1SR4C

Crystal structure of the haemophilus ducreyi cytolethal distending toxin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
154
structure length
154
Chain Sequence
DPTTYPDVELSPPPRISLRSLLTAQPVKNDHYDSHNYLSTHWELIDYKGKEYEKLRDGGTLVQFKVVGAAKCFAFLGKGTTDCKDTDHTVFNLIPTNTGAFLIKDALLGFCITSHDFDDLKLEPCGGSVSGRTFSLAYQWGILPPFGPSKILIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Assembly and Function of a Bacterial Genotoxin
pubmed doi rcsb
molecule keywords Cytolethal distending toxin subunit A
molecule tags Toxin
source organism Haemophilus ducreyi
total genus 36
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03498 CDtoxinA Cytolethal distending toxin A/C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1sr4C00
1HCDA 4AN7B 4J2YA 3ZX7A 1YXWA 3WMUA 1DZCA 3FJJA 1DFCA 1W3FA 3F62B 1AVUA 31BIA 1JT7A 4QALA 2MC2A 5BQUC 2HWAA 3BRGC 4QO3A 2DS0A 3AKHA 2M49A 4ZFWB 1IRAX 2ZQOA 3CA6A 2IWTB 5FZUA 3VUOA 2Z48A 1SR4A 1V6UA 3VT0A 3TC2A 2D44A 4I4XA 3N0KA 3O4BA 3VSZA 1NZKA 2J3PA 1WBCA 3UDAA 4I4QA 3NBCA 1AVWB 2P39A 3OGGA 3FJKA 3FUOA 4X38A 3A23A 3RTIB 1YBIA 1PUMB 1TIEA 2MLLB 3V0AB 1P63A 3N7LA 4GP3A 1G9DA 1EV2A 1TWEA 1S0BA 2VSAA 1S0DA 3V0AA 1SZ6B 1BLDA 2ERMA 2ZR1B 1FQ9A 5FZYA 1ISZA 2WBCA 2GO2A 2NVHA 4OEFA 1JY0A 1M2TB 2VSEA 3JRRA 5D61A 1RY7A 4I4SA 3BA4A 1JLXA 3CA4A 3POKA 3PG0A 3BA5A 1K5VA 1YF8B 2HZ9A 1PUUB 4I96A 3Q7YA 1DIWA 3I2AA 2F2FA 3CRIA 3CA5A 4USOA 3FJFA 3BA7A 3HMYA 1PC8B 4I8MA 2YUGA 3BAUA 2QN4A 1AFCA 3E8LC 3HSMA 4G6JA 4EEEB 1Z2VA 2D20A 4P0LA 1V6WA 4LO2C 1PWAA 5BXRA 5DVHA 4IHZA 4P0KA 3V0BA 4J23B 4HA2A 4I6IA 2FO1A 4ZFYB 2RSTA 2P23A 4IY8A 4LO7B 4IZEA 3T8SA 4ZA3B 2K8RA 2FFUA 5F90A 3N7JA 1PZZA 3UD8A 3VEQA 4QBVA 4D0TA 3AJ5A 4GP0A 2NTDA 2Q3NB 2X2SA 3CA1A 3FJ9A 4LO0C 3QR5A 3IM6A 5EG6C 3H6QA 3AH2A 2R9KB 1JT4A 1MC9A 2ET2A 4KEKA 4LO3A 3R4UA 4A7YA 3Q7XA 1IJTA 2QYIB 1V6VA 1S0EA 1QQKA 3LTQA 4OEGA 3RTJB 1TTUA 1JTCA 1VCLA 3O44A 3O5WB 4KEJA 4WBCA 3O4CA 1W3AA 4OEEA 4IZXA 4JP0A 4R6UB 1BASA 1E0OA 1II4A 3P6IA 41BIA 3CRGA 5FNWA 5EHAA 4I4RA 3BTAA 8I1BA 1ABRB 3FJHA 3QYDA 4QC4A 3VT2A 1XYFA 4X3AA 6I1BA 2Y9FA 1T9FA 5GAQA 2VXRA 3FUQA 1SR4C 2K4AB 5BOWA 1DZDA 1M16A 3FJBA 1ISVA 2D7IA 2NM1A 4DCKC 3LLPA 4XFTA 1XZZA 3CQAA 5D62A 1S0FA 3H6SE 3AJ6A 5BP5A 1RMLA 5BXTA 2I1BA 2ZQNA 1GGPB 4QKSA 3CA0A 4JRAA 4DENA 1HWOB 4F34A 4P6AA 1JT5A 3P6JA 3WA1A 2E4MA 1DQOA 2GZBA 1A8DA 3AH1A 3BRDA 2D43A 1DLLA 1G9AA 4OUJA 1EVTA 1WD4A 4HR6C 4ZLBB 3UJ0A 1W3GA 1ISYA 1ISXA 3MALA 4IONA 5DUYA 4QD2C 2BEBA 2Z49A 1FN0A 3H6RB 3HN1A 1S0CA 3H6RA 5F8WA 3CA3A 3OJVA 4LO1A 1KNMA 2LIEA 1IRPA 1JT3A 3O4DA 2F2FC 1BARA 3AKFA 4P0JA 4OWJA 3HBWA 4ZBVB 4X39A 3BADA 3ZXGA 3B9UA 4GAFA 5I1BA 2AAIB 4HJJA 1DQGA 3FJAA 3O4AA 1ONKB 2Y9XE 3WMVA 3D7WB 4GOYA 3FJIA 4Q9GA 3IAGC 1CE7B 3JUTA 3UD9A 4LO7C 3Q7WA 1HCEA 1FGAA 1ITBA 2BEAA 4JPZA 3HOMA 3I29B 3UJ4A 3FJDA 4OWKA 3BAVA 4OWLA 5DZUA 3PMEA 3FGMA 2NZ9A 2WRYA 3IM5A 1XHBA 1JLYA 1MD6A 4TLPA 1J0SA 5BXPA 4LO3C 4I0YA 3S8KA 1AXMA 4I3NA 5E24E 2KKIA 3N7KA 3BRFA 3A21A 1UPSA 3CU1B 1S0LA 2L5XA 2MIBA 3WO3A 1Q1UA 4I4OA 2RQ9A 1BLAA 1NUNA 1AVXB 4I1EA 3AH4A 1WBAA 2D24A 3O3QA 4I4PA 2VUAA 1Z0HA 1RZOB 5F8SA 7I1BA 2KI6B 4GOVA 3OBRA 2D23A 4XFUA 4ZKTB 2FGFA 1TWMA 4H9WA 5JMCA 3VWCA 3F1RA 3A07A 3EF2A 2IHOA 3AZWA 4II0A 3WINA 4I4YA 3AZVA 3RSJA 4CJMA 4QKRA 1G9CA 2UUSA 4L4HA 5FNXA 3IM7A 4IYBA 1CVSA 1L2HA 5BP5C 4G9MA 4EFPA 3NBNA 4LO8B 3BAQA 3OBTA 4ISQA 3WO4A 4J2XA 1XG6A 1R8NA 4LO0A 4G9NA 4A7KA 4OW4A 3KMVA 4ZOTA 2D22A 1YYNA 2E4MC 3VT1A 4JAWA 1YTOA 4DEPA 5DSSB 1V6XA 2D7RA 1G9BA 1IHKA 5B2HA 9ILBA 5G00A 2DRZA 2VU9A 4KEIA 5BXSA 3R4SA 3C9ZA 1IILA 1WD3A 1T4QA 1FV2A 1G82A 1HWNB 3CRHA 3NBDA 2KLLA 1TOOA 4LO1C 1FMZA 3IIRA 3AKGA 2X2TA 1ISWA 4G1RA 1BFGA 5D63A 2FFVA 1ILR1 2RG9B 1BFFA 3CAHA 1Q04A 5BQUA 3UD7A 4J2KA 1HIBA 1QXMA 3PUBA 1RG8A 3FJCA 4KBBA 3RMXA 4Z9WB 1FV3A 1S0GA 1K5UA 4I7IA 3O4OA 1TP0A 3FFZA 3PHZA 1Q03A 1QQLA 