1SQXJ

Crystal structure analysis of bovine bc1 with stigmatellin a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
60
structure length
60
Chain Sequence
b'APTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 22
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1sqxJ00
5KLVJ 1SQVJ 3H1LJ 3H1JJ 1BGYJ 1BE3J 1NTZJ 1SQPJ 3CX5I 3BCCJ 3L72J 1BCCJ 3CWBJ 4D6TJ 3L71J 3L75J 2IBZI 1EZVI 3H1KJ 4PD4I 3TGUJ 1L0LJ 3CXHI 1L0NJ 1SQXJ 1KYOI 1NTKJ 1P84I 1PP9J 3L74J 2FYUJ 3L70J 3H1HJ 3H1IJ 2BCCJ 1NTMJ 3L73J 4U3FJ 1NU1J 1SQQJ 1KB9I 1SQBJ
chains in the Genus database with same CATH superfamily
1YJWP 1EDIA 4PV1D 1QL2A 1AVYA 3FWLA 3L75G 1BDCA 1T3JA 2A06G 1P84D 3L72J 1VQ7P 1PL5A 3B5ND 3CXHE 1LWUC 5AW5B 1L0NE 3O8ZA 4CPGA 1MV8A 1GW4A 3RK3E 3M91A 1VQKP 3NXSA 1E5WA 2KS1A 1KD1Q 4D6TD 2KYVA 2R3SA 3SFDC 2KSJA 2QA4P 5C39A 2K1AA 3VN0A 1BE3D 2FYUJ 2QE7H 1IFMA 2KNCB 1LJ2A 3OA7A 1FZFA 3GG2A 1YTZI 1NTMK 1NKZB 2POHA 4GT1A 4RJTA 1A02F 2FFDA 3KZIH 5EFWB 1L0NJ 2O3JA 1SVFA 1NU1G 1SQVD 1SQQE 5AVTB 1T2KD 1J1EC 1LWUA 4H0LB 3L72G 5KAIE 5AW6B 1XTGB 1PP9D 1M8OB 3C8VA 3HD7D 3P8CD 3V2QA 1KQGB 2HG5D 2WMMA 3EQ2A 1FOSE 1PP9E 1LNQA 3G4SP 4WY4D 2Y0CA 3A2AA 2CPBA 2C9LY 1KILE 1ZV8A 3MUDC 2QJYB 2ITAA 3BCCE 3TYYA 4WB4A 1JY2O 2MJZA 4L76A 3HE4B 2FYUG 1CZQA 3M0AA 1L4AC 1GDTA 3L70E 2M0BA 4BWNA 1SQQJ 4MN4C 1ZRTE 5B5EH 2QSIA 1M90Q 2OYIB 3H1JE 1NTKK 2NPSB 1L0LD 2B87A 2FBWC 1L0NG 3BASA 1CW5A 4W7ZA 4W80A 1MFTA 3CX5H 2R44A 1GK4A 1PP9J 2IX7C 3E1IA 1NGMB 3O6QB 5KLVD 2P67A 1AFOA 1OW6A 4Y99B 1M7LA 2QRXA 1NKNA 2QG4A 2KI7B 5AW3B 2QJPC 2YKPA 3CCSP 3BCCJ 1IK9A 3G9RA 3M0DC 1SQBK 2KOGA 5AW8B 5CMZA 3LIDA 2H8PD 3VP9A 4W7YA 2I1KA 2R5DA 2V7QJ 3L70J 1NTME 1PPJD 2E74B 1IC2A 1N7LA 1M1JC 3H1JJ 3F5HA 1HBWA 1LTAC 3VYIA 1L4AA 1GU4A 1K04A 1L0LJ 3H1ID 3CC2P 3CCEP 2V4HA 3V5BA 5APSA 3N7NA 2D2CD 4U3FD 2JKVA 1SQQG 4N78E 2FXMA 5AW1B 3Q3DA 2YIUB 3TF5A 4DZOA 2ZJSE 1M56D 1PP9G 5M1BA 1URQD 4TLFA 2Z5IA 1NTMJ 3FXEA 2WSEH 3BCCG 4H0LD 3P8MC 1BDDA 1KYOD 1KV4A 1HF9A 2WT7B 1VQ9P 3UIAA 1H89A 5CHXA 3L70G 1M1JA 1NTKE 4UB6H 2O01N 5BVZA 3H1JG 4I7ZB 1FC2C 3Q5SA 2WPVB 1S5LX 5DJUB 5APWA 1CI6A 1SQPK 4GDOA 2E5YA 1AJYA 4DT0A 5K5GB 3RL0g 3H25A 3WUVA 2BEZF 2GA1A 1SQBE 2K88A 4WVZA 2KUBA 2OQQA 1SS1A 1Q82Q 2O01J 2RMZA 3M9HA 3FGAD 1WT6A 2BEQD 2PFXA 1NTMG 1NTKJ 4HKZH 3WU2E 3MTUE 1NH4A 4OGQC 2KLUA 1K73Q 2IZ0A 3S9OA 4H44C 3CCVP 1IJDB 3V4QA 4PJ0E 2OYOA 1IZNB 3QH9A 4RESB 2OYHB 3BATA 1Y47A 3GF7A 5APQA 1SQBJ 1NTZD 3RK2C 5KJ7C 3V4WA 1VDFA 3TNUB 3B5NA 1OW8A 2QVAA 1KB9H 1VQOP 5AVQB 5E79E 3V2NA 2ZAEB 1VF5B 2E75C 2P7JA 5AW2B 3KQGA 3BRTB 5B66H 1LTJB 2JP3A 3MZWB 1YIJP 2BCCE 2Y9ZA 2IBZD 1GD2E 4WY4C 2OTLP 1HGVA 1FDOA 3LW5J 1GTWA 4I6MC 3HTKA 1NTKG 2I8DA 1SP4A 4QMAA 1VQ5P 5GTHH 1KFNA 2K3RA 3M9BA 3D71A 4PV1B 2JDIH 2XNXA 5AVYB 3CMAP 2SPZA 1N7SD 1SQBG 2BCCJ 2Y9YA 1BGYD 2WQYC 5CCGC 