1SQXJ

Crystal structure analysis of bovine bc1 with stigmatellin a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
60
structure length
60
Chain Sequence
APTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 22
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1sqxJ00
1NTKJ 2BCCJ 2FYUJ 3H1HJ 1L0NJ 3L75J 3TGUJ 3CX5I 3H1KJ 1SQXJ 3L74J 3L73J 3L72J 4D6TJ 5KLVJ 3H1LJ 1P84I 3H1IJ 1KB9I 1SQQJ 1KYOI 1NU1J 1SQBJ 1L0LJ 3CXHI 3H1JJ 1BE3J 1NTMJ 1BCCJ 3L71J 1PP9J 3L70J 1SQPJ 1SQVJ 1BGYJ 3BCCJ 1EZVI 3CWBJ 4PD4I 1NTZJ 4U3FJ 2IBZI
chains in the Genus database with same CATH superfamily
2E43A 2QG4A 3L36A 1L4AA 1LTJA 1QGKB 2BCCJ 1LTJC 1NTZK 4L73A 1LTJB 1N2DC 3CX5I 3HE4A 2E76B 3LIEA 1KQLA 1LP1B 1RQVA 3AEAC 1PZQA 3B5ND 1LP1A 2NPSD 3HE4B 4L74A 2K3RA 4RO0A 2YIUC 2YXRB 2FYUE 3I5CA 5CCHA 1NTZD 1DD3A 3VYIA 1T3JA 4C7RA 4K3AA 1QL2A 3USSA 1LWUB 3Q2YA 2ZXEB 1OXZA 3H1IJ 2KSJA 3JCUH 3II6A 2YXQB 1OVUA 3HUSB 3A5TA 1QVGO 3MIWA 1DEBA 2QEXP 1S4XA 2HG5D 1JMMA 3L71J 5KAFH 5KLVE 3TGUD 1LTSC 1FDMA 2PGDA 1VQLP 1JO5A 4H13C 1NAYA 1D7MA 1GL2A 1SQBE 1KB9H 4GKGA 5C39A 4ZKUA 1JOCA 5TISH 3TSIA 5BU5A 1FZGA 1HF9A 4YXWH 2O01J 1T8ZA 2WSCH 4TT3H 1VL2A 5APVA 3A7OA 2NPSB 3H1KG 3HD7B 3RL0C 3B5NB 3MZWB 4PV1B 4B86A 2LXCB 2FYNC 2YIUB 1SFCB 2KZJA 1N7SA 3V2PA 1KTMA 3VMAA 4KHXA 5EFWB 3LW5H 1SQXE 3H1LJ 3GF7A 1M57D 2JWAA 5AVYB 3ABVC 4MN4C 3VN0A 1SQBJ 3M0DC 4I7ZC 1J1DC 2IDBA 4WBAA 2R32A 2I8DA 1AFOA 1NO4A 1Y8AA 3U59A 1E5WA 2P58A 2UWJE 3T97A 1DD4A 5CCGA 1IK7A 2M8RA 2YMKA 4JF7A 3RL0g 4AYCA 1VPCA 1KZUB 3BCCJ 1MV8A 2IZ1A 1U57A 1KYOD 3HTKA 4QMAA 4PD4I 3GMAA 3TNUB 1VQMP 3P32A 4N78D 4OGQB 4W7YA 4ZNCA 3RGUA 2Q3EA 4R4LA 4Z1MH 2AXTH 3HUSC 2FYUJ 5KKZC 1L0LD 2ZT9B 4GIFA 1SQXG 2XKMA 1MFZA 2KS1B 2V7QJ 3A3YB 3CX5H 1JY2N 3FGAD 4GT1A 4NPFX 4YPCA 2IZ0A 1TU3F 3L73J 2BCCE 1L0LK 4NPDA 2QM7A 1S1CX 5H2FE 2E74B 4H13D 3CLQA 3QH9A 1MFTA 1LTBC 1JY3N 4M3LA 3SFDC 2H43A 1SQVE 5CBOA 3IAOA 1L4AC 1EXJA 2J59M 1BCCD 1IC2A 2A45G 2E76C 4H0LB 2D2CD 4H44D 3V6IA 4PV1C 3RK3D 2V4HA 4C7NA 1GD2E 2FXOA 2G8YA 3PLNA 4C7NB 1R5LA 2K9JB 1NU1E 2XNDH 5AVXB 3CPWO 2HPCB 1KYOH 2N1TC 2Z5HA 3AEEC 3AEFC 3NTNA 3EQ2A 1NTZJ 2FBWC 2R5DA 2OGUA 2KI7B 2YNYA 4U3FJ 5B66E 3CCVP 5M1BA 3G3ZA 1CZQA 2C0XA 4WWIA 2IBZI 4D6TE 2ZXXA 3AE2C 5DJUB 5KKZB 1YJ9P 2DW3A 1LJ2A 3L74G 1EDLA 1Q2NA 4BRYB 3FX0A 3H1KJ 3SWYA 4BRYA 1BDCA 2WT7B 3BRTB 1FZFA 1LNQA 2KSEA 2M0BA 1DIPA 2B89A 1N8RQ 3AE3C 1G1IA 4OGQC 1JEKA 1NOHA 1Z56A 2H89C 1XTGB 5AW4B 1URQB 1JUNA 2I1JA 2M3EA 4WVZA 4DOJA 1URQA 1SLQA 4EI2A 1BGYE 5APUA 2D2CC 3HUSA 1ZOYC 2WSSH 1BE3G 2J5UA 3IR9A 3QWOC 1NVOA 1ZRTD 3L71D 4H44B 1VQ7P 3L75D 4IL6H 2IX7C 3OAKA 4I1LA 3M9HA 1SQPJ 1G1JA 3L70G 5B5EE 1E79H 3F5HA 1S2EA 2A06D 2O1JA 4OH8B 4U3FG 4A7PA 1KILE 3EFFK 1Q90D 1WT6A 4KT0J 5CCHD 2WWWA 4W7ZA 3PH0A 2GUSA 4PJ0H 1N73B 2AXCA 5TISE 1S5LE 1NTKJ 1VDFA 