1SQXJ

Crystal structure analysis of bovine bc1 with stigmatellin a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
60
structure length
60
Chain Sequence
APTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 22
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1sqxJ00
3H1HJ 1EZVI 3L70J 1SQVJ 3L75J 1NTZJ 1SQQJ 1L0NJ 1BGYJ 1SQXJ 1BE3J 2IBZI 3H1LJ 3L74J 5KLVJ 3CX5I 1KB9I 1NU1J 1P84I 3H1IJ 4PD4I 4U3FJ 1KYOI 2BCCJ 4D6TJ 1SQPJ 3CXHI 3H1KJ 3L72J 1SQBJ 1NTKJ 3TGUJ 1BCCJ 3BCCJ 3L73J 1NTMJ 3CWBJ 1L0LJ 2FYUJ 3H1JJ 3L71J 1PP9J
chains in the Genus database with same CATH superfamily
2I8DA 3H1HJ 3L75E 4L73A 1HTLC 1L0NJ 3L74E 4GOEA 4DOJA 3P32A 1AQTA 1PL5A 2O01N 1D7MA 1RF0C 1HGZA 3S1KA 3CCMP 3L70E 3WUVA 1NTZJ 1DH3A 2GA1A 3RGUA 1BE3J 2WSFH 2XU6A 1U7MA 1KB9I 3H1IJ 1E5WA 5CCHD 5B5EE 1ZP0C 4H44C 2W83C 3OJAB 3L71D 1KILD 3O6QB 3H1LG 3CX5E 1VQLP 4ASVA 3AE1C 1NTKE 3RBZA 2W6BA 1J1EC 1YHQP 1JCDA 1OMIA 1M1JC 3S9OA 1YBKA 4EDFA 3AEFC 1OVVA 2XZRA 2CK3H 2KYVA 3M06A 2QM8A 3PHLA 1L4AA 2K88A 2KK7A 2ZYGA 4H13D 4OWFA 3MUDA 5H2FE 1N73B 5BU8B 3V2RA 2A45I 4EYYQ 1KYOH 3H1LE 1ZW0A 2N9BA 4WY4A 3HE4A 3CCEP 5AVUB 1SFCC 4LLHA 3W68A 2LKMA 3CCVP 3MIWA 2QJYB 3SFDC 2Z5IA 1JEKA 2KS1A 4N6JA 1SS1A 2GM4A 2AXTE 2N1TD 4IOIH 1FZBA 3AECC 1KQFB 5EFWB 4RO0A 2FYNC 2BASA 3HD7A 3CMEP 3RK2B 3A3YB 2OYIA 1SQQD 2NRGA 3RL0C 2Q9IA 3BASA 3V5BA 4JYBA 3RK3D 3L72J 2FYUG 5APUA 3V4QA 2OYHB 1BCCD 3L73J 2IBZG 1A02J 1IC2A 2P58A 3R4YA 2QEXP 1SQVJ 2P1JA 3M9QA 4GKGA 1IFPA 2B87A 5GTIE 4I2LC 1KQGB 2OQQA 4Z1MH 1PV3A 5KAIE 3VMXA 1H88A 2M5AB 2E74B 1JO5A 1NTMD 3Q5PA 2YMYA 1GL2D 2JWAA 2WPQA 4JPZB 2WQYC 1BGYG 2NPSB 5GTHE 1S9KD 2WT7B 2POHA 5APTA 5KLVK 2C0XA 1RQVA 1FJPA 4U3FD 3HRNA 1ZV8A 1TU3F 1SQPD 2E5TA 4RESB 3IAOA 2YO2A 2KP8A 1FE6A 2FYUE 3BCCJ 3H1HG 2RH0A 1FOSE 2IBZE 1L0NG 3L70J 1R5LA 1S5LX 4H44D 5APWA 2KSEA 4GOFA 1ZOYC 4JQ0D 4Y99B 3U1CA 5KJ7D 5APSA 2HODB 2Q7CA 4C46A 1QVFO 1K04A 3FGAD 2Q1KA 3M0DA 1BE3G 1K8AQ 1FJKA 1BGYE 2WSCH 1DEEG 1Q2NA 2NZ2A 3FWNA 1GW3A 1M56D 3TGUD 5CHXA 3N7NA 2Y0EA 1RQUA 1ZRTE 4Y28J 2P10A 3H1HE 2E42A 3PH0A 1L0NE 2B9BA 4RJTA 1N73A 1BDCA 1LT9B 1FZFA 4XA4A 1R5SA 1SLQA 3P7KA 3LIEA 3CCQP 3IR9A 3EFFK 1L0LD 1ZLLA 3H1JD 5CJ4A 2R32A 1LTSC 1PP9J 4CPGA 3H25A 1P84H 1NTZE 1PGJA 1BE3E 1SFCD 3CXHH 5AVQB 2R3CA 3WUTA 2QJKC 1EDJA 4HJGH 3PRJA 4I1LA 3CWBG 5DJTB 3D70A 2FXMA 2BEZF 2L91A 4XFJA 1SQXG 3WU2H 3CC2P 2XNXA 2Y9ZA 2V7QJ 4D6TJ 4HKZH 3VYIA 2I1JA 5CBNA 1NOHA 3VP8A 4HH2A 2WTYA 2OTJP 1J1DB 3UIAA 1URQC 1KYOD 2BCCG 4DT0A 2IBZI 3OA7A 3P8CE 1YJ9P 1S3JA 1IFMA 3CWBE 2KI7B 2IYPA 2ZVOB 1L4AB 3L75D 3FX0A 1W5CE 2KLUA 1FZCA 1KTMA 4JBZA 3BATA 5AW2B 3L35A 3WUUA 1X8YA 2E75B 3E1IA 3B5NA 3Q1MA 2FFDA 1HJBA 1LTJC 1IK7A 4NPFX 2VRSA 5APXA 2P2UA 3L71J 2Z4EA 1H89A 5AVVB 4C7NA 4PD4E 4BWNA 3KXDA 2JP3A 4WY4B 3HE4B 4I6MC 2BCCE 5CCHA 4K35A 2IPPA 