2LR2A 3L75D 1S72P 2A06D 2E5TA 4IFMA 3VOPA 1XTCC 1R8EA 4L73A 5APXA 4WY4A 5KLIB 3BRVB 2M5AA 1P84H 3AE6C 4JYCA 2OTKE 3A5TA 5TJHA 2HPCB 2XZRA 2QM7A 3A7OA 3V2PA 1H8AA 3N4XA 3CCLP 3L73E 4HB1A 1RF1A 3HUSB 2YO3A 1BGYJ 3CC4P 4N3YB 3HD7B 1LTTC 5CCGA 2BCCG 3AECC 2M8RA 5KAFH 3I55P 1NU1D 1KB9E 1S2EA 4HH2A 1U7MA 1J1DB 1FZEA 1PGOA 3CMEP 3I5CA 3L72D 4WWIA 2YXRB 1SFCD 2E43A 3PJSK 1NHLA 2C0WA 3GLMA 1GW3A 2J5UA 2E76D 4H13C 1E79H 3H32B 4C7NB 3B4SA 4Y28J 3L73J 1AA0A 3JC22 3RBZA 1EXJA 2AXTE 2OGUA 2A45I 2FYUD 2KNCA 2FFDC 3VMAA 1FJPA 2A45G 3CXHD 3A0BH 3IN6A 4XE5B 2HR3A 1L0ND 1RQVA 2VRSA 3RK3D 2YMKA 2NPSC 3WUUA 4JQ0D 1FZAA 1JMBA 2YKQA 3SFEC 4BRYB 4Y99C 1AVOA 2YXQB 3L73G 2D2CB 4RO0A 4GIFA 4PD4H 1KQFB 1KB9I 1T3UA 1PFIA 4R4MA 3SWFA 1JCDA 2Q5UA 2E74C 1K8AQ 2ZYAA 2JJLA 2WSCH 3HE4A 1FOSF 1URQB 1SQQD 4KJMA 2N1TD 1S9KE 1OW7A 2OYIA 2Y0EA 2NPSA 1FJKA 1PIXA 3OW2O 1MUUA 2ZYGA 3HRNA 1FDIA 5APUA 1KC8Q 1MFZA 1KILD 1DH3A 2CPSA 2WWWA 5TISH 1SQXK 3BCCD 4YTPC 4GOEA 4EDFA 4Z1MH 2KXPB 2J58A 3GMAA 4ZNCA 1LTIC 3SWYA 1GL2D 3L70D 2HLOA 3CXHI 2P2UA 1ZRTD 4EYYQ 3H1JD 2ZXXA 1KYOH 3AEGC 1X22A 1UIXA 4ZKUA 1ZMEC 3KYQA 4I7ZC 3PH0A 3A0BE 2IFNA 2FYNC 1VL2A 3H1HE 4ZMDA 1Y8AA 3A0HH 1JO5A 1X8YA 2QEXP 2K37A 3KXDA 3U1CA 4LC1A 3LIEA 1NTMD 1AQTA 1MKMA 2AEMA 5CCHD 2R32A 1JY3P 4JF7A 1VPCA 2KK7A 2MKVA 2ZXEB 4PD4E 2WT7A 1HGZA 2QIWA 4OWFA 2DW3A 4N78D 5GTIH 3H1HJ 3VMYA 1U57A 3KZIE 2OYHC 3RL0D 3VMZA 3PTZA 1DD3A 3TGUD 1PGQA 1JTHB 5DJTB 3K5BA 1J1EB 3TGUE 1LP1B 1SQXE 1USDA 1EC5A 5L8RJ 4XFJA 3AE1C 2XU6A 1VF5C 2H89C 2OTJP 2KZJA 1OVVA 1LTJC 1IFJA 1YJNP 1S3JA 5TISE 1NTKD 1OXZA 1BSNA 1LT9C 1NTZK 1N7SB 3CCRP 1FBMA 1IFIA 4JBZA 4EIJA 1L4AB 3PHLA 1WMKA 3CWBE 5B5EE 3TGUJ 4PV1C 3H1HG 2OYHA 3CI9A 4HYTB 1YYCA 1SQBD 3B5NC 3KHUA 3M06A 1DX7A 3CX5E 2N9YB 2JR8A 2XV5A 1GU5A 2H7HA 3NFQA 3TNUA 1ZR2A 3A0HE 1G2CB 4PD4I 1OVRA 2QJPB 2H88C 3W68A 3I56P 3P7KA 1LTJA 2HFED 1QGKB 2AEFA 1FZBA 2ZVNB 2N9BA 1LT9A 3Q2YA 2PAJA 3CWBJ 1IK7A 1T8ZA 2WITA 1JNMA 3MGNA 4AUWA 2JEEA 1UIIA 2QM8A 2IYPA 5APTA 1N73B 2Q7CA 3KDPB 1CI6B 3TGUG 1SQXG 5BU5A 1SFCB 5KKZC 1T2KC 2KIKA 2ZFCA 1NAFA 3HUSC 2BCCD 2E76B 4HJGH 3L74E 1MZ9A 2YNYA 3T97B 3HD7C 3PP5A 4N6JA 3MHVA 1DD4A 3D6YA 3CPWO 2IZ1A 1U7JA 4ASWA 4I2LC 3TSIA 1J1DC 2ZT9B 1ZXGA 2QJKC 3FX0A 4WBAA 5H2FH 1CSBA 3CLQA 3L37A 3V6IA 3CWBG 2FXOA 4UB6E 1SQPE 2L91A 3CX5I 1Z56A 3D70A 3CC7P 1S4XA 4ASVA 1NU1K 2HPCA 3RK3B 5AW7B 2O1KA 1RF1C 2C0XA 3L74J 2W83C 2WPRA 2IDBA 1H0TB 1EQ7A 3C9IA 3HUSA 1GZLA 4YPCA 3TK1A 1L4AD 1JY2P 1DEBA 1BCCE 5AW0B 3AEEC 2WSEJ 4M3LA 3HD7A 3U59A 2W6BA 2W6JH 3HE5B 5KTBA 1KQSO 3ITKA 1VQNP 3CCMP 3GW6A 1RH5B 3RBXA 4DOJA 5BU8B 1SQPJ 1X0TA 3ABVC 3AE7C 3G71P 3WMM0 3IAOA 1GK6A 3L73D 5APVA 1NOHA 4C7NA 3H32A 2LXBA 2N1TB 4OVNF 1RHZB 2D2CC 1NYHA 3AEAC 1Q7YQ 1W2BO 1BCCJ 2KZIA 2K9JB 4B86A 3NTNA 3L74G 1K9MQ 3TDKA 1KB9D 2FKWB 2W27A 