3CC4P 1G2CA 2V7QH 3CC7P 4EYYQ 3H1HG 2C9LY 3U1AA 1LTIC 3M0AA 2OYIC 1L4AD 3JSVC 1VF5C 1W2BO 3L72G 1HUCA 2HR3A 1KORA 3V5BA 3AE4C 4OGQD 1IO4A 1S9KD 2M5AB 4AUWA 1VQ6P 2NZ2A 2OTJP 3R4YA 3G9RA 2MKVA 1URQC 3VP8A 1LT1A 2LKMA 1DH3A 2WPVB 3L4FA 1LT9B 1P84E 1Y47A 1XTCC 3Q1MA 1T2KC 2E42A 2OTKE 2FYZA 2KYVA 5KJ7D 1KQSO 2CPBA 2FY8A 3RK3B 2XDJA 3CXHE 2QJYB 3GG2A 4OVNF 1SQVJ 1KMIZ 1H0TB 3KXDA 1GL2C 3L73D 4HKZH 2AEMA 1LTTC 1EDIA 1J1EC 3H1KE 4EIJA 3G4SP 3S4RA 1FS0E 3VMZA 1NTMD 1SQPK 2ZFCA 5H2FH 1X0TA 1OW7A 1HTLC 1L0NG 1SQVK 1MKMA 3L75J 4HB1A 1HWTC 1M1KQ 1VF5D 2KLVA 1Y9BA 1PPJE 1NTMK 1QEXA 3KPEA 3SWKA 5KAIH 2N9BA 1NWQA 2AXTE 5KLVG 3CWBD 1USDA 3M0DA 1VQ4P 3GHGB 3CX5D 4I2LC 1X9VA 3C8VA 1HVVA 3L70E 2ZVOB 4WY4B 4ASWA 5CCGD 5CBNA 1H88A 1PGQA 3CC2P 1VQNP 3RL0D 1AVOA 1NGMB 1L0ND 1BE3E 5DJTB 1NTKK 3OA7A 3LW5J 1BGYG 1EZVG 3H1ID 3M9BA 2KXPB 3CCMP 2NRGA 1JTHB 1PP9E 1JMBA 2E5TA 3B4SA 5AVSB 3RK2B 3IF4A 3C1LA 2FXMA 2OQQA 2WPQA 2Q5UA 5CHXA 1RF1A 1FZAA 2H8PD 1ZN5A 4NPEA 3BASA 5APSA 1YHQP 1KILA 3HE5A 1FJPA 4PD4E 1KFNA 1M56D 1EDKA 2CPSA 1SFCA 2WITA 2YO3A 3L74D 4RKUJ 1GW3A 3IN6A 2JWDA 3EWKA 3L35A 2HODB 4Y99B 1H89A 1SQPD 2WQYC 1P84I 1VQPP 2VRSA 2OYHC 2IPPA 2OYHB 1EZVD 3H1IG 1GL2D 2R3CA 3TNUA 3CXHI 1J2JB 1NU1G 3P8CE 2WMMA 3RL0B 2H7HA 3AE6C 3HRNA 3BVHA 1OX3A 1HH0A 3V2NA 1W2EA 3H1HD 5KTBA 4H0LD 4KJMA 5CCHC 1VQ9P 1YBKA 1JY3O 3AECC 3HTKB 1BSNA 1SQVG 1FC2C 1NH4A 2HLOA 2G3AA 1X79B 2OARA 2PRRA 2XNXA 3KHUA 3PTZA 1KQFB 2KIKA 1RE4C 2E74D 1UIXA 3H1JD 2SPZA 1GW4A 1RHZB 2A06G 5GTHH 3Q3DA 1JY3P 3WMM0 1OIPA 1NTKD 1PPJG 3TDKA 5L8RJ 1BDDA 2ITAA 1KB9E 1L0NJ 2KS1A 1CI6A 1YTZI 5E79H 4DT0A 1ZR2A 1SQXJ 3H1LE 3BCCD 4L75A 2Y0DA 5AVQB 1FAVA 1S72P 1AV1A 1IFDA 2O3JA 3FXDA 3GF3A 2WSFJ 1JY2P 2IFNA 1PGPA 2IBZE 1EDJA 2Z5IA 3KZIE 3KYQA 1A02J 5GTHE 4WB4A 4GDOA 1YJNP 1L0LJ 2JDIH 1NTZE 5TJHA 1NTMJ 4H0LC 4IFFA 1NAFA 4BWNA 3HD7C 1BCCJ 2GM4A 3MGNA 2FYNB 3CD6P 1SFCC 2FYUK 3OJAB 3CCSP 1GK6A 2N1TA 2RH0A 1WMKA 2W6AA 2QA4P 1H0TA 1NJIQ 1ZXGA 2W6JH 3CWBG 1GTWA 4PJ0E 3AEDC 5KLVD 4BXLA 3VMYA 3N7NA 3L72E 4JBZA 2Y0CA 3BRVB 3CCUP 1SQBD 4WY4C 2Q7CA 5BVZA 3M91A 1Q86Q 3ZDMA 3B71A 2OYOA 1LTGC 1GMJA 1SQBK 1A02F 3H1LG 5CJ4A 4U3FD 2RMZA 1YQ3C 3RK2D 3I56P 1LWUC 1LWUA 3MHVA 4DCKA 1RF0A 2AEFA 2BEQD 1RF0C 2XV5A 3L37A 4JYCA 2BEZF 2A45I 4W80A 5GTIH 5AW7B 1IZNB 1SQQE 4LGDE 1X22A 2RN0A 3L71G 1K8AQ 2W90A 2E75B 3IFMA 2WSEJ 4C46A 2B9BA 1FDIA 1YJWP 3CXHH 5K5GB 1K73Q 2LXBA 2KZIA 4ASVA 2QJKC 2QVAA 1SQXK 2B87B 5GTIE 1FOSE 2B87A 3GLMA 1H8AA 1J1EB 2C9NY 5KAFE 1T2KD 1KN7A 1EC5A 4JPZB 1IFIA 3E1IA 2FYUG 2FYUD 2QRXA 3RBXA 4EDFA 2XU6A 5APWA 2IYPA 2K37A 5AVUB 3WUTA 1ZMEC 2NPSC 3M9QA 3MUDC 3L74J 1NKZB 3HD7A 3KZIH 1VQKP 2JR8A 2W8ZA 4N6JA 5KLVK 2PAJA 2JEEA 5KLIC 2P2UA 2QM8A 4U7JA 1N7SB 1HGVA 3FXEA 5KLVJ 2MJZA 1RH5B 2ZYDA 2WZ7A 2KUBA 1PFIA 3TGUE 1AQTA 2R44A 1JCDA 3H1JJ 