3S8JA 2NP0A 1F31A 4Q91A 3P53A 1I1EA 1DJSB 1Z4SA 2HWMA 2DREA 3V79C 4H04A 1JQZA 4JQ0A 4D0ZA 1FWUA 4Z8SB 1N4KA 4QD2B 2DRYA 3OJ2A 1EYLA 3O49A 2AXMA 4X37A 1D0HA 3BX1C 3OJMA 1DFQA 4Q9PA 4F83A 4I2SA 4YOLA 4KC3A 4IQPA 1I1BA 1BFCA 1IT0A 3N7MA 4L4IA 1FWVA 2D1ZA 3ILAA 2Y9WC 3OGFA 1AF9A 2K43A 1OQLB 4D8HA 3FJ8A 2XOAA 2HW9A 4PC4A 2ESUA 1R8OA 1BA7A 1BFBA 5FZZA 3V0BB 2VXTI 3BAGA 3MPPG 3RMYA 4XFSA 3A22A 4IY9A 4ISRA 2NYYA 4XKIA 3WINC 4I4VA 3FJEA 4A7ZA 4ZFUB 1HWPB 4JKXB 1AVAC 4LO2A 3I2XA 1FMMS 1HKNA 2KI4A 4EFRA 4EFQA 4QBCA 2KH2A 4I1BA 4J2SA 1HWMB 2Y9GA 4I37A 2VLCA 4GAIA 3SNVA 4ZGRB 3W9TA 4FVVA 4I4UA 5EC5A 4EKXB 1TFMB 3ZXDA 4FGFA 4USPA 2AQZA 1IOBA 21BIA 3ZC8A 3BB2A 4AN6A 4EB2B 2BFHA 3VSFA 5BVPI 2F8XC 3K1XA 3NBEA 3AKIA 3BAOA 3WO2A 1EPWA 2FDBM 3NJ5A 3ZC9A 2AFGA 3HALA 4G6MA 4ENDA 5JLVA 4JKQA 3BAHA 2Q9XA 2LIQA 5HPZA 5F8YA
chains in the Genus database with same CATH superfamily
1HCDA 4AN7B 4J2YA 3ZX7A 1YXWA 3WMUA 1DZCA 3FJJA 1DFCA 1W3FA 3F62B 1AVUA 31BIA 1JT7A 4QALA 2MC2A 5BQUC 2HWAA 3BRGC 4QO3A 2DS0A 3AKHA 2M49A 4ZFWB 1IRAX 2ZQOA 3CA6A 2IWTB 5FZUA 3VUOA 2Z48A 1SR4A 1V6UA 3VT0A 3TC2A 2D44A 4I4XA 3N0KA 3O4BA 3VSZA 1NZKA 2J3PA 1WBCA 3UDAA 4I4QA 3NBCA 1AVWB 2P39A 3OGGA 3FJKA 3FUOA 4X38A 3A23A 3RTIB 1YBIA 1PUMB 1TIEA 2MLLB 3V0AB 1P63A 3N7LA 4GP3A 1G9DA 1EV2A 1TWEA 1S0BA 2VSAA 1S0DA 3V0AA 1SZ6B 1BLDA 2ERMA 2ZR1B 1FQ9A 5FZYA 1ISZA 2WBCA 2GO2A 2NVHA 4OEFA 1JY0A 1M2TB 2VSEA 3JRRA 5D61A 1RY7A 4I4SA 3BA4A 1JLXA 3CA4A 3POKA 3PG0A 3BA5A 1K5VA 1YF8B 2HZ9A 1PUUB 4I96A 3Q7YA 1DIWA 3I2AA 2F2FA 3CRIA 3CA5A 4USOA 3FJFA 3BA7A 3HMYA 1PC8B 4I8MA 2YUGA 3BAUA 2QN4A 1AFCA 3E8LC 3HSMA 4G6JA 4EEEB 1Z2VA 2D20A 4P0LA 1V6WA 4LO2C 1PWAA 5BXRA 5DVHA 4IHZA 4P0KA 3V0BA 4J23B 4HA2A 4I6IA 2FO1A 4ZFYB 2RSTA 2P23A 4IY8A 4LO7B 4IZEA 3T8SA 4ZA3B 2K8RA 2FFUA 5F90A 3N7JA 1PZZA 3UD8A 3VEQA 4QBVA 4D0TA 4MZHA 3AJ5A 4GP0A 2NTDA 2Q3NB 2X2SA 3CA1A 3FJ9A 4LO0C 3QR5A 3IM6A 5EG6C 3H6QA 3AH2A 2R9KB 1JT4A 1MC9A 2ET2A 4KEKA 4LO3A 3R4UA 4A7YA 3Q7XA 1IJTA 2QYIB 1V6VA 1S0EA 1QQKA 3LTQA 4OEGA 3RTJB 1TTUA 1JTCA 1VCLA 3O44A 3O5WB 4KEJA 4WBCA 3O4CA 1W3AA 4OEEA 4IZXA 4JP0A 4R6UB 1BASA 1E0OA 1II4A 3P6IA 41BIA 3CRGA 5FNWA 5EHAA 4I4RA 3BTAA 8I1BA 1ABRB 3FJHA 3QYDA 4QC4A 3VT2A 1XYFA 4X3AA 6I1BA 2Y9FA 1T9FA 5GAQA 2VXRA 3FUQA 1SR4C 2K4AB 4MZGB 5BOWA 1M16A 3FJBA 1DZDA 1ISVA 2D7IA 2NM1A 4DCKC 3LLPA 4XFTA 1XZZA 3CQAA 5D62A 1S0FA 3H6SE 3AJ6A 5BP5A 1RMLA 5BXTA 2I1BA 2ZQNA 1GGPB 4QKSA 3CA0A 4JRAA 4DENA 1HWOB 4F34A 4P6AA 1JT5A 3P6JA 3WA1A 2E4MA 1DQOA 2GZBA 1A8DA 3AH1A 3BRDA 2D43A 1DLLA 1G9AA 4OUJA 1EVTA 1WD4A 4HR6C 4ZLBB 3UJ0A 1W3GA 1ISYA 1ISXA 3MALA 4IONA 5DUYA 4QD2C 2BEBA 2Z49A 1FN0A 3H6RB 3HN1A 1S0CA 4UY4A 3H6RA 5F8WA 3CA3A 3OJVA 4LO1A 1KNMA 2LIEA 1IRPA 1JT3A 3O4DA 2F2FC 1BARA 3AKFA 4P0JA 4OWJA 3HBWA 4ZBVB 4X39A 3BADA 3ZXGA 3B9UA 4GAFA 5I1BA 2AAIB 4HJJA 1DQGA 3FJAA 3O4AA 1ONKB 2Y9XE 3WMVA 3D7WB 4GOYA 3FJIA 4Q9GA 3IAGC 1CE7B 3JUTA 3UD9A 4H75A 4LO7C 3Q7WA 1HCEA 1FGAA 1ITBA 2BEAA 4JPZA 3HOMA 3I29B 3UJ4A 3FJDA 4OWKA 3BAVA 2NS2A 4OWLA 5DZUA 3PMEA 3FGMA 2NZ9A 2WRYA 3IM5A 1XHBA 1JLYA 1MD6A 4TLPA 1J0SA 5BXPA 4LO3C 4I0YA 3S8KA 1AXMA 4I3NA 5E24E 2KKIA 3N7KA 3BRFA 3A21A 1UPSA 3CU1B 1S0LA 2L5XA 2MIBA 3WO3A 1Q1UA 4I4OA 2RQ9A 1BLAA 1NUNA 1AVXB 4I1EA 3AH4A 1WBAA 2D24A 3O3QA 4I4PA 2VUAA 1Z0HA 1RZOB 5F8SA 7I1BA 2KI6B 4GOVA 3OBRA 2D23A 4XFUA 4ZKTB 2FGFA 1TWMA 4H9WA 5JMCA 3VWCA 3F1RA 3A07A 3EF2A 2IHOA 3AZWA 4II0A 3WINA 4I4YA 3AZVA 3RSJA 4CJMA 4QKRA 1G9CA 2UUSA 4L4HA 5FNXA 3IM7A 4IYBA 1CVSA 1L2HA 5BP5C 4G9MA 4EFPA 3NBNA 4LO8B 3BAQA 3OBTA 4ISQA 3WO4A 4J2XA 1XG6A 1R8NA 4LO0A 4G9NA 4A7KA 4OW4A 3KMVA 4ZOTA 2D22A 1YYNA 2E4MC 3VT1A 4MZFB 4JAWA 1YTOA 4DEPA 5DSSB 1V6XA 2D7RA 1G9BA 1IHKA 5B2HA 9ILBA 5G00A 2DRZA 2VU9A 4KEIA 5BXSA 3R4SA 3C9ZA 1IILA 1WD3A 1T4QA 1FV2A 1G82A 1HWNB 3CRHA 3NBDA 2KLLA 1TOOA 4LO1C 1FMZA 3IIRA 3AKGA 2X2TA 1ISWA 4G1RA 