3AEBC 3O8ZA 2KS1B 4JYCA 1K05A 1EZVD 1KILA 3CC4P 5M1BA 2M0BA 3CX5D 2O01J 3IN6A 3A2AA 1ZR2A 2K37A 1Q81Q 2GUSA 2IFMA 2OTLP 3W67A 1NTKD 1S2EA 1NTMK 1IFIA 2KNCA 2R5DA 2R3SA 2FYUJ 4YXWH 5CJ0A 2HFED 3N4XA 1JY3N 2SPZA 3ZDMA 5KAFH 3HD7B 2KSJA 1SQPK 4YXDC 2YKQA 3L72E 3AE9C 1Q90D 2OYIB 2QJPC 3L73E 4IFMA 3I5CA 2WSSH 2E76C 1Y9BA 3JC22 1S5LH 2K9JB 3NTNA 1VQPP 4GDOA 1AVYA 1RF1A 4IL6E 2B87B 2WPSA 1X79B 4R4MA 3G71P 3HE5A 1AV1A 1LWUC 3GHGA 1GL2C 1K9MQ 2N1TA 4IFFA 1CI6A 4PJ0E 3BCCE 3A0HH 2C9LY 1FOSF 4L75A 5KKZC 4M3LA 1KB9H 1LT1A 2G8YA 1KQSO 2W8ZA 3H1KG 1NO4A 1LNQA 4GT1A 4HB1A 4PD4I 2AEJA 4EOTA 1FDIA 2P67A 5TISE 4H0LB 1L0LK 1PP9G 1Z56A 3LIDA 3L36A 3I55P 5KJ7C 1IFNA 1EXIA 4N78D 1RE4C 3SWYA 1S4XA 2V4HA 3CCRP 2J59M 1M57D 2I1KA 1URQD 4OGQB 1X0TA 1DIPA 5AVZB 1GTWA 5KLVG 1ZMEC 2JO1A 1P84D 4RKUJ 1FS0E 4BRYA 2QRXA 4D6TG 1WRGA 1JY2N 3CXHD 3HUSA 3JCUE 1OFCX 1IJDB 3H1KE 1HUCA 1IFJA 2FXPA 3FXEA 1PGPA 1SQBD 3AE3C 4PV1C 3PTZA 1RE3C 1YQ3C 2PGDA 3CWBJ 5BVZA 1PP9E 1RF0A 1SQXJ 1AVOA 4TLFA 2K9YA 3Q5RA 1Q86Q 1OX3A 2IZ0A 3D6ZA 2K3RA 1X9VA 5B66H 2D2CB 1K73Q 2ZAEB 4EI2A 1HH0A 1G1JA 4A7PA 1JY3P 1FDOA 5KLVE 3JSVC 1N7SC 4D6TE 1VQOP 5KLIC 2BCCJ 2YIUB 4YTPC 4U7JA 1AQ5A 3L71G 4I7ZB 3TGUJ 1QEXA 2J58A 3MTUE 2ZT9B 1FU1A 1VF5B 1LTTC 2JJLA 4QMAA 3M9HA 4JF7A 3VMYA 2WSFJ 1NU1D 2CPSA 1M1JA 5B5EH 5KTBA 1J2JB 2ZFCA 1FZGA 3A0BE 1L0LJ 1ZRTD 1JTHA 1ZXGA 1VQ7P 3CX5H 5CCGC 1AA0A 2PP6A 1EC5A 2JWDA 3CCUP 3LW5H 2WWWA 1M8OB 3MZWB 4UB6E 3AE2C 2E76D 1NTKK 3TYYA 2K9JA 4DCKA 2OTKE 1FZCB 3L71E 1DX7A 1KILE 1SVFA 1EZVI 3CC7P 1NTZD 1QL1A 3B5NB 2AXCA 1NAYA 1JB0J 1SFCA 2FFDB 3CD6P 3H1ID 4GIFA 3KHUA 2WITA 4C7NB 4TT3H 3P8MC 3U1AA 5H2FH 3VTPC 4B86A 1PZQA 1EDIA 2MJZA 3BRTB 1G1IA 1KILB 1NYHA 1PGQA 1PPJD 3PLNA 1N73C 3AEDC 1KD1Q 3OW2O 1PIXA 3H32A 2W6JH 1JMMA 5AW9B 3C8VA 2KNCB 1JY2P 2AXTH 3G3ZA 1G2CA 2N9YB 1S72P 1EXJA 3H6PA 1A02F 3GW6A 1SQQG 5AVXB 2XKMA 1AJYA 2QJYC 4NPEA 4GODA 4H13B 1GK4A 2IDBA 3V2NA 3G9RA 1BCCG 1FDMA 3AE6C 2JEEA 2PFXA 5AW8B 1N86A 2IFNA 1BSHA 1DD3A 1KN7A 1KB9D 2ZVNB 4PV1D 3EWKA 4ZMDA 1RF1B 5AW3B 3MGNA 1NTMG 3H1KJ 2P7JA 3HE5B 3NMDA 2R44A 4IFDK 4LGDE 1YTZT 4WB4A 3RK2C 3GHGB 2JDIH 4U3FG 3U59A 1NHLA 2N1TB 1CI6B 5GTIH 3SWFA 1SQPG 2O1KA 1PFIA 2YKOA 3RK3E 1VQ6P 1SQBK 5KAIH 2OYHC 2MKVA 3E7KA 4AUWA 1N7SD 1E79H 5APQA 3Q5SA 1KMIZ 2H88C 2YNYA 5GTHH 2QA4P 1DD4A 3KZIE 5KLVJ 2O3JA 3A7OA 2IX7C 3L72D 3KDPB 2KZIA 2HPCA 2E74C 1GW4A 5AVSB 1NTME 3L73D 3D71A 3A5TA 3GLMA 1S9KE 1QLED 2NPSC 2WSEH 3RK3B 1SQVD 2H43A 1JY2O 2R5BA 4U3FE 3BVHA 1M90Q 2C9NY 1YI2P 1T8ZA 1SQPE 3TGUG 2YMKA 5CCGD 4IL6X 1UIIA 2ZYDA 4BRYB 4L76A 3B4SA 1RHZB 1LGHB 1KFMA 3HUSB 1OVRA 1VQ4P 2A06D 1T6AA 2WSCJ 1SQXE 1NU1K 4Y99C 4K3AA 3L74D 1R8EA 2PAJA 2HR3A 1NGMB 1Q7YQ 1L0LG 3H1JG 3BCCD 5APVA 2O1JA 1CW5A 2WZ7A 4UB8E 2HG5D 1USDA 5E79E 1LJ2A 2KLVA 3VMZA 1MV8A 1N7LA 4ASWA 3L70D 