1CW5A 2RKLA 3Q5SA 3MD0A 3RK3C 5BU8B 3Q5PA 2ZJSE 4IOIH 3CCRP 2OYIB 1SS1A 2ZYAA 1KD1Q 2A45H 3O8ZA 1AJYA 4WY4D 1ZP0C 1SQVD 2OTLP 3AE1C 3C9IA 2M3BA 5AVTB 2FKWB 4DJGA 3P7KA 5AW3B 2FFDB 3S9OA 2FFDA 2K88A 3PP5A 2QSIA 5APTA 3H6PA 3TGUG 3AE8C 1SQXD 2E75C 2WSFH 4UB6E 1FZBA 2P1JA 1R5SA 2E5YA 4YXDC 1RQUA 2B88A 2QIWA 3I55P 2OYIA 4D6TG 4D6TD 3N4XA 1VQ5P 3SSUA 2E74C 1T3UA 2QE7H 3WU2E 1SQQJ 4CPGA 1SVFA 1IFPA 4WY4A 5CMZA 1YI2P 1KYOE 5E79E 3BATA 4ZMDA 5AW8B 3MUDA 2Q1KA 1NHLA 1SQPG 1BCCG 4N78E 4ZKPA 1LGHB 3CMEP 2AEJA 1BGYD 1URQD 2L91A 1JTHA 2N1TB 3D71A 1L0LE 1LTAC 1JNMA 3K5BA 1ZRTE 3L71E 3L75E 1SP4A 1EXIA 1FU1A 1KC8Q 1J1DB 2BCCG 2BCCD 5AVVB 1NYHA 2YKQA 4HJGH 3E1RA 2A06E 3HD7D 3VTPC 1SQQK 3L75G 1OWAA 1KILD 1W5CE 1FZCC 1USEA 2IFMA 2HODA 1UIIA 2YMYA 3AE5C 3JC22 4Y99C 1ZLLA 4RESB 5AW1B 1GU4A 1NU1K 3EFGA 2OYHA 1BCCE 3F89A 1KB9I 1PGJA 2KOGA 3RK3E 1FJKA 1M1JA 2LR2A 1M1JC 1IFJA 1NU1D 3CI9A 4JQ0D 1BE3J 3JCUE 4UB8E 2ZT9C 2D2CB 2KB7P 2C0WA 3PRJA 4K35A 1RE3A 5AW9B 3B5NC 2K1AA 3A2AA 3R2PA 3D6YA 5KJ7C 3L70J 1YYCA 2O01H 2WSCJ 1RY3A 2YKPA 1HBWA 1L2PA 1P84D 2PP6A 4HH2A 4H13B 1IK9A 2FXPA 1EZVI 3SWFA 1RE4A 2O1KA 3AEGC 2JO1A 1L0NK 3WUVA 1NTZG 2YO2A 1IFMA 3W68A 1QLED 1AVYA 1MUUA 1S3JA 1FZEA 2GUVA 2HFED 3MTUE 1Q81Q 1G2CB 5AW0B 3L73E 1MZ9A 1KFMA 3H1HJ 3KDPB 1QL1A 4IL6X 4I6MC 3UIAA 1N73A 2IBZG 3G71P 1ZR4A 1X8YA 3D70A 3L73G 1AQ5A 1VF5B 3B8EB 3H1KD 1QX8A 3L72J 3V4QA 2M5AA 2W27A 2O01N 2Y0EA 3AE7C 1K04A 1U7MA 3TGUJ 1KYOI 1SQBG 2HYNA 2XZRA 1CSBA 1JCCA 2N1TD 2WTYA 1GDTA 2N9YB 1OVVA 2W83C 1BSHA 3H1JG 4GOEA 1FZCB 1JB0J 1FZCA 2KK7A 3S1KA 1GK4A 3CCEP 1YTZT 5AVZB 4Y28J 4N3YB 3RK2C 2ZYGA 4GOFA 4JYBA 4IFMA 1K9MQ 1BE3D 1HJ0A 1YIJP 2R5BA 3WU2H 3TK1A 3H1IE 3W67A 2KNCA 2PFXA 2ZVNB 1PP9D 2WSEH 5CJ0A 2KNCB 1S5LH 1S9KE 1DX7A 1RE3C 3H32A 1FDOA 2JP3A 3H32B 2ZT9D 4LC1A 3G6EP 3FWNA 2Q3IA 1N7SC 2Q9IA 1FOSF 1R8EA 3CXHD 1HJBA 2BASA 3PHLA 4PD4D 4DZOA 3GHGA 1SQQG 2P67A 3GHGC 2K9YA 3O6QA 3CCJP 1YITP 1N86A 1OVRA 1SQPE 3NFQA 3O6QB 4HYTB 1FBMA 1PP9G 2JKVA 1QVFO 3VOPA 1Q82Q 1EZVE 1BGYJ 1OZHA 3A0HH 1NTME 2Z4EA 1GL2B 4O9BA 2GA1A 1PL5A 2QJKB 2K9JA 3BCCG 4AQRD 2HPCA 5AW5B 3CCLP 3NXSA 3TF5A 1HGZA 3H1HE 4L76A 2CK3H 3VP9A 1PPJD 3M06A 4RJTA 2L5GB 1GU5A 1U7JA 1WRGA 2FFDC 4UB6H 1VQ8P 1LT9C 2NPSA 4XFJA 1SFCD 3CMAP 1AA0A 3B5NA 4H44C 1RF1B 1KV4A 4R4MA 3TYYA 2IYOA 3FWLA 1KILB 3CWBE 3HE5B 4LLHA 4PV1D 1N7LA 4TLFA 3A0HE 3PJSK 3SFEC 1M90Q 1S5LX 3CX5E 2I1KA 5B66H 1NTKE 1FE6A 1IJDB 3CL3D 1M7LA 3L70D 4IL6E 5APYA 2WT7A 2YKOA 2JJLA 1GZLA 2Q6QA 3H1LD 2R3SA 1L0NE 3BCCE 2QJPB 1L0LG 3A0BH 4PD4H 1NU1J 2WPRA 5AW2B 3V4WA 2Y9ZA 1OMIA 1M1JB 1Q7YQ 1N73C 1YQ4C 1EQ7A 2IBZD 1PGOA 3KQGA 3P8MC 4XE5B 1NKNA 3T97B 2E75D 4EOTA 1IFNA 2KLUA 4YTPC 3OW2O 2WPSA 1M8OB 2ZAEB 1VQOP 2H88C 3CWBJ 3V2QA 3V2RA 2W6BA 3A0BE 3L74E 5AVRB 3D6ZA 4IFDK 1NTKG 3LIDA 3RBZA 1JY2O 2P7JA 2KP8A 5KAIE 2J58A 3GW6A 3CCQP 3Q5RA 5AW6B 4GODA 1CI6B 2E76D 2QJYC 3H25A 3E7KA 3WUUA 1DEEG 3L72D 1KQGB 5CCGC 3MP7B 3P8CD 5AVWB 4D6TJ 2Y9YA 1T6AA 1OW6A 3AE9C 3AEBC 4XA4A 1JM0A 4UB8H 2QJPC 4OWFA 1NTMG 2POHA 1LT9A 1RF1C 4U3FE 3ITKA 5B5EH 5KJ7A 3H1JE 1KILC 1PP9J 1ZW0A 5KLIB 3U1CA 5APQA 5APXA 1K05A 3VMXA 1PIXA 1SQQD 1KB9D 1OFCX 1P84H 1OW8A 2WVRA 3NMDA 1PV3A 2P10A 4I7ZB 1ZV8A 1N7SD 1L4AB