1BFGA 5D63A 2FFVA 1ILR1 2RG9B 1BFFA 3CAHA 1Q04A 5BQUA 3UD7A 4J2KA 1HIBA 1QXMA 3PUBA 1RG8A 3FJCA 4KBBA 3RMXA 4Z9WB 1FV3A 1S0GA 1K5UA 4I7IA 3O4OA 1TP0A 3FFZA 3PHZA 1Q03A 1QQLA 3S8JA 2NP0A 1F31A 4Q91A 3P53A 1I1EA 1DJSB 1Z4SA 2HWMA 2DREA 3V79C 4H04A 1JQZA 4JQ0A 4D0ZA 1FWUA 4Z8SB 1N4KA 4QD2B 2DRYA 3OJ2A 1EYLA 3O49A 2AXMA 4X37A 1D0HA 3BX1C 3OJMA 1DFQA 4Q9PA 4F83A 4I2SA 4YOLA 4KC3A 4IQPA 1I1BA 1BFCA 1IT0A 3N7MA 4L4IA 1FWVA 2D1ZA 3ILAA 2Y9WC 3OGFA 1AF9A 2K43A 1OQLB 4D8HA 3FJ8A 2XOAA 2HW9A 4PC4A 2ESUA 1R8OA 1BA7A 1BFBA 5FZZA 3V0BB 2VXTI 3BAGA 3MPPG 3RMYA 4XFSA 3A22A 4IY9A 4ISRA 2NYYA 4XKIA 3WINC 4I4VA 3FJEA 4A7ZA 4ZFUB 1HWPB 4JKXB 1AVAC 4LO2A 3I2XA 1FMMS 1HKNA 2KI4A 4EFRA 4EFQA 4QBCA 2KH2A 4I1BA 4J2SA 1HWMB 2Y9GA 4I37A 2VLCA 4GAIA 3SNVA 4ZGRB 3W9TA 4FVVA 4I4UA 5EC5A 4EKXB 1TFMB 3ZXDA 4FGFA 4USPA 2AQZA 1IOBA 21BIA 3ZC8A 3BB2A 4AN6A 4EB2B 2BFHA 3VSFA 5BVPI 2F8XC 3K1XA 3NBEA 3AKIA 3BAOA 3WO2A 1EPWA 2FDBM 3NJ5A 3ZC9A 2AFGA 3HALA 4G6MA 4ENDA 5JLVA 4JKQA 3BAHA 2Q9XA 2LIQA 5HPZA 5F8YA
chains in the Genus database with same CATH topology
1HCDA 4AN7B 4J2YA 3ZX7A 1YXWA 3WMUA 1DZCA 3FJJA 1DFCA 1W3FA 3F62B 1AVUA 31BIA 1JT7A 4QALA 2MC2A 5BQUC 2HWAA 3BRGC 4QO3A 2DS0A 3AKHA 2M49A 4ZFWB 1IRAX 2ZQOA 3CA6A 2IWTB 5FZUA 3VUOA 2Z48A 1SR4A 1V6UA 3VT0A 3TC2A 2D44A 4I4XA 3N0KA 3O4BA 3VSZA 1NZKA 2J3PA 1WBCA 3UDAA 4I4QA 3NBCA 1AVWB 2P39A 3OGGA 3FJKA 3FUOA 4X38A 3A23A 3RTIB 1YBIA 1PUMB 1TIEA 2MLLB 3V0AB 1P63A 3N7LA 4GP3A 1G9DA 1EV2A 1TWEA 1S0BA 2VSAA 1S0DA 3V0AA 1SZ6B 1BLDA 2ERMA 2ZR1B 1FQ9A 5FZYA 1ISZA 2WBCA 2GO2A 2NVHA 4OEFA 1JY0A 1M2TB 2VSEA 3JRRA 5D61A 1RY7A 4I4SA 3BA4A 1JLXA 3CA4A 3POKA 3PG0A 3BA5A 1K5VA 1YF8B 2HZ9A 1PUUB 4I96A 3Q7YA 1DIWA 3I2AA 2F2FA 3CRIA 3CA5A 4USOA 3FJFA 3BA7A 3HMYA 1PC8B 4I8MA 2YUGA 3BAUA 2QN4A 1AFCA 3E8LC 3HSMA 4G6JA 4EEEB 1Z2VA 2D20A 4P0LA 1V6WA 4LO2C 1PWAA 5BXRA 5DVHA 4IHZA 4P0KA 3V0BA 4J23B 4HA2A 4I6IA 2FO1A 4ZFYB 2RSTA 2P23A 4IY8A 4LO7B 4IZEA 3T8SA 4ZA3B 2K8RA 2FFUA 5F90A 3N7JA 1PZZA 3UD8A 3VEQA 4QBVA 4D0TA 4MZHA 3AJ5A 4GP0A 2NTDA 2Q3NB 2X2SA 3CA1A 3FJ9A 4LO0C 3QR5A 3IM6A 5EG6C 3H6QA 3AH2A 2R9KB 1JT4A 1MC9A 2ET2A 4KEKA 4LO3A 3R4UA 4A7YA 3Q7XA 1IJTA 2QYIB 1V6VA 1S0EA 1QQKA 3LTQA 4OEGA 3RTJB 1TTUA 1JTCA 1VCLA 3O44A 3O5WB 4KEJA 4WBCA 3O4CA 1W3AA 4OEEA 4IZXA 4JP0A 4R6UB 1BASA 1E0OA 1II4A 3P6IA 41BIA 3CRGA 5FNWA 5EHAA 4I4RA 3BTAA 8I1BA 1ABRB 3FJHA 3QYDA 4QC4A 3VT2A 1XYFA 4X3AA 6I1BA 2Y9FA 1T9FA 5GAQA 2VXRA 3FUQA 1SR4C 2K4AB 4MZGB 5BOWA 1M16A 3FJBA 1DZDA 1ISVA 2D7IA 2NM1A 4DCKC 3LLPA 4XFTA 1XZZA 3CQAA 5D62A 1S0FA 3H6SE 3AJ6A 5BP5A 1RMLA 5BXTA 2I1BA 2ZQNA 1GGPB 4QKSA 3CA0A 4JRAA 4DENA 1HWOB 4F34A 4P6AA 1JT5A 3P6JA 3WA1A 2E4MA 1DQOA 2GZBA 1A8DA 3AH1A 3BRDA 2D43A 1DLLA 1G9AA 4OUJA 1EVTA 1WD4A 4HR6C 4ZLBB 3UJ0A 1W3GA 1ISYA 1ISXA 3MALA 4IONA 5DUYA 4QD2C 2BEBA 2Z49A 1FN0A 3H6RB 3HN1A 1S0CA 4UY4A 3H6RA 5F8WA 3CA3A 3OJVA 4LO1A 1KNMA 2LIEA 1IRPA 1JT3A 3O4DA 2F2FC 1BARA 3AKFA 4P0JA 4OWJA 3HBWA 4ZBVB 4X39A 3BADA 3ZXGA 3B9UA 4GAFA 5I1BA 2AAIB 4HJJA 1DQGA 3FJAA 3O4AA 1ONKB 2Y9XE 3WMVA 3D7WB 4GOYA 3FJIA 4Q9GA 3IAGC 1CE7B 3JUTA 3UD9A 4H75A 4LO7C 3Q7WA 1HCEA 1FGAA 1ITBA 2BEAA 4JPZA 3HOMA 3I29B 3UJ4A 3FJDA 4OWKA 3BAVA 2NS2A 4OWLA 5DZUA 3PMEA 3FGMA 2NZ9A 2WRYA 3IM5A 1XHBA 1JLYA 1MD6A 4TLPA 1J0SA 5BXPA 4LO3C 4I0YA 3S8KA 1AXMA 4I3NA 5E24E 2KKIA 3N7KA 3BRFA 3A21A 1UPSA 3CU1B 1S0LA 2L5XA 2MIBA 3WO3A 1Q1UA 4I4OA 2RQ9A 1BLAA 1NUNA 1AVXB 4I1EA 3AH4A 1WBAA 2D24A 3O3QA 4I4PA 2VUAA 1Z0HA 1RZOB 5F8SA 7I1BA 2KI6B 4GOVA 3OBRA 2D23A 4XFUA 4ZKTB 2FGFA 1TWMA 4H9WA 5JMCA 3VWCA 3F1RA 3A07A 3EF2A 2IHOA 3AZWA 4II0A 3WINA 4I4YA 3AZVA 3RSJA 4CJMA 4QKRA 1G9CA 2UUSA 4L4HA 5FNXA 3IM7A 4IYBA 1CVSA 1L2HA 5BP5C 4G9MA 4EFPA 3NBNA 4LO8B 3BAQA 3OBTA 4ISQA 3WO4A 4J2XA 1XG6A 1R8NA 4LO0A 4G9NA 4A7KA 4OW4A 3KMVA 4ZOTA 2D22A 1YYNA 2E4MC 3VT1A 4MZFB 4JAWA 1YTOA 4DEPA 5DSSB 1V6XA 