1SRJA

Structure-based design of synthetic azobenzene ligands for streptavidin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
121
structure length
118
Chain Sequence
AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPASGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title Structure-Based Design of Synthetic Azobenzene Ligands for Streptavidin
pubmed rcsb
source organism Streptomyces avidinii
molecule tags Biotin-binding protein
total genus 25
structure length 118
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1srjA00
1SWUA 2IZKA 4U46A 2OF9A 1VWIB 3WYPA 1VWEB 2JGSA 3EW2A 1LCZA 4BX7B 2F01A 2RTFB 3RDOA 1SLDB 1VWAB 1N9YA 1SWJA 2IZEB 1LELA 1VWGB 3RDQA 4Y59A 1VWQB 1SRFA 1NC9A 1VWMB 1SLFB 2IZLB 2ZSCA 4Z2VA 1RXJA 3RDSA 4CPIA 2RTIB 1VWJB 4Z27A 5F2BA 4Y5DA 1SRGA 2MF6A 2IZAA 5CSEA 5IRAA 4CPEA 1SWDA 2IZHB 2CAMA 3SZHA 3T2XA 1LCVA 1SWGA 1STPA 1SWNA 1VWCB 2RTRB 1LDOA 1SLEB 4GD9A 4BJ8A 4BX6B 1SWKA 2A8GA 2RTKA 1SREA 4CPHA 2FHLA 1SWEA 1KL4A 4I60A 3WZNA 1DF8A 1NBXA 4BBOA 4Z28A 4BCSA 3VHMA 1WBIA 3RDMA 4DNEA 1VWKB 3T6LA 1AVEA 4GJSA 1VWOB 3VHIA 4BX5B 2RTQB 1N9MA 2RTLA 2RTJA 1RAVA 1SRJA 2A5CA 1STSB 3PK2A 4JO6A 1PTSA 3RDXA 1LUQA 4BX7A 4IRWA 5K67A 2RTOB 2QCBA 3WZOA 1Y52X 2Y3EA 1MK5A 1SWHA 4GJVA 5L3YA 2RTCB 5IRUA 2FHNX 2IZCB 3RY1A 1VWPB 2IZBA 3RDUA 1HY2A 4OKAA 1SLGB 2GH7A 1NDJA 1HXLA 2OFBA 1SWQA 1VYOA 1KL5A 1NQNA 1KL3A 2RTHB 4YVBA 1KFFA 1SWBA 2BC3A 4GGZA 5JD2A 3X00A 1N4JA 2IZDB 1Y53X 4GGTA 4GDAA 3RY2A 3FDCA 4JHQA 1MEPA 3VHHA 1SWFA 2C4IA 2C1QA 1I9HA 2RTEB 3RE5A 1MM9A 1STRB 1IJ8A 4BX6A 4Z2PA 1RXHA 3WZQA 1VWRB 4CPFA 2C1SA 1RSUB 2UYWA 3WYQA 3RE6A 1RXKA 4BX5A 1NQMA 1SWOA 2RTMA 1SWLA 3MG5A 4JNJA 1LCWA 5B5FA 1SWTA 1VWHB 2AVIA 1SWRA 4Z6JA 2RTGB 2IZJA 1VWFB 5B5GA 5K68A 1Y55X 2IZIA 4Z2OA 2IZFB 5IRWA 2IZGB 2RTNB 1HXZA 1LDQA 1SRIA 3WZPA 1HQQA 2RTAA 1SRHA 1SWPA 2A5BA 2RTPB 3MM0A 3VGWA 5CHKA 4EKVA 1N7YA 1MOYA 4GGRA 2OF8A 3T6FA 1SWAA 1VWLB 1VWDB 2Y3FA 4CPHB 3EW1A 1SWSA 3SZJA 1N43A 1SWCA 1VWNB 2OFAA 2G5LA 2UZ2A 2RTBB 3T2WA 2RTDB 1AVDA 2Y32A 2WPUA 1VWBB 3SZIA 1RSTB