chains in the Genus database with same CATH topology
1NTKJ 2BCCJ 2FYUJ 3H1HJ 1L0NJ 3L75J 3TGUJ 3CX5I 3H1KJ 1SQXJ 3L74J 3L73J 3L72J 4D6TJ 5KLVJ 3H1LJ 1P84I 3H1IJ 1KB9I 1SQQJ 1KYOI 1NU1J 1SQBJ 1L0LJ 3CXHI 3H1JJ 1BE3J 1NTMJ 1BCCJ 3L71J 1PP9J 3L70J 1SQPJ 1SQVJ 1BGYJ 3BCCJ 1EZVI 3CWBJ 4PD4I 1NTZJ 4U3FJ 2IBZI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTK J;  2BCC J;  2FYU J;  3H1H J;  1L0N J;  3L75 J;  3TGU J;  3CX5 I;  3H1K J;  1SQX J;  3L74 J;  3L73 J;  3L72 J;  4D6T J;  5KLV J;  3H1L J;  1P84 I;  3H1I J;  1KB9 I;  1SQQ J;  1KYO I;  1NU1 J;  1SQB J;  1L0L J;  3CXH I;  3H1J J;  1BE3 J;  1NTM J;  1BCC J;  3L71 J;  1PP9 J;  3L70 J;  1SQP J;  1SQV J;  1BGY J;  3BCC J;  1EZV I;  3CWB J;  4PD4 I;  1NTZ J;  4U3F J;  2IBZ I; 
#chains in the Genus database with same CATH topology
 2E43 A;  2QG4 A;  3L36 A;  1L4A A;  1LTJ A;  1QGK B;  2BCC J;  1LTJ C;  1NTZ K;  4L73 A;  1LTJ B;  1N2D C;  3CX5 I;  3HE4 A;  2E76 B;  3LIE A;  1KQL A;  1LP1 B;  1RQV A;  3AEA C;  1PZQ A;  3B5N D;  1LP1 A;  2NPS D;  3HE4 B;  4L74 A;  2K3R A;  4RO0 A;  2YIU C;  2YXR B;  2FYU E;  3I5C A;  5CCH A;  1NTZ D;  1DD3 A;  3VYI A;  1T3J A;  4C7R A;  4K3A A;  1QL2 A;  3USS A;  1LWU B;  3Q2Y A;  2ZXE B;  1OXZ A;  3H1I J;  2KSJ A;  3JCU H;  3II6 A;  2YXQ B;  1OVU A;  3HUS B;  3A5T A;  1QVG O;  3MIW A;  1DEB A;  2QEX P;  1S4X A;  2HG5 D;  1JMM A;  3L71 J;  5KAF H;  5KLV E;  3TGU D;  1LTS C;  1FDM A;  2PGD A;  1VQL P;  1JO5 A;  4H13 C;  1NAY A;  1D7M A;  1GL2 A;  1SQB E;  1KB9 H;  4GKG A;  5C39 A;  4ZKU A;  1JOC A;  5TIS H;  3TSI A;  5BU5 A;  1FZG A;  1HF9 A;  4YXW H;  2O01 J;  1T8Z A;  2WSC H;  4TT3 H;  1VL2 A;  5APV A;  3A7O A;  2NPS B;  3H1K G;  3HD7 B;  3RL0 C;  3B5N B;  3MZW B;  4PV1 B;  4B86 A;  2LXC B;  2FYN C;  2YIU B;  1SFC B;  2KZJ A;  1N7S A;  3V2P A;  1KTM A;  3VMA A;  4KHX A;  5EFW B;  3LW5 H;  1SQX E;  3H1L J;  3GF7 A;  1M57 D;  2JWA A;  5AVY B;  3ABV C;  4MN4 C;  3VN0 A;  1SQB J;  3M0D C;  4I7Z C;  1J1D C;  2IDB A;  4WBA A;  2R32 A;  2I8D A;  1AFO A;  1NO4 A;  1Y8A A;  3U59 A;  1E5W A;  2P58 A;  2UWJ E;  3T97 A;  1DD4 A;  5CCG A;  1IK7 A;  2M8R A;  2YMK A;  4JF7 A;  3RL0 g;  4AYC A;  1VPC A;  1KZU B;  3BCC J;  1MV8 A;  2IZ1 A;  1U57 A;  1KYO D;  3HTK A;  4QMA A;  4PD4 I;  3GMA A;  3TNU B;  1VQM P;  3P32 A;  4N78 D;  4OGQ B;  4W7Y A;  4ZNC A;  3RGU A;  2Q3E A;  4R4L A;  4Z1M H;  2AXT H;  3HUS C;  