2D7RA 1G9BA 1IHKA 5B2HA 9ILBA 5G00A 2DRZA 2VU9A 4KEIA 5BXSA 3R4SA 3C9ZA 1IILA 1WD3A 1T4QA 1FV2A 1G82A 1HWNB 3CRHA 3NBDA 2KLLA 1TOOA 4LO1C 1FMZA 3IIRA 3AKGA 2X2TA 1ISWA 4G1RA 1BFGA 5D63A 2FFVA 1ILR1 2RG9B 1BFFA 3CAHA 1Q04A 5BQUA 3UD7A 4J2KA 1HIBA 1QXMA 3PUBA 1RG8A 3FJCA 4KBBA 3RMXA 4Z9WB 1FV3A 1S0GA 1K5UA 4I7IA 3O4OA 1TP0A 3FFZA 3PHZA 1Q03A 1QQLA 3S8JA 2NP0A 1F31A 4Q91A 3P53A 1I1EA 1DJSB 1Z4SA 2HWMA 2DREA 3V79C 4H04A 1JQZA 4JQ0A 4D0ZA 1FWUA 4Z8SB 1N4KA 4QD2B 2DRYA 3OJ2A 1EYLA 3O49A 2AXMA 4X37A 1D0HA 3BX1C 3OJMA 1DFQA 4Q9PA 4F83A 4I2SA 4YOLA 4KC3A 4IQPA 1I1BA 1BFCA 1IT0A 3N7MA 4L4IA 1FWVA 2D1ZA 3ILAA 2Y9WC 3OGFA 1AF9A 2K43A 1OQLB 4D8HA 3FJ8A 2XOAA 2HW9A 4PC4A 2ESUA 1R8OA 1BA7A 1BFBA 5FZZA 3V0BB 2VXTI 3BAGA 3MPPG 3RMYA 4XFSA 3A22A 4IY9A 4ISRA 2NYYA 4XKIA 3WINC 4I4VA 3FJEA 4A7ZA 4ZFUB 1HWPB 4JKXB 1AVAC 4LO2A 3I2XA 1FMMS 1HKNA 2KI4A 4EFRA 4EFQA 4QBCA 2KH2A 4I1BA 4J2SA 1HWMB 2Y9GA 4I37A 2VLCA 4GAIA 3SNVA 4ZGRB 3W9TA 4FVVA 4I4UA 5EC5A 4EKXB 1TFMB 3ZXDA 4FGFA 4USPA 2AQZA 1IOBA 21BIA 3ZC8A 3BB2A 4AN6A 4EB2B 2BFHA 3VSFA 5BVPI 2F8XC 3K1XA 3NBEA 3AKIA 3BAOA 3WO2A 1EPWA 2FDBM 3NJ5A 3ZC9A 2AFGA 3HALA 4G6MA 4ENDA 5JLVA 4JKQA 3BAHA 2Q9XA 2LIQA 5HPZA 5F8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HCD A;  4AN7 B;  4J2Y A;  3ZX7 A;  1YXW A;  3WMU A;  1DZC A;  3FJJ A;  1DFC A;  1W3F A;  3F62 B;  1AVU A;  31BI A;  1JT7 A;  4QAL A;  2MC2 A;  5BQU C;  2HWA A;  3BRG C;  4QO3 A;  2DS0 A;  3AKH A;  2M49 A;  4ZFW B;  1IRA X;  2ZQO A;  3CA6 A;  2IWT B;  5FZU A;  3VUO A;  2Z48 A;  1SR4 A;  1V6U A;  3VT0 A;  3TC2 A;  2D44 A;  4I4X A;  3N0K A;  3O4B A;  3VSZ A;  1NZK A;  2J3P A;  1WBC A;  3UDA A;  4I4Q A;  3NBC A;  1AVW B;  2P39 A;  3OGG A;  3FJK A;  3FUO A;  4X38 A;  3A23 A;  3RTI B;  1YBI A;  1PUM B;  1TIE A;  2MLL B;  3V0A B;  1P63 A;  3N7L A;  4GP3 A;  1G9D A;  1EV2 A;  1TWE A;  1S0B A;  2VSA A;  1S0D A;  3V0A A;  1SZ6 B;  1BLD A;  2ERM A;  2ZR1 B;  1FQ9 A;  5FZY A;  1ISZ A;  2WBC A;  2GO2 A;  2NVH A;  4OEF A;  1JY0 A;  1M2T B;  2VSE A;  3JRR A;  5D61 A;  1RY7 A;  4I4S A;  3BA4 A;  1JLX A;  3CA4 A;  3POK A;  3PG0 A;  3BA5 A;  1K5V A;  1YF8 B;  2HZ9 A;  1PUU B;  4I96 A;  3Q7Y A;  1DIW A;  3I2A A;  2F2F A;  3CRI A;  3CA5 A;  4USO A;  3FJF A;  3BA7 A;  3HMY A;  1PC8 B;  4I8M A;  2YUG A;  3BAU A;  2QN4 A;  1AFC A;  3E8L C;  3HSM A;  4G6J A;  4EEE B;  1Z2V A;  2D20 A;  4P0L A;  1V6W A;  4LO2 C;  1PWA A;  5BXR A;  5DVH A;  4IHZ A;  4P0K A;  3V0B A;  4J23 B;  4HA2 A;  4I6I A;  2FO1 A;  4ZFY B;  2RST A;  2P23 A;  4IY8 A;  4LO7 B;  4IZE A;  3T8S A;  4ZA3 B;  2K8R A;  2FFU A;  5F90 A;  3N7J A;  1PZZ A;  3UD8 A;  3VEQ A;  4QBV A;  4D0T A;  3AJ5 A;  4GP0 A;  2NTD A;  2Q3N B;  2X2S A;  3CA1 A;  3FJ9 A;  4LO0 C;  3QR5 A;  3IM6 A;  5EG6 C;  3H6Q A;  3AH2 A;  2R9K B;  1JT4 A;  1MC9 A;  2ET2 A;  4KEK A;  4LO3 A;  3R4U A;  4A7Y A;  3Q7X A;  1IJT A;  2QYI B;  1V6V A;  1S0E A;  1QQK A;  3LTQ A;  4OEG A;  3RTJ B;  1TTU A;  1JTC A;  1VCL A;  3O44 A;  3O5W B;  4KEJ A;  4WBC A;  3O4C A;  1W3A A;  4OEE A;  4IZX A;  4JP0 A;  4R6U B;  1BAS A;  1E0O A;  1II4 A;  3P6I A;  41BI A;  3CRG A;  5FNW A;  5EHA A;  4I4R A;  3BTA A;  8I1B A;  1ABR B;  3FJH A;  3QYD A;  4QC4 A;  3VT2 A;  1XYF A;  4X3A A;  6I1B A;  2Y9F A;  1T9F A;  5GAQ A;  2VXR A;  3FUQ A;  1SR4 C;  2K4A B;  5BOW A;  1DZD A;  1M16 A;  3FJB A;  1ISV A;  2D7I A;  2NM1 A;  4DCK C;  3LLP A;  4XFT A;  1XZZ A;  3CQA A;  5D62 A;  1S0F A;  3H6S E;  3AJ6 A;  5BP5 A;  1RML A;  5BXT A;  2I1B A;  2ZQN A;  1GGP B;  4QKS A;  3CA0 A;  4JRA A;  4DEN A;  1HWO B;  4F34 A;  4P6A A;  1JT5 A;  3P6J A;  3WA1 A;  2E4M A;  1DQO A;  2GZB A;  1A8D A;  3AH1 A;  3BRD A;  2D43 A;  1DLL A;  1G9A A;  4OUJ A;  1EVT A;  1WD4 A;  4HR6 C;  4ZLB B;  3UJ0 A;  1W3G A;  1ISY A;  1ISX A;  3MAL A;  4ION A;  5DUY A;  4QD2 C;  2BEB A;  2Z49 A;  1FN0 