chains in the Genus database with same CATH superfamily
4MIRA 1OBUA 2IZKA 3FELA 1I06A 1UREA 3CBSA 1ZNGA 1GM6A 3UEXA 5L8NA 1S2PA 1VWEB 2JGSA 3KFGA 3EW2A 1LCZA 1ERBA 4I9RA 2RTFB 4XMHA 2JMBA 3RDOA 1VWAB 5EDCA 1N9YA 1I78A 2IZEB 4B55A 3NQ3A 4OS0A 5D45A 5L8IA 1SRFA 3ELXA 3PDFA 4QZUA 5IO6A 1LPJA 4Z2VA 1GT5A 4LKTA 1Y0GA 1TVQA 2WSJA 2I5VO 2MHDA 5AJBA 5EEEA 4A1HA 5KICA 3FYFA 2JU7A 4FGIB 5LJKA 4AYHA 2MF6A 2BHVA 1ZNHA 1FTPA 5EPQA 1SWDA 4A8ZA 2ACPX 1UYOX 5LKEA 1QQSA 1IKJA 2AT8X 4FQBB 2RTRB 4GKCA 3ZW0B 2X32A 2ZAGA 4KCAA 2AT3X 2CZTA 2FT9A 1KL4A 5LJEA 5LJCA 4BBOA 3RDMA 4BGFA 4OMWA 3C77X 4BX5B 2G7BA 1AQBA 3HOEA 5FQ7E 1ZNEA 2OY8A 2RTLA 5KHPA 4ZH9A 1SRJA 4ZCBA 3PK2A 4L3RA 5AEOA 3FEPA 2IFBA 3BLGA 5JR8A 2JOZA 2GTLO 4YKMA 2FR2A 3WJEA 4IRWA 4IMNA 1R0UA 5K67A 2A3FX 2FKJA 4CDDA 5CE4A 2WR6A 5B27A 1KGLA 5LJGA 2LA7A 1MK5A 2OY5O 1SWHA 3DSZA 4GJVA 4TJZA 3B2JA 5K06A 1FELA 1X8UA 1BSOA 2IZBA 3AKNA 4ZGFA 1NDJA 2DJGA 2BS6A 4O3ZA 5CYBA 1S44A 2VFCA 5JD2A 4AZOA 4HPBA 3I0AA 1CBIA 1QG5A 4Y0RA 2AKQA 4GGTA 3B2IA 4GDZA 4JHQA 4O3XB 3E3CA 3RWXA 2WWPA 3SZIA 1IFBA 2ASNX 2OL7A 1SA8A 1X8NA 1HBPA 2RD7C 1KT6A 2K23A 4I3DA 3FIQA 4YBPA 2HZQA 1AELA 3ZW2A 3H3IA 5HA0A 3VE1A 3KFHA 3UEVA 3WZQA 1KQXA 1G74A 1Y9TA 4OEMA 2EU7X 2VDFA 2X8SA 1N0SA 2HMBA 3KZAA 3WJCA 4MVIA 1YWAA 5HBSA 3OD9A 4LQZA 1TW4A 1CBQA 3CR6A 4TKBA 1EALA 1LF7A 1X8OA 2X45A 5HZ9A 3WJFA 2AF5A 1E5PA 5B5GA 4M6SA 2Q39A 5K68A 3F9DA 4Z2OA 3TZSA 1CBSA 3PH6A 5DPQA 3PP6A 1G5WA 4NV8A 1U18A 3CBCA 1IFCA 4TQ2A 1EXSA 1XKIA 2RTAA 1LIDA 2ZAIA 3BDRA 2BSZA 2RA6A 2QMIA 2RTPB 3F8AA 2KTDA 3BS2A 3MM0A 3STKA 3ZW0A 1GT4A 4OS8A 4ARHA 4EKVA 4QGVA 5HCCC 4HFOA 4EQAC 1VWDB 1MUPA 1WUBA 2Y3FA 3KVNA 4GU8A 4Y0PA 3VG5A 4IB9A 1P6PA 3SZJA 2OFAA 1YP6A 2JU8A 1X8PA 2WEWA 3EBKA 1YUPA 2VFBA 3FW5A 2Q2MA 4GUZA 3T2WA 3UAQA 3N91A 1FEMA 1I4UA 1T68X 5HWZA 1RSTB 1SWUA 4UU3A 3U0DA 1LKEA 1SY3A 2F73A 4ODDA 3IFBA 2F01A 