2FYU J;  5KKZ C;  1L0L D;  2ZT9 B;  4GIF A;  1SQX G;  2XKM A;  1MFZ A;  2KS1 B;  2V7Q J;  3A3Y B;  3CX5 H;  1JY2 N;  3FGA D;  4GT1 A;  4NPF X;  4YPC A;  2IZ0 A;  1TU3 F;  3L73 J;  2BCC E;  1L0L K;  4NPD A;  2QM7 A;  1S1C X;  5H2F E;  2E74 B;  4H13 D;  3CLQ A;  3QH9 A;  1MFT A;  1LTB C;  1JY3 N;  4M3L A;  3SFD C;  2H43 A;  1SQV E;  5CBO A;  3IAO A;  1L4A C;  1EXJ A;  2J59 M;  1BCC D;  1IC2 A;  2A45 G;  2E76 C;  4H0L B;  2D2C D;  4H44 D;  3V6I A;  4PV1 C;  3RK3 D;  2V4H A;  4C7N A;  1GD2 E;  2FXO A;  2G8Y A;  3PLN A;  4C7N B;  1R5L A;  2K9J B;  1NU1 E;  2XND H;  5AVX B;  3CPW O;  2HPC B;  1KYO H;  2N1T C;  2Z5H A;  3AEE C;  3AEF C;  3NTN A;  3EQ2 A;  1NTZ J;  2FBW C;  2R5D A;  2OGU A;  2KI7 B;  2YNY A;  4U3F J;  5B66 E;  3CCV P;  5M1B A;  3G3Z A;  1CZQ A;  2C0X A;  4WWI A;  2IBZ I;  4D6T E;  2ZXX A;  3AE2 C;  5DJU B;  5KKZ B;  1YJ9 P;  2DW3 A;  1LJ2 A;  3L74 G;  1EDL A;  1Q2N A;  4BRY B;  3FX0 A;  3H1K J;  3SWY A;  4BRY A;  1BDC A;  2WT7 B;  3BRT B;  1FZF A;  1LNQ A;  2KSE A;  2M0B A;  1DIP A;  2B89 A;  1N8R Q;  3AE3 C;  1G1I A;  4OGQ C;  1JEK A;  1NOH A;  1Z56 A;  2H89 C;  1XTG B;  5AW4 B;  1URQ B;  1JUN A;  2I1J A;  2M3E A;  4WVZ A;  4DOJ A;  1URQ A;  1SLQ A;  4EI2 A;  1BGY E;  5APU A;  2D2C C;  3HUS A;  1ZOY C;  2WSS H;  1BE3 G;  2J5U A;  3IR9 A;  3QWO C;  1NVO A;  1ZRT D;  3L71 D;  4H44 B;  1VQ7 P;  3L75 D;  4IL6 H;  2IX7 C;  3OAK A;  4I1L A;  3M9H A;  1SQP J;  1G1J A;  3L70 G;  5B5E E;  1E79 H;  3F5H A;  1S2E A;  2A06 D;  2O1J A;  4OH8 B;  4U3F G;  4A7P A;  1KIL E;  3EFF K;  1Q90 D;  1WT6 A;  4KT0 J;  5CCH D;  2WWW A;  4W7Z A;  3PH0 A;  2GUS A;  4PJ0 H;  1N73 B;  2AXC A;  5TIS E;  1S5L E;  1NTK J;  1VDF A;  3CC4 P;  1G2C A;  2V7Q H;  3CC7 P;  4EYY Q;  3H1H G;  2C9L Y;  3U1A A;  1LTI C;  3M0A A;  2OYI C;  1L4A D;  3JSV C;  1VF5 C;  1W2B O;  3L72 G;  1HUC A;  2HR3 A;  1KOR A;  3V5B A;  3AE4 C;  4OGQ D;  1IO4 A;  1S9K D;  2M5A B;  4AUW A;  1VQ6 P;  2NZ2 A;  2OTJ P;  3R4Y A;  3G9R A;  2MKV A;  1URQ C;  3VP8 A;  1LT1 A;  2LKM A;  1DH3 A;  2WPV B;  3L4F A;  1LT9 B;  1P84 E;  1Y47 A;  1XTC C;  3Q1M A;  1T2K C;  2E42 A;  2OTK E;  2FYZ A;  2KYV A;  5KJ7 D;  1KQS O;  2CPB A;  2FY8 A;  3RK3 B;  2XDJ A;  3CXH E;  2QJY B;  3GG2 A;  4OVN F;  1SQV J;  1KMI Z;  1H0T B;  3KXD A;  1GL2 C;  3L73 D;  4HKZ H;  2AEM A;  1LTT C;  1EDI A;  1J1E C;  3H1K E;  4EIJ A;  3G4S P;  3S4R A;  1FS0 E;  3VMZ A;  1NTM D;  1SQP K;  2ZFC A;  5H2F H;  1X0T A;  1OW7 A;  1HTL C;  1L0N G;  1SQV K;  1MKM A;  3L75 J;  4HB1 A;  1HWT C;  1M1K Q;  1VF5 D;  2KLV A;  1Y9B A;  1PPJ E;  1NTM K;  1QEX A;  3KPE A;  3SWK A;  5KAI H;  2N9B A;  1NWQ A;  2AXT E;  5KLV G;  3CWB D;  1USD A;  3M0D A;  1VQ4 P;  3GHG B;  3CX5 D;  4I2L C;  1X9V A;  3C8V A;  1HVV A;  3L70 E;  2ZVO B;  4WY4 B;  4ASW A;  5CCG