A;  3H6R B;  3HN1 A;  1S0C A;  3H6R A;  5F8W A;  3CA3 A;  3OJV A;  4LO1 A;  1KNM A;  2LIE A;  1IRP A;  1JT3 A;  3O4D A;  2F2F C;  1BAR A;  3AKF A;  4P0J A;  4OWJ A;  3HBW A;  4ZBV B;  4X39 A;  3BAD A;  3ZXG A;  3B9U A;  4GAF A;  5I1B A;  2AAI B;  4HJJ A;  1DQG A;  3FJA A;  3O4A A;  1ONK B;  2Y9X E;  3WMV A;  3D7W B;  4GOY A;  3FJI A;  4Q9G A;  3IAG C;  1CE7 B;  3JUT A;  3UD9 A;  4LO7 C;  3Q7W A;  1HCE A;  1FGA A;  1ITB A;  2BEA A;  4JPZ A;  3HOM A;  3I29 B;  3UJ4 A;  3FJD A;  4OWK A;  3BAV A;  4OWL A;  5DZU A;  3PME A;  3FGM A;  2NZ9 A;  2WRY A;  3IM5 A;  1XHB A;  1JLY A;  1MD6 A;  4TLP A;  1J0S A;  5BXP A;  4LO3 C;  4I0Y A;  3S8K A;  1AXM A;  4I3N A;  5E24 E;  2KKI A;  3N7K A;  3BRF A;  3A21 A;  1UPS A;  3CU1 B;  1S0L A;  2L5X A;  2MIB A;  3WO3 A;  1Q1U A;  4I4O A;  2RQ9 A;  1BLA A;  1NUN A;  1AVX B;  4I1E A;  3AH4 A;  1WBA A;  2D24 A;  3O3Q A;  4I4P A;  2VUA A;  1Z0H A;  1RZO B;  5F8S A;  7I1B A;  2KI6 B;  4GOV A;  3OBR A;  2D23 A;  4XFU A;  4ZKT B;  2FGF A;  1TWM A;  4H9W A;  5JMC A;  3VWC A;  3F1R A;  3A07 A;  3EF2 A;  2IHO A;  3AZW A;  4II0 A;  3WIN A;  4I4Y A;  3AZV A;  3RSJ A;  4CJM A;  4QKR A;  1G9C A;  2UUS A;  4L4H A;  5FNX A;  3IM7 A;  4IYB A;  1CVS A;  1L2H A;  5BP5 C;  4G9M A;  4EFP A;  3NBN A;  4LO8 B;  3BAQ A;  3OBT A;  4ISQ A;  3WO4 A;  4J2X A;  1XG6 A;  1R8N A;  4LO0 A;  4G9N A;  4A7K A;  4OW4 A;  3KMV A;  4ZOT A;  2D22 A;  1YYN A;  2E4M C;  3VT1 A;  4JAW A;  1YTO A;  4DEP A;  5DSS B;  1V6X A;  2D7R A;  1G9B A;  1IHK A;  5B2H A;  9ILB A;  5G00 A;  2DRZ A;  2VU9 A;  4KEI A;  5BXS A;  3R4S A;  3C9Z A;  1IIL A;  1WD3 A;  1T4Q A;  1FV2 A;  1G82 A;  1HWN B;  3CRH A;  3NBD A;  2KLL A;  1TOO A;  4LO1 C;  1FMZ A;  3IIR A;  3AKG A;  2X2T A;  1ISW A;  4G1R A;  1BFG A;  5D63 A;  2FFV A;  1ILR 1;  2RG9 B;  1BFF A;  3CAH A;  1Q04 A;  5BQU A;  3UD7 A;  4J2K A;  1HIB A;  1QXM A;  3PUB A;  1RG8 A;  3FJC A;  4KBB A;  3RMX A;  4Z9W B;  1FV3 A;  1S0G A;  1K5U A;  4I7I A;  3O4O A;  1TP0 A;  3FFZ A;  3PHZ A;  1Q03 A;  1QQL A;  3S8J A;  2NP0 A;  1F31 A;  4Q91 A;  3P53 A;  1I1E A;  1DJS B;  1Z4S A;  2HWM A;  2DRE A;  3V79 C;  4H04 A;  1JQZ A;  4JQ0 A;  4D0Z A;  1FWU A;  4Z8S B;  1N4K A;  4QD2 B;  2DRY A;  3OJ2 A;  1EYL A;  3O49 A;  2AXM A;  4X37 A;  1D0H A;  3BX1 C;  3OJM A;  1DFQ A;  4Q9P A;  4F83 A;  4I2S A;  4YOL A;  4KC3 A;  4IQP A;  1I1B A;  1BFC A;  1IT0 A;  3N7M A;  4L4I A;  1FWV A;  2D1Z A;  3ILA A;  2Y9W C;  3OGF A;  1AF9 A;  2K43 A;  1OQL B;  4D8H A;  3FJ8 A;  2XOA A;  2HW9 A;  4PC4 A;  2ESU A;  1R8O A;  1BA7 A;  1BFB A;  5FZZ A;  3V0B B;  2VXT I;  3BAG A;  3MPP G;  3RMY A;  4XFS A;  3A22 A;  4IY9 A;  4ISR A;  2NYY A;  4XKI A;  3WIN C;  4I4V A;  3FJE A;  4A7Z A;  4ZFU B;  1HWP B;  4JKX B;  1AVA C;  4LO2 A;  3I2X A;  1FMM S;  1HKN A;  2KI4 A;  4EFR A;  4EFQ A;  4QBC A;  2KH2 A;  4I1B A;  4J2S A;  1HWM B;  2Y9G A;  4I37 A;  2VLC A;  4GAI A;  3SNV A;  4ZGR B;  3W9T A;  4FVV A;  4I4U A;  5EC5 A;  4EKX B;  1TFM B;  3ZXD A;  4FGF A;  4USP A;  2AQZ A;  1IOB A;  21BI A;  3ZC8 A;  3BB2 A;  4AN6 A;  4EB2 B;  2BFH A;  3VSF A;  5BVP I;  2F8X C;  3K1X A;  3NBE A;  3AKI A;  3BAO A;  3WO2 A;  1EPW A;  2FDB M;  3NJ5 A;  3ZC9 A;  2AFG A;  3HAL A;  4G6M A;  4END A;  5JLV A;  4JKQ A;  3BAH A;  2Q9X A;  2LIQ A;  5HPZ A;  5F8Y A; 
#chains in the Genus database with same CATH topology