1SQQK 2GUVA 1H8AA 2H7HA 1GU4A 4EIJA 2Y9YA 1S1CX 2OYOA 4W7ZA 3TGUE 5BU5A 4H44B 2Q3IA 2CPBA 1HJ0A 2YO3A 1YYCA 4C7RA 4HYTB 2QVAA 2FY8A 1NH4A 3TF5A 1LT9C 2AEMA 1USEA 3Q2YA 1URQA 3VMAA 4XE5B 1LP1A 2M3BA 1SQBJ 1J1EB 1L0LE 3H1JE 1KQLA 1M1JB 3AEEC 1RY3A 2WMMA 1RH5B 1JTHB 3GF7A 1T3UA 2LR2A 3M9BA 1IO4A 2A06G 3SSUA 3L75G 4KJMA 1GMJA 3AE8C 2Y0CA 1LTJA 1YITP 3H1LD 1BDDA 1MZ9A 2AEFA 2H89C 1GK6A 2IZ1A 1YQ4C 1JOCA 1SFCB 2C0WA 3M0AA 4ZNCA 1J1DC 3ABVC 1IZNB 3G6EP 1ZN5A 1KYOE 1KC8Q 3EFGA 1GZLA 1NKNA 2RMZA 1NU1J 3G4SP 3RK2D 4ZKPA 3AE4C 4W7YA 1EZVG 3GG2A 3KPEA 1WT6A 3KYQA 1L4AC 2YXQB 4PD4H 1SQQJ 1NJIQ 3MUDC 1NTKG 2FYNB 4WWIA 2E75C 1LTIC 3B5ND 3H32B 2LXCB 1BCCJ 2IYOA 1KZUB 2E5YA 3CMAP 2RKLA 2E74D 1G2CB 2J5UA 3M91A 3RL0B 4WY4C 3FWLA 3V2QA 1JUNA 2XDJA 2NPSD 1JNMA 1QGKB 1YJWP 1NTMJ 1EZVE 1SP4A 3C9IA 4LC1A 4DJGA 3CL3D 1EQ7A 2ITAA 2LXBA 4U3FJ 1YTZI 1AFOA 3USSA 5AW4B 1SQPJ 1U57A 1LWUA 3TSIA 1MUUA 2A45H 3IF4A 1GL2A 1SQVK 2G3AA 3MHVA 3HD7C 3HTKA 4AYCA 1CSBA 4W80A 1EDKA 1OVUA 2YXRB 2Q6QA 3AE5C 2WPVB 3AEGC 2OYIC 4IL6H 2FYUD 4MN4C 3CI9A 1GU5A 1H0TA 2WPRA 2YKPA 2IBZD 2RN0A 3L4FA 1XTGB 2K1AA 5KJ7A 1KYOI 3C1LA 3T97A 1RE4A 4PJ0H 1LTGC 4O9BA 1JMBA 3V6IA 1BGYD 2HPCB 3ITKA 3SFEC 1M1KQ 2OGUA 5AVRB 5TISH 3II6A 3H1JJ 1FC2C 3H1HD 3S4RA 2HYNA 1RE3A 1L0ND 2Z5HA 1SQBG 1OW6A 2KOGA 2Q3EA 3PP5A 1VQNP 5CMZA 3CLQA 4H0LC 3V4WA 1N2DC 4AQRD 3NFQA 3BRVB 1VQ8P 4N78E 1MFTA 2XNDH 1BE3D 3CX5I 2KB7P 1OWAA 2ZXEB 3RBXA 2QJKB 3JCUH 1UIXA 3IFMA 3M0DC 1KFNA 4OGQC 1XTCC 1N7SA 3KQGA 2KUBA 4N3YB 1P84E 3CXHE 5C39A 3TDKA 2ZJSE 1FZEA 1QL2A 2L5GB 1L4AD 4WVZA 1SQBE 1QVGO 2E43A 4KHXA 2E75D 1JY3O 3NXSA 3FXDA 2QIWA 1URQB 3WU2E 3L75J 1LP1B 3QWOC 1NU1G 1T3JA 1T2KC 1GDTA 3L74J 3Q3DA 3CCJP 4OH8B 3K5BA 2V7QH 3P8CD 5CCGA 4WY4D 5AW1B 3CWBD 2D2CC 1VL2A 1HWTC 2QE7H 1SQXD 3R2PA 5AW0B 1NKZB 3O6QA 2YIUC 3EQ2A 4I7ZC 1LTJB 1LTBC 3A0BH 1NTZG 1Y47A 1VQKP 2HLOA 2ZT9C 1JCCA 1IFDA 1VF5C 2XV5A 2QM7A 3H1IG 3AEAC 4PD4D 3CPWO 3OAKA 2ZYAA 1NU1E 4ZKUA 1FAVA 3LW5J 1X22A 2B89A 2BCCD 3PJSK 5AW5B 1PGOA 4UB6H 3GF3A 1NTKJ 2KIKA 3HD7D 3GMAA 3TK1A 1QX8A 2OARA 2FKWB 1SQQE 5DJUB 1NAFA 1OIPA 3TNUB 1PPJG 2Q5UA 2DW3A 1BCCE 2FXOA 1FZCC 3WMM0 1NWQA 3MP7B 3VOPA 1KORA 3B5NC 2O01H 3V2PA 3F5HA 2FFDC 3H1IE 2KZJA 3H1LJ 4YPCA 1P84I 1OZHA 3CXHI 1U7JA 2FYUK 2QJPB 2FBWC 5L8RJ 1YJNP 2JR8A 1N8RQ 5TJHA 5CBOA 4NPDA 5CCHC 2E76B 5KAFE 3RL0g 2B88A 2FYZA 5AVWB 1KILC 3CCLP 1PPJE 3F89A 4KT0J 5K5GB 2WVRA 4R4LA 1EDLA 1Y8AA 1W2EA 2H8PD 4H0LD 1LWUB 1S5LE 4DZOA 1VQ5P 1HF9A 1GL2B 1OW7A 3RL0D 2W27A 3HTKB 1VQMP 1VQ9P 2QG4A 5KKZB 2OYHA 4H13C 1L0NK 4OGQD 1CZQA 1H0TB 3A0HE 1KV4A 3I56P 5AW6B 3D6YA 1L2PA 4OVNF 2W90A 2QSIA 1KB9E 2M5AA 3AE7C 1NTZK 3T97B 3CCSP 1W2BO 1YIJP 1IK9A 1RF1C 3L72G 2NPSA 4WBAA 1GD2E 1JM0A 2A45G 3L73G 2WT7A 3QH9A 3MD0A 1T2KD 1VDFA 1SQVG 1HBWA 2W6AA 3GHGC 4L74A 1MFZA 3B8EB 2ZXXA 1OW8A 2N1TC 3KZIH 2D2CD 5AVTB 5APYA 3H1KD 1HGVA 2Y0DA 1Q82Q 1BSNA 4PV1B 2UWJE 2HODA 1DEBA 1ZR4A 1PP9D 2WSEJ 3L74G 1FBMA 2KXPB 1WMKA 1LTAC 3VN0A 2BEQD 2ZT9D 2M3EA 3BCCG 1VF5D 2JKVA 1NVOA 3L70G 3VP9A 3B71A 1SQVE 3RK3C 5AW7B 1SQXK 1VPCA 3E1RA 2PRRA 1BGYJ 5KLVD 3L37A 1N7SB 5KLIB 4D6TD 5B66E 1MKMA 3SWKA 1FZAA 1LT9A 2M8RA 5AVYB 1HVVA 3TNUA 4UB8H 5E79H 1M7LA 4BXLA 1OXZA 3HUSC 2A06E