D;  5CBN A;  1H88 A;  1PGQ A;  3CC2 P;  1VQN P;  3RL0 D;  1AVO A;  1NGM B;  1L0N D;  1BE3 E;  5DJT B;  1NTK K;  3OA7 A;  3LW5 J;  1BGY G;  1EZV G;  3H1I D;  3M9B A;  2KXP B;  3CCM P;  2NRG A;  1JTH B;  1PP9 E;  1JMB A;  2E5T A;  3B4S A;  5AVS B;  3RK2 B;  3IF4 A;  3C1L A;  2FXM A;  2OQQ A;  2WPQ A;  2Q5U A;  5CHX A;  1RF1 A;  1FZA A;  2H8P D;  1ZN5 A;  4NPE A;  3BAS A;  5APS A;  1YHQ P;  1KIL A;  3HE5 A;  1FJP A;  4PD4 E;  1KFN A;  1M56 D;  1EDK A;  2CPS A;  1SFC A;  2WIT A;  2YO3 A;  3L74 D;  4RKU J;  1GW3 A;  3IN6 A;  2JWD A;  3EWK A;  3L35 A;  2HOD B;  4Y99 B;  1H89 A;  1SQP D;  2WQY C;  1P84 I;  1VQP P;  2VRS A;  2OYH C;  2IPP A;  2OYH B;  1EZV D;  3H1I G;  1GL2 D;  2R3C A;  3TNU A;  3CXH I;  1J2J B;  1NU1 G;  3P8C E;  2WMM A;  3RL0 B;  2H7H A;  3AE6 C;  3HRN A;  3BVH A;  1OX3 A;  1HH0 A;  3V2N A;  1W2E A;  3H1H D;  5KTB A;  4H0L D;  4KJM A;  5CCH C;  1VQ9 P;  1YBK A;  1JY3 O;  3AEC C;  3HTK B;  1BSN A;  1SQV G;  1FC2 C;  1NH4 A;  2HLO A;  2G3A A;  1X79 B;  2OAR A;  2PRR A;  2XNX A;  3KHU A;  3PTZ A;  1KQF B;  2KIK A;  1RE4 C;  2E74 D;  1UIX A;  3H1J D;  2SPZ A;  1GW4 A;  1RHZ B;  2A06 G;  5GTH H;  3Q3D A;  1JY3 P;  3WMM 0;  1OIP A;  1NTK D;  1PPJ G;  3TDK A;  5L8R J;  1BDD A;  2ITA A;  1KB9 E;  1L0N J;  2KS1 A;  1CI6 A;  1YTZ I;  5E79 H;  4DT0 A;  1ZR2 A;  1SQX J;  3H1L E;  3BCC D;  4L75 A;  2Y0D A;  5AVQ B;  1FAV A;  1S72 P;  1AV1 A;  1IFD A;  2O3J A;  3FXD A;  3GF3 A;  2WSF J;  1JY2 P;  2IFN A;  1PGP A;  2IBZ E;  1EDJ A;  2Z5I A;  3KZI E;  3KYQ A;  1A02 J;  5GTH E;  4WB4 A;  4GDO A;  1YJN P;  1L0L J;  2JDI H;  1NTZ E;  5TJH A;  1NTM J;  4H0L C;  4IFF A;  1NAF A;  4BWN A;  3HD7 C;  1BCC J;  2GM4 A;  3MGN A;  2FYN B;  3CD6 P;  1SFC C;  2FYU K;  3OJA B;  3CCS P;  1GK6 A;  2N1T A;  2RH0 A;  1WMK A;  2W6A A;  2QA4 P;  1H0T A;  1NJI Q;  1ZXG A;  2W6J H;  3CWB G;  1GTW A;  4PJ0 E;  3AED C;  5KLV D;  4BXL A;  3VMY A;  3N7N A;  3L72 E;  4JBZ A;  2Y0C A;  3BRV B;  3CCU P;  1SQB D;  4WY4 C;  2Q7C A;  5BVZ A;  3M91 A;  1Q86 Q;  3ZDM A;  3B71 A;  2OYO A;  1LTG C;  1GMJ A;  1SQB K;  1A02 F;  3H1L G;  5CJ4 A;  4U3F D;  2RMZ A;  1YQ3 C;  3RK2 D;  3I56 P;  1LWU C;  1LWU A;  3MHV A;  4DCK A;  1RF0 A;  2AEF A;  2BEQ D;  1RF0 C;  2XV5 A;  3L37 A;  4JYC A;  2BEZ F;  2A45 I;  4W80 A;  5GTI H;  5AW7 B;  1IZN B;  1SQQ E;  4LGD E;  1X22 A;  2RN0 A;  3L71 G;  1K8A Q;  2W90 A;  2E75 B;  3IFM A;  2WSE J;  4C46 A;  2B9B A;  1FDI A;  1YJW P;  3CXH H;  5K5G B;  1K73 Q;  2LXB A;  2KZI A;  4ASV A;  2QJK C;  2QVA A;  1SQX K;  2B87 B;  5GTI E;  1FOS E;  2B87 A;  3GLM A;  1H8A A;  1J1E B;  2C9N Y;  5KAF E;  1T2K D;  1KN7 A;  1EC5 A;  4JPZ B;  1IFI A;  3E1I A;  2FYU G;  2FYU D;  2QRX A;  3RBX A;  4EDF A;  2XU6 A;  5APW A;  2IYP A;  2K37 A;  5AVU B;  3WUT A;  1ZME C;  2NPS C;  