 1HCD A;  4AN7 B;  4J2Y A;  3ZX7 A;  1YXW A;  3WMU A;  1DZC A;  3FJJ A;  1DFC A;  1W3F A;  3F62 B;  1AVU A;  31BI A;  1JT7 A;  4QAL A;  2MC2 A;  5BQU C;  2HWA A;  3BRG C;  4QO3 A;  2DS0 A;  3AKH A;  2M49 A;  4ZFW B;  1IRA X;  2ZQO A;  3CA6 A;  2IWT B;  5FZU A;  3VUO A;  2Z48 A;  1SR4 A;  1V6U A;  3VT0 A;  3TC2 A;  2D44 A;  4I4X A;  3N0K A;  3O4B A;  3VSZ A;  1NZK A;  2J3P A;  1WBC A;  3UDA A;  4I4Q A;  3NBC A;  1AVW B;  2P39 A;  3OGG A;  3FJK A;  3FUO A;  4X38 A;  3A23 A;  3RTI B;  1YBI A;  1PUM B;  1TIE A;  2MLL B;  3V0A B;  1P63 A;  3N7L A;  4GP3 A;  1G9D A;  1EV2 A;  1TWE A;  1S0B A;  2VSA A;  1S0D A;  3V0A A;  1SZ6 B;  1BLD A;  2ERM A;  2ZR1 B;  1FQ9 A;  5FZY A;  1ISZ A;  2WBC A;  2GO2 A;  2NVH A;  4OEF A;  1JY0 A;  1M2T B;  2VSE A;  3JRR A;  5D61 A;  1RY7 A;  4I4S A;  3BA4 A;  1JLX A;  3CA4 A;  3POK A;  3PG0 A;  3BA5 A;  1K5V A;  1YF8 B;  2HZ9 A;  1PUU B;  4I96 A;  3Q7Y A;  1DIW A;  3I2A A;  2F2F A;  3CRI A;  3CA5 A;  4USO A;  3FJF A;  3BA7 A;  3HMY A;  1PC8 B;  4I8M A;  2YUG A;  3BAU A;  2QN4 A;  1AFC A;  3E8L C;  3HSM A;  4G6J A;  4EEE B;  1Z2V A;  2D20 A;  4P0L A;  1V6W A;  4LO2 C;  1PWA A;  5BXR A;  5DVH A;  4IHZ A;  4P0K A;  3V0B A;  4J23 B;  4HA2 A;  4I6I A;  2FO1 A;  4ZFY B;  2RST A;  2P23 A;  4IY8 A;  4LO7 B;  4IZE A;  3T8S A;  4ZA3 B;  2K8R A;  2FFU A;  5F90 A;  3N7J A;  1PZZ A;  3UD8 A;  3VEQ A;  4QBV A;  4D0T A;  4MZH A;  3AJ5 A;  4GP0 A;  2NTD A;  2Q3N B;  2X2S A;  3CA1 A;  3FJ9 A;  4LO0 C;  3QR5 A;  3IM6 A;  5EG6 C;  3H6Q A;  3AH2 A;  2R9K B;  1JT4 A;  1MC9 A;  2ET2 A;  4KEK A;  4LO3 A;  3R4U A;  4A7Y A;  3Q7X A;  1IJT A;  2QYI B;  1V6V A;  1S0E A;  1QQK A;  3LTQ A;  4OEG A;  3RTJ B;  1TTU A;  1JTC A;  1VCL A;  3O44 A;  3O5W B;  4KEJ A;  4WBC A;  3O4C A;  1W3A A;  4OEE A;  4IZX A;  4JP0 A;  4R6U B;  1BAS A;  1E0O A;  1II4 A;  3P6I A;  41BI A;  3CRG A;  5FNW A;  5EHA A;  4I4R A;  3BTA A;  8I1B A;  1ABR B;  3FJH A;  3QYD A;  4QC4 A;  3VT2 A;  1XYF A;  4X3A A;  6I1B A;  2Y9F A;  1T9F A;  5GAQ A;  2VXR A;  3FUQ A;  1SR4 C;  2K4A B;  4MZG B;  5BOW A;  1M16 A;  3FJB A;  1DZD A;  1ISV A;  2D7I A;  2NM1 A;  4DCK C;  3LLP A;  4XFT A;  1XZZ A;  3CQA A;  5D62 A;  1S0F A;  3H6S E;  3AJ6 A;  5BP5 A;  1RML A;  5BXT A;  2I1B A;  2ZQN A;  1GGP B;  4QKS A;  3CA0 A;  4JRA A;  4DEN A;  1HWO B;  4F34 A;  4P6A A;  1JT5 A;  3P6J A;  3WA1 A;  2E4M A;  1DQO A;  2GZB A;  1A8D A;  3AH1 A;  3BRD A;  2D43 A;  1DLL A;  1G9A A;  4OUJ A;  1EVT A;  1WD4 A;  4HR6 C;  4ZLB B;  3UJ0 A;  1W3G A;  1ISY A;  1ISX A;  3MAL A;  4ION A;  5DUY A;  4QD2 C;  2BEB A;  2Z49 A;  1FN0 A;  3H6R B;  3HN1 A;  1S0C A;  4UY4 A;  3H6R A;  5F8W A;  3CA3 A;  3OJV A;  4LO1 A;  1KNM A;  2LIE A;  1IRP A;  1JT3 A;  3O4D A;  2F2F C;  1BAR A;  3AKF A;  4P0J A;  4OWJ A;  3HBW A;  4ZBV B;  4X39 A;  3BAD A;  3ZXG A;  3B9U A;  4GAF A;  5I1B A;  2AAI B;  4HJJ A;  1DQG A;  3FJA A;  3O4A A;  1ONK B;  2Y9X E;  3WMV A;  3D7W B;  4GOY A;  3FJI A;  4Q9G A;  3IAG C;  1CE7 B;  3JUT A;  3UD9 A;  4H75 A;  4LO7 C;  3Q7W A;  1HCE A;  1FGA A;  1ITB A;  2BEA A;  4JPZ A;  3HOM A;  3I29 B;  3UJ4 A;  3FJD A;  4OWK A;  3BAV A;  2NS2 A;  4OWL A;  5DZU A;  3PME A;  3FGM A;  2NZ9 A;  2WRY A;  3IM5 A;  1XHB A;  1JLY A;  1MD6 A;  4TLP A;  1J0S A;  5BXP A;  4LO3 C;  4I0Y A;  3S8K A;  1AXM A;  4I3N A;  5E24 E;  2KKI A;  3N7K A;  3BRF A;  3A21 A;  1UPS A;  3CU1 B;  1S0L A;  2L5X A;  2MIB A;  3WO3 A;  1Q1U A;  4I4O A;  2RQ9 A;  1BLA A;  1NUN A;  1AVX B;  4I1E A;  3AH4 A;  1WBA A;  2D24 A;  3O3Q A;  4I4P A;  2VUA A;  1Z0H A;  1RZO B;  5F8S A;  7I1B A;  2KI6 B;  4GOV A;  3OBR A;  2D23 A;  4XFU A;  4ZKT B;  2FGF A;  1TWM A;  4H9W A;  5JMC A;  3VWC A;  3F1R A;  3A07 A;  3EF2 A;  2IHO A;  3AZW A;  4II0 A;  3WIN A;  4I4Y A;  3AZV A;  3RSJ A;  4CJM A;  4QKR A;  1G9C A;  2UUS A;  4L4H A;  5FNX A;  3IM7 A;  4IYB A;  1CVS A;  1L2H A;  5BP5 C;  4G9M A;  4EFP A;  3NBN A;  4LO8 B;  3BAQ A;  3OBT A;  4ISQ A;  3WO4 A;  4J2X A;  1XG6 A;  1R8N A;  4LO0 A;  4G9N A;  4A7K A;  4OW4 A;  3KMV A;  4ZOT A;  2D22 A;  1YYN A;  2E4M C;  3VT1 A;  4MZF B;  4JAW A;  1YTO A;  4DEP A;  5DSS B;  1V6X A;  2D7R A;  1G9B A;  1IHK A;  5B2H A;  9ILB A;  5G00 A;  2DRZ A;  2VU9 A;  4KEI A;  5BXS A;  3R4S A;  3C9Z A;  1IIL A;  1WD3 A;  1T4Q A;  1FV2 A;  1G82 A;  1HWN B;  3CRH A;  3NBD