1Q2NA 1VQ8P 1KILB 2PGDA 2G3AA 1FDMA 2G8YA 2E75B 3IR9A 2K9YA 1PGJA 1URQC 1PV3A 5B66E 1NAYA 1HUCA 1GL2B 1J2JB 3OJAB 4H0LC 5KAIH 2NZ2A 3USSA 3AE5C 4ZKPA 3CCQP 2OARA 1SQPG 1AV1A 1ZOYC 2LKMA 5AVZB 1VQ4P 1RY3A 1EZVE 5GTHE 4BRYA 1SQQK 4IL6H 3U1AA 1SQVK 2PRRA 2Z5HA 2QJYC 2ZT9D 3R4YA 2GUSA 3MP7B 2E42A 4NPFX 1BCCG 4L74A 3C1LA 3Q5RA 3L71E 2Q3IA 2XNDH 2O1JA 5AVSB 2WZ7A 2OYIC 1URQA 3CCUP 1QLED 2Q6QA 3GHGB 1Y9BA 2XDJA 1M57D 3PLNA 1FZCB 1IFPA 2B9BA 3BVHA 2HODB 4A7PA 1N8RQ 1QX8A 1P84E 2Q1KA 3B71A 1RQUA 3FXDA 4BXLA 1S1CX 2R5BA 3MD0A 5CJ4A 2P1JA 1L0LK 3F89A 1ZN5A 2Q9IA 4U7JA 4IFDK 3RL0B 5APYA 2B89A 4GOFA 1X9VA 1HJ0A 1VQ6P 1T6AA 4D6TE 3CL3D 3L71J 4OGQD 4EI2A 3MIWA 5KLVK 2UWJE 1S9KD 4IOIH 4H44D 1D7MA 1N86A 1TU3F 2XKMA 1BE3E 1LTBC 4R4LA 2L5GB 5KAFE 2M3BA 1AQ5A 3B8EB 1EZVI 2YIUC 4IFFA 3RK2D 3R2PA 5KJ7D 3V2RA 2P10A 3O6QA 2KS1B 1USEA 1SQVE 1EZVG 2E75D 1OVUA 4AQRD 4H13B 1M1KQ 4DJGA 3E7KA 4D6TJ 1HJBA 2FXPA 1VQLP 1Q90D 2JWDA 3P8CE 4NPDA 2O01H 1Q81Q 1VQPP 4IL6E 2W6AA 1BE3J 4XA4A 1IO4A 1X79B 1HWTC 1N7SC 3L71G 2WTYA 2FFDB 1QVFO 3H1HD 1P84I 1JY3N 1KORA 1K05A 1JB0J 4UB8H 3CD6P 2J59M 1LWUB 5CBOA 1SQVJ 1RE4C 1NO4A 1HVVA 1KMIZ 1JTHA 1A02J 1L0LE 1IFDA 5CCGD 3L4FA 1LP1A 1YJ9P 2H43A 1RE3C 5KLVE 1FU1A 2AXCA 2KSEA 1N2DC 1KFMA 4PD4D 4D6TG 1JCCA 3IF4A 3WU2H 1LTGC 4O9BA 5AVWB 5AVRB 3MUDA 2YKOA 2CK3H 3AE4C 1N7SA 1BE3G 3G3ZA 3LW5H 1EDKA 4PJ0H 3NMDA 1PPJE 2B87B 2HYNA 1SQXD 2WSFH 1KQLA 1N73C 3AE3C 3EWKA 3Q5PA 1OX3A 1RE4A 3VMXA 3W67A 2Y0DA 2B88A 2NRGA 3AEFC 2LXCB 5AW9B 3H1IE 1SQVG 1SFCC 5E79H 4U3FE 3JCUH 5KLVJ 1ZR4A 2E76C 2RKLA 3OAKA 2Z4EA 3GF3A 4C7RA 5CJ0A 4RKUJ 1RE3A 3KPEA 1G2CA 3QWOC 2IYOA 3H1LD 3M0DA 3E1RA 2WSCJ 1YTZT 2ZT9C 3H1LE 3CWBD 2YMYA 4H13D 1S5LH 1KTMA 2AEJA 1KYOE 1YQ4C 3L36A 1SQXJ 4AYCA 3A3YB 3H1IJ 3CX5D 3AE9C 4U3FJ 1WRGA 3RK3C 1N73A 1H88A 1FZGA 2FYNB 1L0LG 4UB8E 3P32A 1SFCA 2GUVA 2W90A 1L2PA 1ZP0C 2I1JA 1R5LA 2A45H 2ZVOB 3T97A 5KLVG 1LT1A 3AE8C 1JOCA 1YI2P 3H1LJ 1FE6A 1ZW0A 1DEEG 5KLIC 1LGHB 2NPSD 3EFGA 4YXDC 5AW4B 3VTPC 1M1JB 1OIPA 1EDLA 1W2EA 1OWAA 1NVOA 1OMIA 1PPJG 2JO1A 5CBNA 2BASA 1JUNA 5GTIE 2N1TC 3L74D 2GM4A 3H1IG 3S1KA 5AVVB 4U3FG 3S4RA 5AVXB 1YQ3C 1NWQA 1LTSC 1Q86Q 2E74D 1EXIA 1H0TA 2FY8A 1GMJA 4JYBA 4K3AA 4I1LA 1KILC 1NTZE 3JCUE 3RGUA 2M3EA 1KYOI 3HE5A 3CCJP 1JM0A 1YHQP 3AEDC 4KT0J 2PP6A 3H1LG 1JY2N 1GL2C 1LT9B 1SQPD 2IBZE 2W8ZA 1SLQA 2WSSH 4NPEA 2Q3EA 4KHXA 4LGDE 3IFMA 4K35A 1OZHA 2AXTH 1S5LE 2WSFJ 2N1TA 3EFFK 4OH8B 2KLVA 1BSHA 4GKGA 1BCCD 2RH0A 1NTZJ 3B5NB 3H1KD 1RF0C 3AEBC 2K9JA 3H1KE 5KJ7A 2JWAA 1KILA 3CXHH 4DCKA 1BGYE 1JY3O 1PZQA 2FYUK 4YXWH 3GHGC 3HTKB 3L75E 4OGQB 2A06E 4TT3H 5CCHC 1GL2A 3FWNA 1FZCC 5AVUB 1FAVA 1G1JA 4GODA 1R5SA 2KP8A 4H44B 2WPSA 1L0NK 2IFMA 2YO2A 1DIPA 1OFCX 3PRJA 3H1KJ 3RK2B 1ZLLA 3RL0C 2ZYDA 1RF0A 1IFNA 5KKZB 3D6ZA 1NTZG 1FS0E 2FYZA 3G6EP 1JEKA 1HH0A 3L75J 1QVGO 2IBZI 1QL1A 4C46A 4WY4B 2WPQA 3II6A 2IPPA 2M5AB 1YBKA 3GHGA 1HTLC 4JPZB 1NU1E 5CCHA 2IBZG 3SWKA 1YITP 1KZUB 1EZVD 1FZCA 3L35A 2QJKB 2HODA 3L72E 1W5CE 5H2FE 2KB7P 4LLHA 1VF5D 3JSVC 4L75A 3Q1MA 1VQMP 2WVRA 3ZDMA 1KN7A 2P58A 1QEXA 1PGPA 1RF1B 1JMMA 3L71D 3H6PA 4EOTA 4IL6X 3WUTA 2V7QH 3H1KG 3M9QA 2R3CA 1G1IA 3VP8A 2FYUE 3SSUA 1EDJA 2RN0A 1NJIQ 1BGYG 1NU1J 3AE2C 2C9NY