chains in the Genus database with same CATH topology
3H1HJ 1EZVI 3L70J 1SQVJ 3L75J 1NTZJ 1SQQJ 1L0NJ 1BGYJ 1SQXJ 1BE3J 2IBZI 3H1LJ 3L74J 5KLVJ 3CX5I 1KB9I 1NU1J 1P84I 3H1IJ 4PD4I 4U3FJ 1KYOI 2BCCJ 4D6TJ 1SQPJ 3CXHI 3H1KJ 3L72J 1SQBJ 1NTKJ 3TGUJ 1BCCJ 3BCCJ 3L73J 1NTMJ 3CWBJ 1L0LJ 2FYUJ 3H1JJ 3L71J 1PP9J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1H J;  1EZV I;  3L70 J;  1SQV J;  3L75 J;  1NTZ J;  1SQQ J;  1L0N J;  1BGY J;  1SQX J;  1BE3 J;  2IBZ I;  3H1L J;  3L74 J;  5KLV J;  3CX5 I;  1KB9 I;  1NU1 J;  1P84 I;  3H1I J;  4PD4 I;  4U3F J;  1KYO I;  2BCC J;  4D6T J;  1SQP J;  3CXH I;  3H1K J;  3L72 J;  1SQB J;  1NTK J;  3TGU J;  1BCC J;  3BCC J;  3L73 J;  1NTM J;  3CWB J;  1L0L J;  2FYU J;  3H1J J;  3L71 J;  1PP9 J; 
#chains in the Genus database with same CATH topology
 2I8D A;  3H1H J;  3L75 E;  4L73 A;  1HTL C;  1L0N J;  3L74 E;  4GOE A;  4DOJ A;  3P32 A;  1AQT A;  1PL5 A;  2O01 N;  1D7M A;  1RF0 C;  1HGZ A;  3S1K A;  3CCM P;  3L70 E;  3WUV A;  1NTZ J;  1DH3 A;  2GA1 A;  3RGU A;  1BE3 J;  2WSF H;  2XU6 A;  1U7M A;  1KB9 I;  3H1I J;  1E5W A;  5CCH D;  5B5E E;  1ZP0 C;  4H44 C;  2W83 C;  3OJA B;  3L71 D;  1KIL D;  3O6Q B;  3H1L G;  3CX5 E;  1VQL P;  4ASV A;  3AE1 C;  1NTK E;  3RBZ A;  2W6B A;  1J1E C;  1YHQ P;  1JCD A;  1OMI A;  1M1J C;  3S9O A;  1YBK A;  4EDF A;  3AEF C;  1OVV A;  2XZR A;  2CK3 H;  2KYV A;  3M06 A;  2QM8 A;  3PHL A;  1L4A A;  2K88 A;  2KK7 A;  2ZYG A;  4H13 D;  4OWF A;  3MUD A;  5H2F E;  1N73 B;  5BU8 B;  3V2R A;  2A45 I;  4EYY Q;  1KYO H;  3H1L E;  1ZW0 A;  2N9B A;  4WY4 A;  3HE4 A;  3CCE P;  5AVU B;  1SFC C;  4LLH A;  3W68 A;  2LKM A;  3CCV P;  3MIW A;  2QJY B;  3SFD C;  2Z5I A;  1JEK A;  2KS1 A;  4N6J A;  1SS1 A;  2GM4 A;  2AXT E;  2N1T D;  4IOI H;  1FZB A;  3AEC C;  1KQF B;  5EFW B;  4RO0 A;  2FYN C;  2BAS A;  3HD7 A;  3CME P;  3RK2 B;  3A3Y B;  2OYI A;  1SQQ D;  2NRG A;  3RL0 C;  2Q9I A;  3BAS A;  3V5B A;  4JYB A;  3RK3 D;  3L72 J;  2FYU G;  5APU A;  3V4Q A;  2OYH B;  1BCC D;  3L73 J;  2IBZ G;  1A02 J;  1IC2 A;  2P58 A;  3R4Y A;  2QEX P;  1SQV J;  2P1J A;  3M9Q A;  4GKG A;  1IFP A;  2B87 A;  5GTI E;  4I2L C;  1KQG B;  2OQQ A;  4Z1M H;  1PV3 A;  5KAI E;  3VMX A;  1H88 A;  2M5A B;  2E74 B;  1JO5 A;  1NTM D;  3Q5P A;  2YMY A;  1GL2 D;  2JWA A;  2WPQ A;  4JPZ B;  2WQY C;  1BGY G;  2NPS B;  5GTH E;  1S9K D;  2WT7 B;  2POH A;  5APT A;  5KLV K;  2C0X