A;  2KLL A;  1TOO A;  4LO1 C;  1FMZ A;  3IIR A;  3AKG A;  2X2T A;  1ISW A;  4G1R A;  1BFG A;  5D63 A;  2FFV A;  1ILR 1;  2RG9 B;  1BFF A;  3CAH A;  1Q04 A;  5BQU A;  3UD7 A;  4J2K A;  1HIB A;  1QXM A;  3PUB A;  1RG8 A;  3FJC A;  4KBB A;  3RMX A;  4Z9W B;  1FV3 A;  1S0G A;  1K5U A;  4I7I A;  3O4O A;  1TP0 A;  3FFZ A;  3PHZ A;  1Q03 A;  1QQL A;  3S8J A;  2NP0 A;  1F31 A;  4Q91 A;  3P53 A;  1I1E A;  1DJS B;  1Z4S A;  2HWM A;  2DRE A;  3V79 C;  4H04 A;  1JQZ A;  4JQ0 A;  4D0Z A;  1FWU A;  4Z8S B;  1N4K A;  4QD2 B;  2DRY A;  3OJ2 A;  1EYL A;  3O49 A;  2AXM A;  4X37 A;  1D0H A;  3BX1 C;  3OJM A;  1DFQ A;  4Q9P A;  4F83 A;  4I2S A;  4YOL A;  4KC3 A;  4IQP A;  1I1B A;  1BFC A;  1IT0 A;  3N7M A;  4L4I A;  1FWV A;  2D1Z A;  3ILA A;  2Y9W C;  3OGF A;  1AF9 A;  2K43 A;  1OQL B;  4D8H A;  3FJ8 A;  2XOA A;  2HW9 A;  4PC4 A;  2ESU A;  1R8O A;  1BA7 A;  1BFB A;  5FZZ A;  3V0B B;  2VXT I;  3BAG A;  3MPP G;  3RMY A;  4XFS A;  3A22 A;  4IY9 A;  4ISR A;  2NYY A;  4XKI A;  3WIN C;  4I4V A;  3FJE A;  4A7Z A;  4ZFU B;  1HWP B;  4JKX B;  1AVA C;  4LO2 A;  3I2X A;  1FMM S;  1HKN A;  2KI4 A;  4EFR A;  4EFQ A;  4QBC A;  2KH2 A;  4I1B A;  4J2S A;  1HWM B;  2Y9G A;  4I37 A;  2VLC A;  4GAI A;  3SNV A;  4ZGR B;  3W9T A;  4FVV A;  4I4U A;  5EC5 A;  4EKX B;  1TFM B;  3ZXD A;  4FGF A;  4USP A;  2AQZ A;  1IOB A;  21BI A;  3ZC8 A;  3BB2 A;  4AN6 A;  4EB2 B;  2BFH A;  3VSF A;  5BVP I;  2F8X C;  3K1X A;  3NBE A;  3AKI A;  3BAO A;  3WO2 A;  1EPW A;  2FDB M;  3NJ5 A;  3ZC9 A;  2AFG A;  3HAL A;  4G6M A;  4END A;  5JLV A;  4JKQ A;  3BAH A;  2Q9X A;  2LIQ A;  5HPZ A;  5F8Y A; 
#chains in the Genus database with same CATH homology
 1HCD A;  4AN7 B;  4J2Y A;  3ZX7 A;  1YXW A;  3WMU A;  1DZC A;  3FJJ A;  1DFC A;  1W3F A;  3F62 B;  1AVU A;  31BI A;  1JT7 A;  4QAL A;  2MC2 A;  5BQU C;  2HWA A;  3BRG C;  4QO3 A;  2DS0 A;  3AKH A;  2M49 A;  4ZFW B;  1IRA X;  2ZQO A;  3CA6 A;  2IWT B;  5FZU A;  3VUO A;  2Z48 A;  1SR4 A;  1V6U A;  3VT0 A;  3TC2 A;  2D44 A;  4I4X A;  3N0K A;  3O4B A;  3VSZ A;  1NZK A;  2J3P A;  1WBC A;  3UDA A;  4I4Q A;  3NBC A;  1AVW B;  2P39 A;  3OGG A;  3FJK A;  3FUO A;  4X38 A;  3A23 A;  3RTI B;  1YBI A;  1PUM B;  1TIE A;  2MLL B;  3V0A B;  1P63 A;  3N7L A;  4GP3 A;  1G9D A;  1EV2 A;  1TWE A;  1S0B A;  2VSA A;  1S0D A;  3V0A A;  1SZ6 B;  1BLD A;  2ERM A;  2ZR1 B;  1FQ9 A;  5FZY A;  1ISZ A;  2WBC A;  2GO2 A;  2NVH A;  4OEF A;  1JY0 A;  1M2T B;  2VSE A;  3JRR A;  5D61 A;  1RY7 A;  4I4S A;  3BA4 A;  1JLX A;  3CA4 A;  3POK A;  3PG0 A;  3BA5 A;  1K5V A;  1YF8 B;  2HZ9 A;  1PUU B;  4I96 A;  3Q7Y A;  1DIW A;  3I2A A;  2F2F A;  3CRI A;  3CA5 A;  4USO A;  3FJF A;  3BA7 A;  3HMY A;  1PC8 B;  4I8M A;  2YUG A;  3BAU A;  2QN4 A;  1AFC A;  3E8L C;  3HSM A;  4G6J A;  4EEE B;  1Z2V A;  2D20 A;  4P0L A;  1V6W A;  4LO2 C;  1PWA A;  5BXR A;  5DVH A;  4IHZ A;  4P0K A;  3V0B A;  4J23 B;  4HA2 A;  4I6I A;  2FO1 A;  4ZFY B;  2RST A;  2P23 A;  4IY8 A;  4LO7 B;  4IZE A;  3T8S A;  4ZA3 B;  2K8R A;  2FFU A;  5F90 A;  3N7J A;  1PZZ A;  3UD8 A;  3VEQ A;  4QBV A;  4D0T A;  4MZH A;  3AJ5 A;  4GP0 A;  2NTD A;  2Q3N B;  2X2S A;  3CA1 A;  3FJ9 A;  4LO0 C;  3QR5 A;  3IM6 A;  5EG6 C;  3H6Q A;  3AH2 A;  2R9K B;  1JT4 A;  1MC9 A;  2ET2 A;  4KEK A;  4LO3 A;  3R4U A;  4A7Y A;  3Q7X A;  1IJT A;  2QYI B;  1V6V A;  1S0E A;  1QQK A;  3LTQ A;  4OEG A;  3RTJ B;  1TTU A;  1JTC A;  1VCL A;  3O44 A;  3O5W B;  4KEJ A;  4WBC A;  3O4C A;  1W3A A;  4OEE A;  4IZX A;  4JP0 A;  4R6U B;  1BAS A;  1E0O A;  1II4 A;  3P6I A;  41BI A;  3CRG A;  5FNW A;  5EHA A;  4I4R A;  3BTA A;  8I1B A;  1ABR B;  3FJH A;  3QYD A;  4QC4 A;  3VT2 A;  1XYF A;  4X3A A;  6I1B A;  2Y9F A;  1T9F A;  5GAQ A;  2VXR A;  3FUQ A;  1SR4 C;  2K4A B;  4MZG B;  5BOW A;  1M16 A;  3FJB A;  1DZD A;  1ISV A;  2D7I A;  2NM1 A;  4DCK C;  3LLP A;  