chains in the Genus database with same CATH topology
5KLVJ 1SQVJ 3H1LJ 3H1JJ 1BGYJ 1BE3J 1NTZJ 1SQPJ 3CX5I 3BCCJ 3L72J 1BCCJ 3CWBJ 4D6TJ 3L71J 3L75J 2IBZI 1EZVI 3H1KJ 4PD4I 3TGUJ 1L0LJ 3CXHI 1L0NJ 1SQXJ 1KYOI 1NTKJ 1P84I 1PP9J 3L74J 2FYUJ 3L70J 3H1HJ 3H1IJ 2BCCJ 1NTMJ 3L73J 4U3FJ 1NU1J 1SQQJ 1KB9I 1SQBJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KLV J;  1SQV J;  3H1L J;  3H1J J;  1BGY J;  1BE3 J;  1NTZ J;  1SQP J;  3CX5 I;  3BCC J;  3L72 J;  1BCC J;  3CWB J;  4D6T J;  3L71 J;  3L75 J;  2IBZ I;  1EZV I;  3H1K J;  4PD4 I;  3TGU J;  1L0L J;  3CXH I;  1L0N J;  1SQX J;  1KYO I;  1NTK J;  1P84 I;  1PP9 J;  3L74 J;  2FYU J;  3L70 J;  3H1H J;  3H1I J;  2BCC J;  1NTM J;  3L73 J;  4U3F J;  1NU1 J;  1SQQ J;  1KB9 I;  1SQB J; 
#chains in the Genus database with same CATH topology
 1YJW P;  1EDI A;  4PV1 D;  1QL2 A;  1AVY A;  3FWL A;  3L75 G;  1BDC A;  1T3J A;  2A06 G;  1P84 D;  3L72 J;  1VQ7 P;  1PL5 A;  3B5N D;  3CXH E;  1LWU C;  5AW5 B;  1L0N E;  3O8Z A;  4CPG A;  1MV8 A;  1GW4 A;  3RK3 E;  3M91 A;  1VQK P;  3NXS A;  1E5W A;  2KS1 A;  1KD1 Q;  4D6T D;  2KYV A;  2R3S A;  3SFD C;  2KSJ A;  2QA4 P;  5C39 A;  2K1A A;  3VN0 A;  1BE3 D;  2FYU J;  2QE7 H;  1IFM A;  2KNC B;  1LJ2 A;  3OA7 A;  1FZF A;  3GG2 A;  1YTZ I;  1NTM K;  1NKZ B;  2POH A;  4GT1 A;  4RJT A;  1A02 F;  2FFD A;  3KZI H;  5EFW B;  1L0N J;  2O3J A;  1SVF A;  1NU1 G;  1SQV D;  1SQQ E;  5AVT B;  1T2K D;  1J1E C;  1LWU A;  4H0L B;  3L72 G;  5KAI E;  5AW6 B;  1XTG B;  1PP9 D;  1M8O B;  3C8V A;  3HD7 D;  3P8C D;  3V2Q A;  1KQG B;  2HG5 D;  2WMM A;  3EQ2 A;  1FOS E;  1PP9 E;  1LNQ A;  3G4S P;  4WY4 D;  2Y0C A;  3A2A A;  2CPB A;  2C9L Y;  1KIL E;  1ZV8 A;  3MUD C;  2QJY B;  2ITA A;  3BCC E;  3TYY A;  4WB4 A;  1JY2 O;  2MJZ A;  4L76 A;  3HE4 B;  2FYU G;  1CZQ A;  3M0A A;  1L4A C;  1GDT A;  3L70 E;  2M0B A;  4BWN A;  1SQQ J;  4MN4 C;  1ZRT E;  5B5E H;  2QSI A;  1M90 Q;  2OYI B;  3H1J E;  1NTK K;  2NPS B;  1L0L D;  2B87 A;  2FBW C;  1L0N G;  3BAS A;  1CW5 A;  4W7Z A;  4W80 A;  1MFT A;  3CX5 H;  2R44 A;  1GK4 A;  1PP9 J;  2IX7 C;  3E1I A;  1NGM B;  3O6Q B;  5KLV D;  2P67 A;  1AFO A;  1OW6 A;  4Y99 B;  1M7L A;  2QRX A;  1NKN A;  2QG4 A;  2KI7 B;  5AW3 B;  2QJP C;  2YKP A;  3CCS P;  3BCC J;  1IK9 A;  3G9R A;  3M0D C;  1SQB K;  2KOG A;  5AW8 B;  5CMZ A;  3LID A;  2H8P D;  3VP9 A;  4W7Y A;  2I1K A;  2R5D A;  2V7Q J;  3L70 J;  