A;  1RQV A;  1FJP A;  4U3F D;  3HRN A;  1ZV8 A;  1TU3 F;  1SQP D;  2E5T A;  4RES B;  3IAO A;  2YO2 A;  2KP8 A;  1FE6 A;  2FYU E;  3BCC J;  3H1H G;  2RH0 A;  1FOS E;  2IBZ E;  1L0N G;  3L70 J;  1R5L A;  1S5L X;  4H44 D;  5APW A;  2KSE A;  4GOF A;  1ZOY C;  4JQ0 D;  4Y99 B;  3U1C A;  5KJ7 D;  5APS A;  2HOD B;  2Q7C A;  4C46 A;  1QVF O;  1K04 A;  3FGA D;  2Q1K A;  3M0D A;  1BE3 G;  1K8A Q;  1FJK A;  1BGY E;  2WSC H;  1DEE G;  1Q2N A;  2NZ2 A;  3FWN A;  1GW3 A;  1M56 D;  3TGU D;  5CHX A;  3N7N A;  2Y0E A;  1RQU A;  1ZRT E;  4Y28 J;  2P10 A;  3H1H E;  2E42 A;  3PH0 A;  1L0N E;  2B9B A;  4RJT A;  1N73 A;  1BDC A;  1LT9 B;  1FZF A;  4XA4 A;  1R5S A;  1SLQ A;  3P7K A;  3LIE A;  3CCQ P;  3IR9 A;  3EFF K;  1L0L D;  1ZLL A;  3H1J D;  5CJ4 A;  2R32 A;  1LTS C;  1PP9 J;  4CPG A;  3H25 A;  1P84 H;  1NTZ E;  1PGJ A;  1BE3 E;  1SFC D;  3CXH H;  5AVQ B;  2R3C A;  3WUT A;  2QJK C;  1EDJ A;  4HJG H;  3PRJ A;  4I1L A;  3CWB G;  5DJT B;  3D70 A;  2FXM A;  2BEZ F;  2L91 A;  4XFJ A;  1SQX G;  3WU2 H;  3CC2 P;  2XNX A;  2Y9Z A;  2V7Q J;  4D6T J;  4HKZ H;  3VYI A;  2I1J A;  5CBN A;  1NOH A;  3VP8 A;  4HH2 A;  2WTY A;  2OTJ P;  1J1D B;  3UIA A;  1URQ C;  1KYO D;  2BCC G;  4DT0 A;  2IBZ I;  3OA7 A;  3P8C E;  1YJ9 P;  1S3J A;  1IFM A;  3CWB E;  2KI7 B;  2IYP A;  2ZVO B;  1L4A B;  3L75 D;  3FX0 A;  1W5C E;  2KLU A;  1FZC A;  1KTM A;  4JBZ A;  3BAT A;  5AW2 B;  3L35 A;  3WUU A;  1X8Y A;  2E75 B;  3E1I A;  3B5N A;  3Q1M A;  2FFD A;  1HJB A;  1LTJ C;  1IK7 A;  4NPF X;  2VRS A;  5APX A;  2P2U A;  3L71 J;  2Z4E A;  1H89 A;  5AVV B;  4C7N A;  4PD4 E;  4BWN A;  3KXD A;  2JP3 A;  4WY4 B;  3HE4 B;  4I6M C;  2BCC E;  5CCH A;  4K35 A;  2IPP A;  3AEB C;  3O8Z A;  2KS1 B;  4JYC A;  1K05 A;  1EZV D;  1KIL A;  3CC4 P;  5M1B A;  2M0B A;  3CX5 D;  2O01 J;  3IN6 A;  3A2A A;  1ZR2 A;  2K37 A;  1Q81 Q;  2GUS A;  2IFM A;  2OTL P;  3W67 A;  1NTK D;  1S2E A;  1NTM K;  1IFI A;  2KNC A;  2R5D A;  2R3S A;  2FYU J;  4YXW H;  5CJ0 A;  2HFE D;  3N4X A;  1JY3 N;  2SPZ A;  3ZDM A;  5KAF H;  3HD7 B;  2KSJ A;  1SQP K;  4YXD C;  2YKQ A;  3L72 E;  3AE9 C;  1Q90 D;  2OYI B;  2QJP C;  3L73 E;  4IFM A;  3I5C A;  2WSS H;  2E76 C;  1Y9B A;  3JC2 2;  1S5L H;  2K9J B;  3NTN A;  1VQP P;  4GDO A;  1AVY A;  1RF1 A;  4IL6 E;  2B87 B;  2WPS A;  1X79 B;  4R4M A;  3G71 P;  3HE5 A;  1AV1 A;  1LWU C;  3GHG A;  1GL2 C;  1K9M Q;  2N1T A;  4IFF A;  1CI6 A;  4PJ0 E;  3BCC E;  3A0H H;  2C9L Y;  1FOS F;  4L75 A;  5KKZ C;  4M3L A;  1KB9 H;  1LT1 A;  2G8Y A;  1KQS O;  2W8Z A;  3H1K G;  1NO4 A;  1LNQ A;  4GT1 A;  4HB1 A;  4PD4 I;  2AEJ A;  4EOT A;  1FDI A;  2P67 A;  5TIS E;  4H0L B;  1L0L K;  1PP9 G;  1Z56 A;  3LID A;  3L36 A;  3I55 P;  5KJ7 C;  1IFN A;  1EXI A;  4N78 D;  1RE4 C;  3SWY A;  1S4X A;  2V4H A;  3CCR P;  2J59 M;  1M57 