3M9Q A;  3MUD C;  3L74 J;  1NKZ B;  3HD7 A;  3KZI H;  1VQK P;  2JR8 A;  2W8Z A;  4N6J A;  5KLV K;  2PAJ A;  2JEE A;  5KLI C;  2P2U A;  2QM8 A;  4U7J A;  1N7S B;  1HGV A;  3FXE A;  5KLV J;  2MJZ A;  1RH5 B;  2ZYD A;  2WZ7 A;  2KUB A;  1PFI A;  3TGU E;  1AQT A;  2R44 A;  1JCD A;  3H1J J;  1CW5 A;  2RKL A;  3Q5S A;  3MD0 A;  3RK3 C;  5BU8 B;  3Q5P A;  2ZJS E;  4IOI H;  3CCR P;  2OYI B;  1SS1 A;  2ZYA A;  1KD1 Q;  2A45 H;  3O8Z A;  1AJY A;  4WY4 D;  1ZP0 C;  1SQV D;  2OTL P;  3AE1 C;  3C9I A;  2M3B A;  5AVT B;  2FKW B;  4DJG A;  3P7K A;  5AW3 B;  2FFD B;  3S9O A;  2FFD A;  2K88 A;  3PP5 A;  2QSI A;  5APT A;  3H6P A;  3TGU G;  3AE8 C;  1SQX D;  2E75 C;  2WSF H;  4UB6 E;  1FZB A;  2P1J A;  1R5S A;  2E5Y A;  4YXD C;  1RQU A;  2B88 A;  2QIW A;  3I55 P;  2OYI A;  4D6T G;  4D6T D;  3N4X A;  1VQ5 P;  3SSU A;  2E74 C;  1T3U A;  2QE7 H;  3WU2 E;  1SQQ J;  4CPG A;  1SVF A;  1IFP A;  4WY4 A;  5CMZ A;  1YI2 P;  1KYO E;  5E79 E;  3BAT A;  4ZMD A;  5AW8 B;  3MUD A;  2Q1K A;  1NHL A;  1SQP G;  1BCC G;  4N78 E;  4ZKP A;  1LGH B;  3CME P;  2AEJ A;  1BGY D;  1URQ D;  2L91 A;  1JTH A;  2N1T B;  3D71 A;  1L0L E;  1LTA C;  1JNM A;  3K5B A;  1ZRT E;  3L71 E;  3L75 E;  1SP4 A;  1EXI A;  1FU1 A;  1KC8 Q;  1J1D B;  2BCC G;  2BCC D;  5AVV B;  1NYH A;  2YKQ A;  4HJG H;  3E1R A;  2A06 E;  3HD7 D;  3VTP C;  1SQQ K;  3L75 G;  1OWA A;  1KIL D;  1W5C E;  1FZC C;  1USE A;  2IFM A;  2HOD A;  1UII A;  2YMY A;  3AE5 C;  3JC2 2;  4Y99 C;  1ZLL A;  4RES B;  5AW1 B;  1GU4 A;  1NU1 K;  3EFG A;  2OYH A;  1BCC E;  3F89 A;  1KB9 I;  1PGJ A;  2KOG A;  3RK3 E;  1FJK A;  1M1J A;  2LR2 A;  1M1J C;  1IFJ A;  1NU1 D;  3CI9 A;  4JQ0 D;  1BE3 J;  3JCU E;  4UB8 E;  2ZT9 C;  2D2C B;  2KB7 P;  2C0W A;  3PRJ A;  4K35 A;  1RE3 A;  5AW9 B;  3B5N C;  2K1A A;  3A2A A;  3R2P A;  3D6Y A;  5KJ7 C;  3L70 J;  1YYC A;  2O01 H;  2WSC J;  1RY3 A;  2YKP A;  1HBW A;  1L2P A;  1P84 D;  2PP6 A;  4HH2 A;  4H13 B;  1IK9 A;  2FXP A;  1EZV I;  3SWF A;  1RE4 A;  2O1K A;  3AEG C;  2JO1 A;  1L0N K;  3WUV A;  1NTZ G;  2YO2 A;  1IFM A;  3W68 A;  1QLE D;  1AVY A;  1MUU A;  1S3J A;  1FZE A;  2GUV A;  2HFE D;  3MTU E;  1Q81 Q;  1G2C B;  5AW0 B;  3L73 E;  1MZ9 A;  1KFM A;  3H1H J;  3KDP B;  1QL1 A;  4IL6 X;  4I6M C;  3UIA A;  1N73 A;  2IBZ G;  3G71 P;  1ZR4 A;  1X8Y A;  3D70 A;  3L73 G;  1AQ5 A;  1VF5 B;  3B8E B;  3H1K D;  1QX8 A;  3L72 J;  3V4Q A;  2M5A A;  2W27 A;  2O01 N;  2Y0E A;  3AE7 C;  1K04 A;  1U7M A;  3TGU J;  1KYO I;  1SQB G;  2HYN A;  2XZR A;  1CSB A;  1JCC A;  2N1T D;  2WTY A;  1GDT A;  2N9Y B;  1OVV A;  2W83 C;  1BSH A;  3H1J G;  4GOE A;  1FZC B;  1JB0 J;  1FZC A;  2KK7 A;  3S1K A;  1GK4 A;  3CCE P;  1YTZ T;  5AVZ B;  4Y28 J;  4N3Y B;  3RK2 C;  2ZYG A;  4GOF A;  4JYB A;  4IFM A;  1K9M Q;  1BE3 D;  1HJ0 A;  1YIJ P;  2R5B