1NTM E;  1PPJ D;  2E74 B;  1IC2 A;  1N7L A;  1M1J C;  3H1J J;  3F5H A;  1HBW A;  1LTA C;  3VYI A;  1L4A A;  1GU4 A;  1K04 A;  1L0L J;  3H1I D;  3CC2 P;  3CCE P;  2V4H A;  3V5B A;  5APS A;  3N7N A;  2D2C D;  4U3F D;  2JKV A;  1SQQ G;  4N78 E;  2FXM A;  5AW1 B;  3Q3D A;  2YIU B;  3TF5 A;  4DZO A;  2ZJS E;  1M56 D;  1PP9 G;  5M1B A;  1URQ D;  4TLF A;  2Z5I A;  1NTM J;  3FXE A;  2WSE H;  3BCC G;  4H0L D;  3P8M C;  1BDD A;  1KYO D;  1KV4 A;  1HF9 A;  2WT7 B;  1VQ9 P;  3UIA A;  1H89 A;  5CHX A;  3L70 G;  1M1J A;  1NTK E;  4UB6 H;  2O01 N;  5BVZ A;  3H1J G;  4I7Z B;  1FC2 C;  3Q5S A;  2WPV B;  1S5L X;  5DJU B;  5APW A;  1CI6 A;  1SQP K;  4GDO A;  2E5Y A;  1AJY A;  4DT0 A;  5K5G B;  3RL0 g;  3H25 A;  3WUV A;  2BEZ F;  2GA1 A;  1SQB E;  2K88 A;  4WVZ A;  2KUB A;  2OQQ A;  1SS1 A;  1Q82 Q;  2O01 J;  2RMZ A;  3M9H A;  3FGA D;  1WT6 A;  2BEQ D;  2PFX A;  1NTM G;  1NTK J;  4HKZ H;  3WU2 E;  3MTU E;  1NH4 A;  4OGQ C;  2KLU A;  1K73 Q;  2IZ0 A;  3S9O A;  4H44 C;  3CCV P;  1IJD B;  3V4Q A;  4PJ0 E;  2OYO A;  1IZN B;  3QH9 A;  4RES B;  2OYH B;  3BAT A;  1Y47 A;  3GF7 A;  5APQ A;  1SQB J;  1NTZ D;  3RK2 C;  5KJ7 C;  3V4W A;  1VDF A;  3TNU B;  3B5N A;  1OW8 A;  2QVA A;  1KB9 H;  1VQO P;  5AVQ B;  5E79 E;  3V2N A;  2ZAE B;  1VF5 B;  2E75 C;  2P7J A;  5AW2 B;  3KQG A;  3BRT B;  5B66 H;  1LTJ B;  2JP3 A;  3MZW B;  1YIJ P;  2BCC E;  2Y9Z A;  2IBZ D;  1GD2 E;  4WY4 C;  2OTL P;  1HGV A;  1FDO A;  3LW5 J;  1GTW A;  4I6M C;  3HTK A;  1NTK G;  2I8D A;  1SP4 A;  4QMA A;  1VQ5 P;  5GTH H;  1KFN A;  2K3R A;  3M9B A;  3D71 A;  4PV1 B;  2JDI H;  2XNX A;  5AVY B;  3CMA P;  2SPZ A;  1N7S D;  1SQB G;  2BCC J;  2Y9Y A;  1BGY D;  2WQY C;  5CCG C;  2LR2 A;  3L75 D;  1S72 P;  2A06 D;  2E5T A;  4IFM A;  3VOP A;  1XTC C;  1R8E A;  4L73 A;  5APX A;  4WY4 A;  5KLI B;  3BRV B;  2M5A A;  1P84 H;  3AE6 C;  4JYC A;  2OTK E;  3A5T A;  5TJH A;  2HPC B;  2XZR A;  2QM7 A;  3A7O A;  3V2P A;  1H8A A;  3N4X A;  3CCL P;  3L73 E;  4HB1 A;  1RF1 A;  3HUS B;  2YO3 A;  1BGY J;  3CC4 P;  4N3Y B;  3HD7 B;  1LTT C;  5CCG A;  2BCC G;  3AEC C;  2M8R A;  5KAF H;  3I55 P;  1NU1 D;  1KB9 E;  1S2E A;  4HH2 A;  1U7M A;  1J1D B;  1FZE A;  1PGO A;  3CME P;  3I5C A;  3L72 D;  4WWI A;  2YXR B;  1SFC D;  2E43 A;  3PJS K;  1NHL A;  2C0W A;  3GLM A;  1GW3 A;  2J5U A;  2E76 D;  4H13 C;  1E79 H;  3H32 B;  4C7N B;  3B4S A;  4Y28 J;  3L73 J;  1AA0 A;  3JC2 2;  3RBZ A;  1EXJ A;  2AXT E;  2OGU A;  2A45 I;  2FYU D;  2KNC A;  2FFD C;  3VMA A;  1FJP A;  2A45 G;  3CXH D;  3A0B H;  3IN6 A;  4XE5 B;  2HR3 A;  1L0N D;  1RQV A;  2VRS A;  3RK3 D;  2YMK A;  2NPS C;  3WUU A;  4JQ0 D;  1FZA A;  1JMB A;  2YKQ A;  3SFE C;  4BRY B;  4Y99 C;  1AVO A;  2YXQ B;  3L73 G;  2D2C B;  4RO0 A;  4GIF A;  4PD4 H;  1KQF B;  1KB9 I;  1T3U A;  1PFI A;  4R4M