D;  2I1K A;  1URQ D;  4OGQ B;  1X0T A;  1DIP A;  5AVZ B;  1GTW A;  5KLV G;  1ZME C;  2JO1 A;  1P84 D;  4RKU J;  1FS0 E;  4BRY A;  2QRX A;  4D6T G;  1WRG A;  1JY2 N;  3CXH D;  3HUS A;  3JCU E;  1OFC X;  1IJD B;  3H1K E;  1HUC A;  1IFJ A;  2FXP A;  3FXE A;  1PGP A;  1SQB D;  3AE3 C;  4PV1 C;  3PTZ A;  1RE3 C;  1YQ3 C;  2PGD A;  3CWB J;  5BVZ A;  1PP9 E;  1RF0 A;  1SQX J;  1AVO A;  4TLF A;  2K9Y A;  3Q5R A;  1Q86 Q;  1OX3 A;  2IZ0 A;  3D6Z A;  2K3R A;  1X9V A;  5B66 H;  2D2C B;  1K73 Q;  2ZAE B;  4EI2 A;  1HH0 A;  1G1J A;  4A7P A;  1JY3 P;  1FDO A;  5KLV E;  3JSV C;  1N7S C;  4D6T E;  1VQO P;  5KLI C;  2BCC J;  2YIU B;  4YTP C;  4U7J A;  1AQ5 A;  3L71 G;  4I7Z B;  3TGU J;  1QEX A;  2J58 A;  3MTU E;  2ZT9 B;  1FU1 A;  1VF5 B;  1LTT C;  2JJL A;  4QMA A;  3M9H A;  4JF7 A;  3VMY A;  2WSF J;  1NU1 D;  2CPS A;  1M1J A;  5B5E H;  5KTB A;  1J2J B;  2ZFC A;  1FZG A;  3A0B E;  1L0L J;  1ZRT D;  1JTH A;  1ZXG A;  1VQ7 P;  3CX5 H;  5CCG C;  1AA0 A;  2PP6 A;  1EC5 A;  2JWD A;  3CCU P;  3LW5 H;  2WWW A;  1M8O B;  3MZW B;  4UB6 E;  3AE2 C;  2E76 D;  1NTK K;  3TYY A;  2K9J A;  4DCK A;  2OTK E;  1FZC B;  3L71 E;  1DX7 A;  1KIL E;  1SVF A;  1EZV I;  3CC7 P;  1NTZ D;  1QL1 A;  3B5N B;  2AXC A;  1NAY A;  1JB0 J;  1SFC A;  2FFD B;  3CD6 P;  3H1I D;  4GIF A;  3KHU A;  2WIT A;  4C7N B;  4TT3 H;  3P8M C;  3U1A A;  5H2F H;  3VTP C;  4B86 A;  1PZQ A;  1EDI A;  2MJZ A;  3BRT B;  1G1I A;  1KIL B;  1NYH A;  1PGQ A;  1PPJ D;  3PLN A;  1N73 C;  3AED C;  1KD1 Q;  3OW2 O;  1PIX A;  3H32 A;  2W6J H;  1JMM A;  5AW9 B;  3C8V A;  2KNC B;  1JY2 P;  2AXT H;  3G3Z A;  1G2C A;  2N9Y B;  1S72 P;  1EXJ A;  3H6P A;  1A02 F;  3GW6 A;  1SQQ G;  5AVX B;  2XKM A;  1AJY A;  2QJY C;  4NPE A;  4GOD A;  4H13 B;  1GK4 A;  2IDB A;  3V2N A;  3G9R A;  1BCC G;  1FDM A;  3AE6 C;  2JEE A;  2PFX A;  5AW8 B;  1N86 A;  2IFN A;  1BSH A;  1DD3 A;  1KN7 A;  1KB9 D;  2ZVN B;  4PV1 D;  3EWK A;  4ZMD A;  1RF1 B;  5AW3 B;  3MGN A;  1NTM G;  3H1K J;  2P7J A;  3HE5 B;  3NMD A;  2R44 A;  4IFD K;  4LGD E;  1YTZ T;  4WB4 A;  3RK2 C;  3GHG B;  2JDI H;  4U3F G;  3U59 A;  1NHL A;  2N1T B;  1CI6 B;  5GTI H;  3SWF A;  1SQP G;  2O1K A;  1PFI A;  2YKO A;  3RK3 E;  1VQ6 P;  1SQB K;  5KAI H;  2OYH C;  2MKV A;  3E7K A;  4AUW A;  1N7S D;  1E79 H;  5APQ A;  3Q5S A;  1KMI Z;  2H88 C;  2YNY A;  5GTH H;  2QA4 P;  1DD4 A;  3KZI E;  5KLV J;  2O3J A;  3A7O A;  2IX7 C;  3L72 D;  3KDP B;  2KZI A;  2HPC A;  2E74 C;  1GW4 A;  5AVS B;  1NTM E;  3L73 D;  3D71 A;  3A5T A;  3GLM A;  1S9K E;  1QLE D;  2NPS C;  2WSE H;  3RK3 B;  1SQV D;  2H43 A;  1JY2 O;  2R5B A;  4U3F E;  3BVH A;  1M90 Q;  2C9N Y;  1YI2 P;  1T8Z A;  1SQP E;  3TGU G;  2YMK A;  5CCG D;  4IL6 X;  1UII A;  2ZYD A;  4BRY B;  4L76 A;  3B4S A;  1RHZ B;  1LGH B;  1KFM A;  3HUS B;  1OVR A;  