4XFT A;  1XZZ A;  3CQA A;  5D62 A;  1S0F A;  3H6S E;  3AJ6 A;  5BP5 A;  1RML A;  5BXT A;  2I1B A;  2ZQN A;  1GGP B;  4QKS A;  3CA0 A;  4JRA A;  4DEN A;  1HWO B;  4F34 A;  4P6A A;  1JT5 A;  3P6J A;  3WA1 A;  2E4M A;  1DQO A;  2GZB A;  1A8D A;  3AH1 A;  3BRD A;  2D43 A;  1DLL A;  1G9A A;  4OUJ A;  1EVT A;  1WD4 A;  4HR6 C;  4ZLB B;  3UJ0 A;  1W3G A;  1ISY A;  1ISX A;  3MAL A;  4ION A;  5DUY A;  4QD2 C;  2BEB A;  2Z49 A;  1FN0 A;  3H6R B;  3HN1 A;  1S0C A;  4UY4 A;  3H6R A;  5F8W A;  3CA3 A;  3OJV A;  4LO1 A;  1KNM A;  2LIE A;  1IRP A;  1JT3 A;  3O4D A;  2F2F C;  1BAR A;  3AKF A;  4P0J A;  4OWJ A;  3HBW A;  4ZBV B;  4X39 A;  3BAD A;  3ZXG A;  3B9U A;  4GAF A;  5I1B A;  2AAI B;  4HJJ A;  1DQG A;  3FJA A;  3O4A A;  1ONK B;  2Y9X E;  3WMV A;  3D7W B;  4GOY A;  3FJI A;  4Q9G A;  3IAG C;  1CE7 B;  3JUT A;  3UD9 A;  4H75 A;  4LO7 C;  3Q7W A;  1HCE A;  1FGA A;  1ITB A;  2BEA A;  4JPZ A;  3HOM A;  3I29 B;  3UJ4 A;  3FJD A;  4OWK A;  3BAV A;  2NS2 A;  4OWL A;  5DZU A;  3PME A;  3FGM A;  2NZ9 A;  2WRY A;  3IM5 A;  1XHB A;  1JLY A;  1MD6 A;  4TLP A;  1J0S A;  5BXP A;  4LO3 C;  4I0Y A;  3S8K A;  1AXM A;  4I3N A;  5E24 E;  2KKI A;  3N7K A;  3BRF A;  3A21 A;  1UPS A;  3CU1 B;  1S0L A;  2L5X A;  2MIB A;  3WO3 A;  1Q1U A;  4I4O A;  2RQ9 A;  1BLA A;  1NUN A;  1AVX B;  4I1E A;  3AH4 A;  1WBA A;  2D24 A;  3O3Q A;  4I4P A;  2VUA A;  1Z0H A;  1RZO B;  5F8S A;  7I1B A;  2KI6 B;  4GOV A;  3OBR A;  2D23 A;  4XFU A;  4ZKT B;  2FGF A;  1TWM A;  4H9W A;  5JMC A;  3VWC A;  3F1R A;  3A07 A;  3EF2 A;  2IHO A;  3AZW A;  4II0 A;  3WIN A;  4I4Y A;  3AZV A;  3RSJ A;  4CJM A;  4QKR A;  1G9C A;  2UUS A;  4L4H A;  5FNX A;  3IM7 A;  4IYB A;  1CVS A;  1L2H A;  5BP5 C;  4G9M A;  4EFP A;  3NBN A;  4LO8 B;  3BAQ A;  3OBT A;  4ISQ A;  3WO4 A;  4J2X A;  1XG6 A;  1R8N A;  4LO0 A;  4G9N A;  4A7K A;  4OW4 A;  3KMV A;  4ZOT A;  2D22 A;  1YYN A;  2E4M C;  3VT1 A;  4MZF B;  4JAW A;  1YTO A;  4DEP A;  5DSS B;  1V6X A;  2D7R A;  1G9B A;  1IHK A;  5B2H A;  9ILB A;  5G00 A;  2DRZ A;  2VU9 A;  4KEI A;  5BXS A;  3R4S A;  3C9Z A;  1IIL A;  1WD3 A;  1T4Q A;  1FV2 A;  1G82 A;  1HWN B;  3CRH A;  3NBD A;  2KLL A;  1TOO A;  4LO1 C;  1FMZ A;  3IIR A;  3AKG A;  2X2T A;  1ISW A;  4G1R A;  1BFG A;  5D63 A;  2FFV A;  1ILR 1;  2RG9 B;  1BFF A;  3CAH A;  1Q04 A;  5BQU A;  3UD7 A;  4J2K A;  1HIB A;  1QXM A;  3PUB A;  1RG8 A;  3FJC A;  4KBB A;  3RMX A;  4Z9W B;  1FV3 A;  1S0G A;  1K5U A;  4I7I A;  3O4O A;  1TP0 A;  3FFZ A;  3PHZ A;  1Q03 A;  1QQL A;  3S8J A;  2NP0 A;  1F31 A;  4Q91 A;  3P53 A;  1I1E A;  1DJS B;  1Z4S A;  2HWM A;  2DRE A;  3V79 C;  4H04 A;  1JQZ A;  4JQ0 A;  4D0Z A;  1FWU A;  4Z8S B;  1N4K A;  4QD2 B;  2DRY A;  3OJ2 A;  1EYL A;  3O49 A;  2AXM A;  4X37 A;  1D0H A;  3BX1 C;  3OJM A;  1DFQ A;  4Q9P A;  4F83 A;  4I2S A;  4YOL A;  4KC3 A;  4IQP A;  1I1B A;  1BFC A;  1IT0 A;  3N7M A;  4L4I A;  1FWV A;  2D1Z A;  3ILA A;  2Y9W C;  3OGF A;  1AF9 A;  2K43 A;  1OQL B;  4D8H A;  3FJ8 A;  2XOA A;  2HW9 A;  4PC4 A;  2ESU A;  1R8O A;  1BA7 A;  1BFB A;  5FZZ A;  3V0B B;  2VXT I;  3BAG A;  3MPP G;  3RMY A;  4XFS A;  3A22 A;  4IY9 A;  4ISR A;  2NYY A;  4XKI A;  3WIN C;  4I4V A;  3FJE A;  4A7Z A;  4ZFU B;  1HWP B;  4JKX B;  1AVA C;  4LO2 A;  3I2X A;  1FMM S;  1HKN A;  2KI4 A;  4EFR A;  4EFQ A;  4QBC A;  2KH2 A;  4I1B A;  4J2S A;  1HWM B;  2Y9G A;  4I37 A;  2VLC A;  4GAI A;  3SNV A;  4ZGR B;  3W9T A;  4FVV A;  4I4U A;  5EC5 A;  4EKX B;  1TFM B;  3ZXD A;  4FGF A;  4USP A;  2AQZ A;  1IOB A;  21BI A;  3ZC8 A;  3BB2 A;  4AN6 A;  4EB2 B;  2BFH A;  3VSF A;  5BVP I;  2F8X C;  3K1X A;  3NBE A;  3AKI A;  3BAO A;  3WO2 A;  1EPW A;  2FDB M;  3NJ5 A;  3ZC9 A;  2AFG A;  3HAL A;  4G6M A;  4END A;  5JLV A;  4JKQ A;  3BAH A;  2Q9X A;  2LIQ A;  5HPZ A;  5F8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...