2FR3A 1GX9A 3RY1A 1A18A 1SWJA 1ZNLA 1PBOA 2AL0X 4ORXA 4U8UN 1EIOA 2GTFX 2X8TA 5BVQA 3TGBA 1ZNKA 4CPIA 4MISA 3GE2A 1HMTA 1Y9LA 1OSPO 2RTIB 4HPAA 4KC7A 1XCAA 2BLGA 5F2BA 1YP7A 4ORYA 1BEBA 3C76X 4NLIA 4ON1A 1DFVA 3PQUA 4ZHGA 2IZHB 1DZKA 1JZUA 1E00A 3AEHA 2OL8O 5B3MO 3SZHA 3T2XA 4YGGA 2N93A 3SOTA 1DZPA 2POAA 1VWCB 2XKLA 2LB6A 1ADLA 3FA8A 2HYSA 1HMSA 1SWKA 3P6DA 5H9LA 3FEKA 1SWEA 4Y0SA 5FQ8E 5BVSA 4YBUA 4EDEA 4YGZA 4Z28A 4ML7B 3VHMA 4BCSA 4DNEA 2KW1A 2R74A 3RKGA 5DG4A 3T6LA 1AVEA 3VHIA 5FENA 4NV7A 4ZHCA 1N9MA 2OYBO 2NNEA 1LFOA 4LKPA 4JO6A 1PTSA 2OFMX 1EI5A 2X8FA 4YFQA 4ORRA 3ZI8A 3KFFA 1QFTA 3AKMA 5LJDA 3WVMA 3NX2A 2E4JA 1OBPA 2Q2PA 5HZ5A 2QCBA 5FQ6E 3ZUOA 4I3BA 1G85A 2Y3EA 5H9AA 4O4UA 5L3YA 1PBYA 5IRUA 2FHNX 4AZMA 1GT1A 1PEEA 4OKAA 2JU3A 3JQOA 2OFBA 2RTHB 1SMPI 1W4TA 1GX8A 4FBOA 3S26A 5BVTA 2CBSA 1KFFA 1SWBA 2BC3A 4GGZA 3Q34A 4MVKA 1GX3A 1HQPA 4NLJA 3CKGA 4ZH6A 3STMX 3HPEA 2L9CA 2PY1A 2FKGA 1BRPA 5KIDA 1U17A 3EM0A 1YWCA 1MEPA 1JYJA 1SWFA 3VG4A 2C4IA 2QM9A 2MJIA 4MVEA 4NYQA 1U0XA 1MM9A 1CBRA 1T8VA 1IJ8A 3QKGA 4AZPA 4D6BA 3BX7A 3NX1A 1KZXA 4COTA 2CM4A 4BOEA 3CQRA 1VWRB 2ALLX 1YWBA 2K62A 1LIEA 2C1SA 3K3LA 2G79A 3NR3A 1JV4A 3P6GA 1EPAA 2RCTA 4QAEA 3WYQA 1RXKA 4GNYA 1TOWA 2OVSA 4BVMA 2RTMA 3MG5A 1SWLA 5LJBA 1SXUA 4BQUA 3ZQ3A 1VWHB 4QGWA 1JQPA 4UU2A 1SWRA 4Z6JA 2GJ5A 4ES7A 4RUNA 1VYGA 3D9WA 1UZ2X 1Y55X 2A13A 3FIDA 1G7NA 2KD2A 2BS5A 2WQ9A 3FA7A 2IZFB 1OBQA 4IAXA 2RN4A 1B8EA 3D96A 2IZGB 3D97A 2CM9A 4GK9A 4TNNA 5B11O 5F6ZA 1W5RA 3WZPA 1HQQA 3P6CA 1SRHA 3JS1A 2LBAA 1SWPA 1SXYA 2A5BA 4WFUA 1EUOA 1QWDA 3VGWA 3O2YA 4GGRA 3VPJE 2OVEA 3T6FA 5HZ6A 3P02A 1A2DA 2QO4A 1VWLB 2FGSA 3MVFA 1BSQA 4YCHA 1HN2A 4LZUA 1BLRA 2UZ2A 2CZUA 3OBLA 2G5LA 2O62A 4LZVA 3UEWA 4D6AA 3BU9A 3QQ2A 1JMZA 2CBRA 4BX6A 2DJFA 3FR4A 5HA1A 2GTLN 2LBVA 3VE2A 4I3CA 3LTWA 1QY1A 1X8QA 3B2KA 3NPOA 4U46A 2LFOA 2FLJA 4QZTA 1B4MA 5FFHA 1DZJA 1OEJA 1IIUA 1VWIB 4FBVA 1SY2A 4KH8A 4RUUA 5F1EA 3CWKA 1KT5A 5D48A 4DCBA 2HZRA 