1VQ4 P;  2A06 D;  1T6A A;  2WSC J;  1SQX E;  1NU1 K;  4Y99 C;  4K3A A;  3L74 D;  1R8E A;  2PAJ A;  2HR3 A;  1NGM B;  1Q7Y Q;  1L0L G;  3H1J G;  3BCC D;  5APV A;  2O1J A;  1CW5 A;  2WZ7 A;  4UB8 E;  2HG5 D;  1USD A;  5E79 E;  1LJ2 A;  2KLV A;  3VMZ A;  1MV8 A;  1N7L A;  4ASW A;  3L70 D;  1SQQ K;  2GUV A;  1H8A A;  2H7H A;  1GU4 A;  4EIJ A;  2Y9Y A;  1S1C X;  2OYO A;  4W7Z A;  3TGU E;  5BU5 A;  4H44 B;  2Q3I A;  2CPB A;  1HJ0 A;  2YO3 A;  1YYC A;  4C7R A;  4HYT B;  2QVA A;  2FY8 A;  1NH4 A;  3TF5 A;  1LT9 C;  2AEM A;  1USE A;  3Q2Y A;  1URQ A;  3VMA A;  4XE5 B;  1LP1 A;  2M3B A;  1SQB J;  1J1E B;  1L0L E;  3H1J E;  1KQL A;  1M1J B;  3AEE C;  1RY3 A;  2WMM A;  1RH5 B;  1JTH B;  3GF7 A;  1T3U A;  2LR2 A;  3M9B A;  1IO4 A;  2A06 G;  3SSU A;  3L75 G;  4KJM A;  1GMJ A;  3AE8 C;  2Y0C A;  1LTJ A;  1YIT P;  3H1L D;  1BDD A;  1MZ9 A;  2AEF A;  2H89 C;  1GK6 A;  2IZ1 A;  1YQ4 C;  1JOC A;  1SFC B;  2C0W A;  3M0A A;  4ZNC A;  1J1D C;  3ABV C;  1IZN B;  3G6E P;  1ZN5 A;  1KYO E;  1KC8 Q;  3EFG A;  1GZL A;  1NKN A;  2RMZ A;  1NU1 J;  3G4S P;  3RK2 D;  4ZKP A;  3AE4 C;  4W7Y A;  1EZV G;  3GG2 A;  3KPE A;  1WT6 A;  3KYQ A;  1L4A C;  2YXQ B;  4PD4 H;  1SQQ J;  1NJI Q;  3MUD C;  1NTK G;  2FYN B;  4WWI A;  2E75 C;  1LTI C;  3B5N D;  3H32 B;  2LXC B;  1BCC J;  2IYO A;  1KZU B;  2E5Y A;  3CMA P;  2RKL A;  2E74 D;  1G2C B;  2J5U A;  3M91 A;  3RL0 B;  4WY4 C;  3FWL A;  3V2Q A;  1JUN A;  2XDJ A;  2NPS D;  1JNM A;  1QGK B;  1YJW P;  1NTM J;  1EZV E;  1SP4 A;  3C9I A;  4LC1 A;  4DJG A;  3CL3 D;  1EQ7 A;  2ITA A;  2LXB A;  4U3F J;  1YTZ I;  1AFO A;  3USS A;  5AW4 B;  1SQP J;  1U57 A;  1LWU A;  3TSI A;  1MUU A;  2A45 H;  3IF4 A;  1GL2 A;  1SQV K;  2G3A A;  3MHV A;  3HD7 C;  3HTK A;  4AYC A;  1CSB A;  4W80 A;  1EDK A;  1OVU A;  2YXR B;  2Q6Q A;  3AE5 C;  2WPV B;  3AEG C;  2OYI C;  4IL6 H;  2FYU D;  4MN4 C;  3CI9 A;  1GU5 A;  1H0T A;  2WPR A;  2YKP A;  2IBZ D;  2RN0 A;  3L4F A;  1XTG B;  2K1A A;  5KJ7 A;  1KYO I;  3C1L A;  3T97 A;  1RE4 A;  4PJ0 H;  1LTG C;  4O9B A;  1JMB A;  3V6I A;  1BGY D;  2HPC B;  3ITK A;  3SFE C;  1M1K Q;  2OGU A;  5AVR B;  5TIS H;  3II6 A;  3H1J J;  1FC2 C;  3H1H D;  3S4R A;  2HYN A;  1RE3 A;  1L0N D;  2Z5H A;  1SQB G;  1OW6 A;  2KOG A;  2Q3E A;  3PP5 A;  1VQN P;  5CMZ A;  3CLQ A;  4H0L C;  3V4W A;  1N2D C;  4AQR D;  3NFQ A;  3BRV B;  1VQ8 P;  4N78 E;  1MFT A;  2XND H;  1BE3 D;  3CX5 I;  2KB7 P;  1OWA A;  2ZXE B;  3RBX A;  2QJK B;  3JCU H;  1UIX A;  3IFM A;  3M0D C;  1KFN A;  4OGQ C;  1XTC C;  1N7S A;  3KQG A;  2KUB A;  4N3Y B;  1P84 E;  3CXH E;  5C39 A;  3TDK A;  2ZJS E;  1FZE A;  1QL2 A;  2L5G B;  1L4A D;  4WVZ A;  1SQB E;  1QVG O;  2E43 A;  4KHX A;  2E75 D;  1JY3 O;  3NXS A;  3FXD A;  2QIW A;  1URQ B;  3WU2 E;  3L75 J;  1LP1 B;  3QWO C;  1NU1 G;  1T3J