A;  3WU2 H;  3TK1 A;  3H1I E;  3W67 A;  2KNC A;  2PFX A;  2ZVN B;  1PP9 D;  2WSE H;  5CJ0 A;  2KNC B;  1S5L H;  1S9K E;  1DX7 A;  1RE3 C;  3H32 A;  1FDO A;  2JP3 A;  3H32 B;  2ZT9 D;  4LC1 A;  3G6E P;  3FWN A;  2Q3I A;  1N7S C;  2Q9I A;  1FOS F;  1R8E A;  3CXH D;  1HJB A;  2BAS A;  3PHL A;  4PD4 D;  4DZO A;  3GHG A;  1SQQ G;  2P67 A;  3GHG C;  2K9Y A;  3O6Q A;  3CCJ P;  1YIT P;  1N86 A;  1OVR A;  1SQP E;  3NFQ A;  3O6Q B;  4HYT B;  1FBM A;  1PP9 G;  2JKV A;  1QVF O;  3VOP A;  1Q82 Q;  1EZV E;  1BGY J;  1OZH A;  3A0H H;  1NTM E;  2Z4E A;  1GL2 B;  4O9B A;  2GA1 A;  1PL5 A;  2QJK B;  2K9J A;  3BCC G;  4AQR D;  2HPC A;  5AW5 B;  3CCL P;  3NXS A;  3TF5 A;  1HGZ A;  3H1H E;  4L76 A;  2CK3 H;  3VP9 A;  1PPJ D;  3M06 A;  4RJT A;  2L5G B;  1GU5 A;  1U7J A;  1WRG A;  2FFD C;  4UB6 H;  1VQ8 P;  1LT9 C;  2NPS A;  4XFJ A;  1SFC D;  3CMA P;  1AA0 A;  3B5N A;  4H44 C;  1RF1 B;  1KV4 A;  4R4M A;  3TYY A;  2IYO A;  3FWL A;  1KIL B;  3CWB E;  3HE5 B;  4LLH A;  4PV1 D;  1N7L A;  4TLF A;  3A0H E;  3PJS K;  3SFE C;  1M90 Q;  1S5L X;  3CX5 E;  2I1K A;  5B66 H;  1NTK E;  1FE6 A;  1IJD B;  3CL3 D;  1M7L A;  3L70 D;  4IL6 E;  5APY A;  2WT7 A;  2YKO A;  2JJL A;  1GZL A;  2Q6Q A;  3H1L D;  2R3S A;  1L0N E;  3BCC E;  2QJP B;  1L0L G;  3A0B H;  4PD4 H;  1NU1 J;  2WPR A;  5AW2 B;  3V4W A;  2Y9Z A;  1OMI A;  1M1J B;  1Q7Y Q;  1N73 C;  1YQ4 C;  1EQ7 A;  2IBZ D;  1PGO A;  3KQG A;  3P8M C;  4XE5 B;  1NKN A;  3T97 B;  2E75 D;  4EOT A;  1IFN A;  2KLU A;  4YTP C;  3OW2 O;  2WPS A;  1M8O B;  2ZAE B;  1VQO P;  2H88 C;  3CWB J;  3V2Q A;  3V2R A;  2W6B A;  3A0B E;  3L74 E;  5AVR B;  3D6Z A;  4IFD K;  1NTK G;  3LID A;  3RBZ A;  1JY2 O;  2P7J A;  2KP8 A;  5KAI E;  2J58 A;  3GW6 A;  3CCQ P;  3Q5R A;  5AW6 B;  4GOD A;  1CI6 B;  2E76 D;  2QJY C;  3H25 A;  3E7K A;  3WUU A;  1DEE G;  3L72 D;  1KQG B;  5CCG C;  3MP7 B;  3P8C D;  5AVW B;  4D6T J;  2Y9Y A;  1T6A A;  1OW6 A;  3AE9 C;  3AEB C;  4XA4 A;  1JM0 A;  4UB8 H;  2QJP C;  4OWF A;  1NTM G;  2POH A;  1LT9 A;  1RF1 C;  4U3F E;  3ITK A;  5B5E H;  5KJ7 A;  3H1J E;  1KIL C;  1PP9 J;  1ZW0 A;  5KLI B;  3U1C A;  5APQ A;  5APX A;  1K05 A;  3VMX A;  1PIX A;  1SQQ D;  1KB9 D;  1OFC X;  1P84 H;  1OW8 A;  2WVR A;  3NMD A;  1PV3 A;  2P10 A;  4I7Z B;  1ZV8 A;  1N7S D;  1L4A B; 
#chains in the Genus database with same CATH homology
 1NTK J;  2BCC J;  2FYU J;  3H1H J;  1L0N J;  3L75 J;  3TGU J;  3CX5 I;  3H1K J;  1SQX J;  3L74 J;  3L73 J;  3L72 J;  4D6T J;  5KLV J;  3H1L J;  1P84 I;  3H1I J;  1KB9 I;  1SQQ J;  1KYO I;  1NU1 J;  1SQB J;  1L0L J;  3CXH I;  3H1J J;  1BE3 J;  1NTM J;  1BCC J;  3L71 J;  1PP9 J;  3L70 J;  1SQP J;  1SQV J;  1BGY J;  3BCC J;  1EZV I;  3CWB J;  4PD4 I;  1NTZ J;  4U3F J;  2IBZ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...