A;  3SWF A;  1JCD A;  2Q5U A;  2E74 C;  1K8A Q;  2ZYA A;  2JJL A;  2WSC H;  3HE4 A;  1FOS F;  1URQ B;  1SQQ D;  4KJM A;  2N1T D;  1S9K E;  1OW7 A;  2OYI A;  2Y0E A;  2NPS A;  1FJK A;  1PIX A;  3OW2 O;  1MUU A;  2ZYG A;  3HRN A;  1FDI A;  5APU A;  1KC8 Q;  1MFZ A;  1KIL D;  1DH3 A;  2CPS A;  2WWW A;  5TIS H;  1SQX K;  3BCC D;  4YTP C;  4GOE A;  4EDF A;  4Z1M H;  2KXP B;  2J58 A;  3GMA A;  4ZNC A;  1LTI C;  3SWY A;  1GL2 D;  3L70 D;  2HLO A;  3CXH I;  2P2U A;  1ZRT D;  4EYY Q;  3H1J D;  2ZXX A;  1KYO H;  3AEG C;  1X22 A;  1UIX A;  4ZKU A;  1ZME C;  3KYQ A;  4I7Z C;  3PH0 A;  3A0B E;  2IFN A;  2FYN C;  1VL2 A;  3H1H E;  4ZMD A;  1Y8A A;  3A0H H;  1JO5 A;  1X8Y A;  2QEX P;  2K37 A;  3KXD A;  3U1C A;  4LC1 A;  3LIE A;  1NTM D;  1AQT A;  1MKM A;  2AEM A;  5CCH D;  2R32 A;  1JY3 P;  4JF7 A;  1VPC A;  2KK7 A;  2MKV A;  2ZXE B;  4PD4 E;  2WT7 A;  1HGZ A;  2QIW A;  4OWF A;  2DW3 A;  4N78 D;  5GTI H;  3H1H J;  3VMY A;  1U57 A;  3KZI E;  2OYH C;  3RL0 D;  3VMZ A;  3PTZ A;  1DD3 A;  3TGU D;  1PGQ A;  1JTH B;  5DJT B;  3K5B A;  1J1E B;  3TGU E;  1LP1 B;  1SQX E;  1USD A;  1EC5 A;  5L8R J;  4XFJ A;  3AE1 C;  2XU6 A;  1VF5 C;  2H89 C;  2OTJ P;  2KZJ A;  1OVV A;  1LTJ C;  1IFJ A;  1YJN P;  1S3J A;  5TIS E;  1NTK D;  1OXZ A;  1BSN A;  1LT9 C;  1NTZ K;  1N7S B;  3CCR P;  1FBM A;  1IFI A;  4JBZ A;  4EIJ A;  1L4A B;  3PHL A;  1WMK A;  3CWB E;  5B5E E;  3TGU J;  4PV1 C;  3H1H G;  2OYH A;  3CI9 A;  4HYT B;  1YYC A;  1SQB D;  3B5N C;  3KHU A;  3M06 A;  1DX7 A;  3CX5 E;  2N9Y B;  2JR8 A;  2XV5 A;  1GU5 A;  2H7H A;  3NFQ A;  3TNU A;  1ZR2 A;  3A0H E;  1G2C B;  4PD4 I;  1OVR A;  2QJP B;  2H88 C;  3W68 A;  3I56 P;  3P7K A;  1LTJ A;  2HFE D;  1QGK B;  2AEF A;  1FZB A;  2ZVN B;  2N9B A;  1LT9 A;  3Q2Y A;  2PAJ A;  3CWB J;  1IK7 A;  1T8Z A;  2WIT A;  1JNM A;  3MGN A;  4AUW A;  2JEE A;  1UII A;  2QM8 A;  2IYP A;  5APT A;  1N73 B;  2Q7C A;  3KDP B;  1CI6 B;  3TGU G;  1SQX G;  5BU5 A;  1SFC B;  5KKZ C;  1T2K C;  2KIK A;  2ZFC A;  1NAF A;  3HUS C;  2BCC D;  2E76 B;  4HJG H;  3L74 E;  1MZ9 A;  2YNY A;  3T97 B;  3HD7 C;  3PP5 A;  4N6J A;  3MHV A;  1DD4 A;  3D6Y A;  3CPW O;  2IZ1 A;  1U7J A;  4ASW A;  4I2L C;  3TSI A;  1J1D C;  2ZT9 B;  1ZXG A;  2QJK C;  3FX0 A;  4WBA A;  5H2F H;  1CSB A;  3CLQ A;  3L37 A;  3V6I A;  3CWB G;  2FXO A;  4UB6 E;  1SQP E;  2L91 A;  3CX5 I;  1Z56 A;  3D70 A;  3CC7 P;  1S4X A;  4ASV A;  1NU1 K;  2HPC A;  3RK3 B;  5AW7 B;  2O1K A;  1RF1 C;  2C0X A;  3L74 J;  2W83 C;  2WPR A;  2IDB A;  1H0T B;  1EQ7 A;  3C9I A;  3HUS A;  1GZL A;  4YPC A;  3TK1 A;  1L4A D;  1JY2 P;  1DEB A;  1BCC E;  5AW0 B;  3AEE C;  2WSE J;  4M3L A;  3HD7 A;  3U59 A;  2W6B A;  2W6J H;  3HE5 B;  5KTB A;  1KQS O;  3ITK A;  1VQN P;  3CCM P;  3GW6 A;  1RH5 B;  3RBX A;  4DOJ A;  5BU8 B;  1SQP J;  