A;  1T2K C;  1GDT A;  3L74 J;  3Q3D A;  3CCJ P;  4OH8 B;  3K5B A;  2V7Q H;  3P8C D;  5CCG A;  4WY4 D;  5AW1 B;  3CWB D;  2D2C C;  1VL2 A;  1HWT C;  2QE7 H;  1SQX D;  3R2P A;  5AW0 B;  1NKZ B;  3O6Q A;  2YIU C;  3EQ2 A;  4I7Z C;  1LTJ B;  1LTB C;  3A0B H;  1NTZ G;  1Y47 A;  1VQK P;  2HLO A;  2ZT9 C;  1JCC A;  1IFD A;  1VF5 C;  2XV5 A;  2QM7 A;  3H1I G;  3AEA C;  4PD4 D;  3CPW O;  3OAK A;  2ZYA A;  1NU1 E;  4ZKU A;  1FAV A;  3LW5 J;  1X22 A;  2B89 A;  2BCC D;  3PJS K;  5AW5 B;  1PGO A;  4UB6 H;  3GF3 A;  1NTK J;  2KIK A;  3HD7 D;  3GMA A;  3TK1 A;  1QX8 A;  2OAR A;  2FKW B;  1SQQ E;  5DJU B;  1NAF A;  1OIP A;  3TNU B;  1PPJ G;  2Q5U A;  2DW3 A;  1BCC E;  2FXO A;  1FZC C;  3WMM 0;  1NWQ A;  3MP7 B;  3VOP A;  1KOR A;  3B5N C;  2O01 H;  3V2P A;  3F5H A;  2FFD C;  3H1I E;  2KZJ A;  3H1L J;  4YPC A;  1P84 I;  1OZH A;  3CXH I;  1U7J A;  2FYU K;  2QJP B;  2FBW C;  5L8R J;  1YJN P;  2JR8 A;  1N8R Q;  5TJH A;  5CBO A;  4NPD A;  5CCH C;  2E76 B;  5KAF E;  3RL0 g;  2B88 A;  2FYZ A;  5AVW B;  1KIL C;  3CCL P;  1PPJ E;  3F89 A;  4KT0 J;  5K5G B;  2WVR A;  4R4L A;  1EDL A;  1Y8A A;  1W2E A;  2H8P D;  4H0L D;  1LWU B;  1S5L E;  4DZO A;  1VQ5 P;  1HF9 A;  1GL2 B;  1OW7 A;  3RL0 D;  2W27 A;  3HTK B;  1VQM P;  1VQ9 P;  2QG4 A;  5KKZ B;  2OYH A;  4H13 C;  1L0N K;  4OGQ D;  1CZQ A;  1H0T B;  3A0H E;  1KV4 A;  3I56 P;  5AW6 B;  3D6Y A;  1L2P A;  4OVN F;  2W90 A;  2QSI A;  1KB9 E;  2M5A A;  3AE7 C;  1NTZ K;  3T97 B;  3CCS P;  1W2B O;  1YIJ P;  1IK9 A;  1RF1 C;  3L72 G;  2NPS A;  4WBA A;  1GD2 E;  1JM0 A;  2A45 G;  3L73 G;  2WT7 A;  3QH9 A;  3MD0 A;  1T2K D;  1VDF A;  1SQV G;  1HBW A;  2W6A A;  3GHG C;  4L74 A;  1MFZ A;  3B8E B;  2ZXX A;  1OW8 A;  2N1T C;  3KZI H;  2D2C D;  5AVT B;  5APY A;  3H1K D;  1HGV A;  2Y0D A;  1Q82 Q;  1BSN A;  4PV1 B;  2UWJ E;  2HOD A;  1DEB A;  1ZR4 A;  1PP9 D;  2WSE J;  3L74 G;  1FBM A;  2KXP B;  1WMK A;  1LTA C;  3VN0 A;  2BEQ D;  2ZT9 D;  2M3E A;  3BCC G;  1VF5 D;  2JKV A;  1NVO A;  3L70 G;  3VP9 A;  3B71 A;  1SQV E;  3RK3 C;  5AW7 B;  1SQX K;  1VPC A;  3E1R A;  2PRR A;  1BGY J;  5KLV D;  3L37 A;  1N7S B;  5KLI B;  4D6T D;  5B66 E;  1MKM A;  3SWK A;  1FZA A;  1LT9 A;  2M8R A;  5AVY B;  1HVV A;  3TNU A;  4UB8 H;  5E79 H;  1M7L A;  4BXL A;  1OXZ A;  3HUS C;  2A06 E; 
#chains in the Genus database with same CATH homology
 3H1H J;  1EZV I;  3L70 J;  1SQV J;  3L75 J;  1NTZ J;  1SQQ J;  1L0N J;  1BGY J;  1SQX J;  1BE3 J;  2IBZ I;  3H1L J;  3L74 J;  5KLV J;  3CX5 I;  1KB9 I;  1NU1 J;  1P84 I;  3H1I J;  4PD4 I;  4U3F J;  1KYO I;  2BCC J;  4D6T J;  1SQP J;  3CXH I;  3H1K J;  3L72 J;  1SQB J;  1NTK J;  3TGU J;  1BCC J;  3BCC J;  3L73 J;  1NTM J;  3CWB J;  1L0L J;  2FYU J;  3H1J J;  3L71 J;  1PP9 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...