU6 A;  1JY2 P;  3B71 A;  3LW5 J;  4U3F G;  1JM0 A;  1AV1 A;  1PGP A;  2XNX A;  5AW2 B;  1YHQ P;  1YTZ T;  3GHG A;  1BDD A;  2XDJ A;  3L74 G;  4JYB A;  1K8A Q;  3FXE A;  1FDO A;  1ZRT D;  5APT A;  3KQG A;  2NPS C;  1SS1 A;  4RKU J;  5CCG A;  2O01 J;  2QJY C;  1P84 D;  1J1D B;  3L73 G;  4OGQ C;  2R44 A;  2WSE H;  1AVY A;  3RBZ A;  4D6T G;  3CCQ P;  2J59 M;  2YXR B;  5KAI E;  3TYY A;  1VQM P;  1KQS O;  4I1L A;  2IZ1 A;  5APS A;  1N7L A;  1NTM D;  2WPQ A;  1SQQ E;  3A2A A;  5BVZ A;  5KAF E;  3P32 A;  4H0L C;  4WWI A;  1JNM A;  4XFJ A;  1M57 D;  3L73 D;  3HE5 B;  4D6T D;  2FXO A;  2M0B A;  5H2F E;  2GA1 A;  2YIU B;  2UWJ E;  3A0H H;  3G9R A;  5KKZ C;  4BRY A;  1BDC A;  5CCG C;  3H1L J;  1PL5 A;  3S4R A;  2FKW B;  1VF5 B;  1SQP J;  3MP7 B;  5CBN A;  3M9H A;  3NTN A;  1S9K E;  1Q2N A;  1X9V A;  1T2K D;  1SLQ A;  3CWB D;  3HD7 C;  5TIS E;  3M06 A;  2WT7 B;  3A3Y B;  1URQ C;  3CWB J;  3B4S A;  4AYC A;  4K3A A;  3NXS A;  5CCG D;  3G4S P;  2B9B A;  4UB8 E;  1IK7 A;  2DW3 A;  2D2C C;  2RH0 A;  3L71 J;  3VP9 A;  3VMA A;  4XA4 A;  1SQX G;  4CPG A;  1RF0 A;  2N1T D;  2ZVN B;  1EZV D;  3TGU G;  3AE5 C;  3E1R A;  2E5T A;  1L4A C;  2WSE J;  3L72 E;  2KLU A;  1HUC A;  4JBZ A;  1GL2 C;  3Q5P A;  2R3C A;  1NAY A;  2WSC H;  2N9B A;  5AVU B;  5TJH A;  1IK9 A;  5M1B A;  1ZN5 A;  5APU A;  4NPE A;  4IFM A;  5AVQ B;  1LTJ B;  3VOP A;  1OXZ A;  1H88 A;  1LT9 A;  1NTK E;  2E74 C;  2Y0C A;  2K3R A;  2P58 A;  4H44 C;  2KSE A;  4I2L C;  3PLN A;  1GL2 B;  1SQV K;  3M0D C;  3CCR P;  1BSH A;  4DJG A;  3L74 J;  1LWU B;  1ZV8 A;  1MFT A;  2I8D A;  3HTK B;  1LTB C;  3N4X A;  2HFE D;  2E76 D;  4I7Z C;  3L75 E;  3RBX A;  1HWT C;  1H8A A;  3NMD A;  3O8Z A;  4OVN F;  3H1K J;  5GTH H;  1VQN P;  4H44 D;  2P10 A;  3G71 P;  1ZRT E;  2JKV A;  5AVV B;  1G2C B;  3KPE A;  2WWW A;  4ZKU A;  1DX7 A;  5CCH D;  1YI2 P;  1K73 Q;  2IDB A;  3AEE C;  3BVH A;  3P8M C;  3D71 A;  2N9Y B;  2E75 C;  5APQ A;  1KYO H;  4OGQ D;  5AW8 B;  3VYI A;  3AE7 C;  1Y8A A;  3JSV C;  5B66 E;  3EWK A;  2LR2 A;  3CCU P;  1OW8 A;  5APV A;  1S72 P;  3C1L A;  2QM8 A;  5AVZ B;  1RE4 A;  1L4A D;  1SQQ J;  1WRG A;  2B88 A;  2FYU D;  3HUS B;  3JCU H;  4WBA A;  5C39 A;  2HR3 A;  2BCC D;  2P1J A;  2XKM A;  4JYC A;  3S1K A;  3V4Q A;  3A5T A;  5E79 H;  3USS A;  1K05 A;  4HJG H;  1VPC A;  2QA4 P;  2KB7 P;  1NTZ G;  4M3L A;  1L0L G;  4PV1 C;  3L75 D;  4U3F J;  1W2B O;  1WMK A;  3H1L E;  4H13 D;  1QL1 A;  1LT9 B;  1SQP D;  4EYY Q;  2IPP A;  4WY4 C;  2YKQ A; 
#chains in the Genus database with same CATH homology
 3CWB J;  1KYO I;  1KB9 I;  1P84 I;  1L0N J;  3L72 J;  2IBZ I;  4PD4 I;  3L71 J;  1SQB J;  3H1J J;  1BE3 J;  2FYU J;  1NTZ J;  3BCC J;  4D6T J;  3TGU J;  3H1I J;  1L0L J;  1SQV J;  3L73 J;  5KLV J;  3L70 J;  1SQQ J;  3H1H J;  3CX5 I;  1EZV I;  3CXH I;  1NU1 J;  3H1L J;  1BGY J;  3L74 J;  1BCC J;  2BCC J;  1NTK J;  1SQX J;  4U3F J;  1SQP J;  1PP9 J;  3H1K J;  3L75 J;  1NTM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...