1X0T A;  3ABV C;  3AE7 C;  3G71 P;  3WMM 0;  3IAO A;  1GK6 A;  3L73 D;  5APV A;  1NOH A;  4C7N A;  3H32 A;  2LXB A;  2N1T B;  4OVN F;  1RHZ B;  2D2C C;  1NYH A;  3AEA C;  1Q7Y Q;  1W2B O;  1BCC J;  2KZI A;  2K9J B;  4B86 A;  3NTN A;  3L74 G;  1K9M Q;  3TDK A;  1KB9 D;  2FKW B;  2W27 A;  1Q2N A;  1VQ8 P;  1KIL B;  2PGD A;  2G3A A;  1FDM A;  2G8Y A;  2E75 B;  3IR9 A;  2K9Y A;  1PGJ A;  1URQ C;  1PV3 A;  5B66 E;  1NAY A;  1HUC A;  1GL2 B;  1J2J B;  3OJA B;  4H0L C;  5KAI H;  2NZ2 A;  3USS A;  3AE5 C;  4ZKP A;  3CCQ P;  2OAR A;  1SQP G;  1AV1 A;  1ZOY C;  2LKM A;  5AVZ B;  1VQ4 P;  1RY3 A;  1EZV E;  5GTH E;  4BRY A;  1SQQ K;  4IL6 H;  3U1A A;  1SQV K;  2PRR A;  2Z5H A;  2QJY C;  2ZT9 D;  3R4Y A;  2GUS A;  3MP7 B;  2E42 A;  4NPF X;  1BCC G;  4L74 A;  3C1L A;  3Q5R A;  3L71 E;  2Q3I A;  2XND H;  2O1J A;  5AVS B;  2WZ7 A;  2OYI C;  1URQ A;  3CCU P;  1QLE D;  2Q6Q A;  3GHG B;  1Y9B A;  2XDJ A;  1M57 D;  3PLN A;  1FZC B;  1IFP A;  2B9B A;  3BVH A;  2HOD B;  4A7P A;  1N8R Q;  1QX8 A;  1P84 E;  2Q1K A;  3B71 A;  1RQU A;  3FXD A;  4BXL A;  1S1C X;  2R5B A;  3MD0 A;  5CJ4 A;  2P1J A;  1L0L K;  3F89 A;  1ZN5 A;  2Q9I A;  4U7J A;  4IFD K;  3RL0 B;  5APY A;  2B89 A;  4GOF A;  1X9V A;  1HJ0 A;  1VQ6 P;  1T6A A;  4D6T E;  3CL3 D;  3L71 J;  4OGQ D;  4EI2 A;  3MIW A;  5KLV K;  2UWJ E;  1S9K D;  4IOI H;  4H44 D;  1D7M A;  1N86 A;  1TU3 F;  2XKM A;  1BE3 E;  1LTB C;  4R4L A;  2L5G B;  5KAF E;  2M3B A;  1AQ5 A;  3B8E B;  1EZV I;  2YIU C;  4IFF A;  3RK2 D;  3R2P A;  5KJ7 D;  3V2R A;  2P10 A;  3O6Q A;  2KS1 B;  1USE A;  1SQV E;  1EZV G;  2E75 D;  1OVU A;  4AQR D;  4H13 B;  1M1K Q;  4DJG A;  3E7K A;  4D6T J;  1HJB A;  2FXP A;  1VQL P;  1Q90 D;  2JWD A;  3P8C E;  4NPD A;  2O01 H;  1Q81 Q;  1VQP P;  4IL6 E;  2W6A A;  1BE3 J;  4XA4 A;  1IO4 A;  1X79 B;  1HWT C;  1N7S C;  3L71 G;  2WTY A;  2FFD B;  1QVF O;  3H1H D;  1P84 I;  1JY3 N;  1KOR A;  1K05 A;  1JB0 J;  4UB8 H;  3CD6 P;  2J59 M;  1LWU B;  5CBO A;  1SQV J;  1RE4 C;  1NO4 A;  1HVV A;  1KMI Z;  1JTH A;  1A02 J;  1L0L E;  1IFD A;  5CCG D;  3L4F A;  1LP1 A;  1YJ9 P;  2H43 A;  1RE3 C;  5KLV E;  1FU1 A;  2AXC A;  2KSE A;  1N2D C;  1KFM A;  4PD4 D;  4D6T G;  1JCC A;  3IF4 A;  3WU2 H;  1LTG C;  4O9B A;  5AVW B;  5AVR B;  3MUD A;  2YKO A;  2CK3 H;  3AE4 C;  1N7S A;  1BE3 G;  3G3Z A;  3LW5 H;  1EDK A;  4PJ0 H;  3NMD A;  1PPJ E;  2B87 B;  2HYN A;  1SQX D;  2WSF H;  1KQL A;  1N73 C;  3AE3 C;  3EWK A;  3Q5P A;  1OX3 A;  1RE4 A;  3VMX A;  3W67 A;  2Y0D A;  2B88 A;  2NRG A;  3AEF C;  2LXC B;  5AW9 B;  3H1I E;  1SQV G;  1SFC C;  5E79 H;  4U3F E;  3JCU H;  5KLV J;  1ZR4 A;  2E76 C;  2RKL A;  3OAK A;  2Z4E A;  3GF3 A;  4C7R A;  5CJ0 A;  4RKU J;  1RE3 A;  3KPE A;  1G2C A;  3QWO C;  2IYO A;  3H1L D;  3M0D A;  3E1R A;  2WSC J;  1YTZ T;  2ZT9 C;  3H1L E;  3CWB D;  2YMY A;  4H13 D;  1S5L H;  1KTM A;  2AEJ A;  1KYO E;  1YQ4 C;  3L36 A;  1SQX J;  4AYC A;  3A3Y B;  3H1I J;  3CX5 D;  3AE9 C;  4U3F J;  1WRG A;  3RK3 C;  1N73 A;  1H88 A;  1FZG A;  2FYN B;  1L0L G;  4UB8 E;  3P32 A;  1SFC A;  2GUV A;  2W90 A;  1L2P A;  1ZP0 C;  2I1J A;  1R5L A;  2A45 H;  2ZVO B;  3T97 A;  5KLV G;  1LT1 A;  3AE8 C;  1JOC A;  1YI2 P;  3H1L J;  1FE6 A;  1ZW0 A;  1DEE G;  5KLI C;  1LGH B;  2NPS D;  3EFG A;  4YXD C;  5AW4 B;  3VTP C;  1M1J B;  1OIP A;  1EDL A;  1W2E A;  1OWA A;  1NVO A;  1OMI A;  1PPJ G;  2JO1 A;  5CBN A;  2BAS A;  1JUN A;  5GTI E;  2N1T C;  3L74 D;  2GM4 A;  3H1I G;  3S1K A;  5AVV B;  4U3F G;  3S4R A;  5AVX B;  1YQ3 C;  1NWQ A;  1LTS C;  1Q86 Q;  2E74 D;  1EXI A;  1H0T A;  2FY8 A;  1GMJ A;  4JYB A;  4K3A A;  4I1L A;  1KIL C;  1NTZ E;  3JCU E;  3RGU A;  2M3E A;  1KYO I;  3HE5 A;  3CCJ P;  1JM0 A;  1YHQ P;  3AED C;  4KT0 J;  2PP6 A;  3H1L G;  1JY2 N;  1GL2 C;  1LT9 B;  1SQP D;  2IBZ E;  2W8Z A;  1SLQ A;  2WSS H;  4NPE A;  2Q3E A;  4KHX A;  4LGD E;  3IFM A;  4K35 A;  1OZH A;  2AXT H;  1S5L E;  2WSF J;  2N1T A;  3EFF K;  4OH8 B;  2KLV A;  1BSH A;  4GKG A;  1BCC D;  2RH0 A;  1NTZ J;  3B5N B;  3H1K D;  1RF0 C;  3AEB C;  2K9J A;  3H1K E;  5KJ7 A;  2JWA A;  1KIL A;  3CXH H;  4DCK A;  1BGY E;  1JY3 O;  1PZQ A;  2FYU K;  4YXW H;  3GHG C;  3HTK B;  3L75 E;  4OGQ B;  2A06 E;  4TT3 H;  5CCH C;  1GL2 A;  3FWN A;  1FZC C;  5AVU B;  1FAV A;  1G1J A;  4GOD A;  1R5S A;  2KP8 A;  4H44 B;  2WPS A;  1L0N K;  2IFM A;  2YO2 A;  1DIP A;  1OFC X;  3PRJ A;  3H1K J;  3RK2 B;  1ZLL A;  3RL0 C;  2ZYD A;  1RF0 A;  1IFN A;  5KKZ B;  3D6Z A;  1NTZ G;  1FS0 E;  2FYZ A;  3G6E P;  1JEK A;  1HH0 A;  3L75 J;  1QVG O;  2IBZ I;  1QL1 A;  4C46 A;  4WY4 B;  2WPQ A;  3II6 A;  2IPP A;  2M5A B;  1YBK A;  3GHG A;  1HTL C;  4JPZ B;  1NU1 E;  5CCH A;  2IBZ G;  3SWK A;  1YIT P;  1KZU B;  1EZV D;  1FZC A;  3L35 A;  2QJK B;  2HOD A;  3L72 E;  1W5C E;  5H2F E;  2KB7 P;  4LLH A;  1VF5 D;  3JSV C;  4L75 A;  3Q1M A;  1VQM P;  2WVR A;  3ZDM A;  1KN7 A;  2P58 A;  1QEX A;  1PGP A;  1RF1 B;  1JMM A;  3L71 D;  3H6P A;  4EOT A;  4IL6 X;  3WUT A;  2V7Q H;  3H1K G;  3M9Q A;  2R3C A;  1G1I A;  3VP8 A;  2FYU E;  3SSU A;  1EDJ A;  2RN0 A;  1NJI Q;  1BGY G;  1NU1 J;  3AE2 C;  2C9N Y; 
#chains in the Genus database with same CATH homology
 5KLV J;  1SQV J;  3H1L J;  3H1J J;  1BGY J;  1BE3 J;  1NTZ J;  1SQP J;  3CX5 I;  3BCC J;  3L72 J;  1BCC J;  3CWB J;  4D6T J;  3L71 J;  3L75 J;  2IBZ I;  1EZV I;  3H1K J;  4PD4 I;  3TGU J;  1L0L J;  3CXH I;  1L0N J;  1SQX J;  1KYO I;  1NTK J;  1P84 I;  1PP9 J;  3L74 J;  2FYU J;  3L70 J;  3H1H J;  3H1I J;  2BCC J;  1NTM J;  3L73 J;  4U3F J;  1NU1 J;  1SQQ J;  1KB9 I;  1SQB J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...