4QGXA 1KT4A 2PI3O 4O4XA 1A3YA 1ZNDA 1VWGB 3HOLA 3TF6A 3RDQA 4A1YA 2F09A 5H9NA 1SLFB 4N7CA 1YIVA 4U9CA 2IZLB 1EPBA 2ZSCA 1BM5A 3OJYC 5D8JA 3WJGA 4I6SA 1B0OA 4GNWA 2AT6X 4L1NA 1PM1X 5HCEC 3L4RA 1BSYA 4IB6A 4Y5DA 5CSEA 2IZAA 3FW4A 5HAEA 4CPEA 2KTSA 1OPAA 2CAMA 1SY1A 4OMXA 1SWGA 1SWNA 4O3WA 1O1VA 1LDOA 1AVGI 4BJ8A 1O8VA 2A8GA 2RTKA 4CPHA 3WBGA 1X71A 4I60A 1EQDA 5H9KA 1T0VA 4MVLA 3VG3A 3WZNA 1DF8A 3ZW1B 1JYDA 4HPDA 4ID2A 1WBIA 3HWEA 2FWVA 4DQ3A 1VWKB 1MVGA 2ACOA 3VG7A 2W2FA 4GJSA 4YMYA 3P6HA 1D2UA 2RTJA 1BRQA 2A5CA 4PJ2A 1STSB 2L68A 2WEXA 4NNSA 3T1DA 3VG6A 4INNA 3RZYA 2Q4NA 3CKFA 1LUQA 4YDBA 4BX7A 1ICNA 2L5PA 4ZR2A 3HWFA 1AB0A 4IB8A 3EC5A 5IXGA 3DTQA 1GT3A 4ALBA 2L67A 3PECA 1E2TA 2MWHA 2RTCB 1DZMA 4N7DA 1HY2A 1GGLA 3U9PC 4GZVA 2GH7A 1HXLA 1I05A 1GKAA 3JSQA 1VYOA 1KL3A 4AZQA 3BRNA 4YVBA 1E02A 2FTBA 4CDFA 3X00A 4XMDA 1N4JA 1QY2A 3WJBA 4GDAA 3SLTA 3RY2A 2QO5A 5HZQA 4CSBA 5EDBA 2JN3A 4EEJA 2AT5X 3VHHA 2YMSA 2RTEB 2C1QA 1I9HA 1KT3A 4PSQA 3RE5A 3D4RA 3FMZA 2HNXA 4U3QA 2WQAE 3P6FA 5F6BA 1DC9A 2WUTA 3CQNA 5F58A 2M4LA 4AW8A 1L6MA 1JIWI 1BJ7A 1HMRA 1SXXA 1KT7A 4CPFA 4XMEA 3U03A 5B29A 1X89A 1RSUB 2NNDA 4I9SA 2Z4HA 5LJHA 1K3BA 3G7XA 3RE6A 4QYNA 1NQMA 3OE3A 3P6EA 3NBXX 5B5FA 1LCWA 1MDCA 2G8CO 2ANSA 2OL6O 3APXA 2RTGB 2IZJA 3LHNA 3P24A 1FENA 5EZ2A 3PPTA 4C5PA 2GC9A 4GE1A 1QY0A 1VWFB 4JGLA 2NP1A 1LNMA 2IZIA 4MEEA 3SAOA 1JMXA 2KT4B 1DV9A 1IW2A 4TKJA 4GH7A 4WHIA 4AZNA 1ACDA 3BU1A 4ZHFA 4YDAA 1SRIA 1LDQA 3EYCA 3ZW1A 1QABE 2X4MA 3TGAA 1BBPA 3WJDA 1Z24A 4ORSA 3AUMO 5L8OA 4QQ1A 2FS6A 5CHKA 4CDEA 1N7YA 4O9SA 3APWA 1RBPA 5C0NA 1SWAA 5HTEA 3HK1A 3CMPA 1FDQA 1KXOA 1EW3A 1ALBA 1ML7A 2R56A 3B2LA 3O22A 4CPHB 2W2BA 1N43A 1SWCA 4IBAA 3D95A 3NP1A 2W2AA 2RTBB 4KC8A 3O19A 5IO5A 4KT5A 1A57A 4HWMA 2WPUA 1VWBB 3F6ZB 5AQ6A 2R73A 4XMFA 3RSWA 1BWYA 1JJXA 2OF9A 3WYPA 4R0BA 3HWGA 4BX7B 5HZ8A 3NADA 1SLDB 4ORUA 2OZQA 3APUA 3WXQA 2OY7A 3HTYA 1LELA 4O4OA 2YG2A 4Y59A 2X34A 4K19A 1VWQB 4QRLA 5D47A 1NC9A 1VWMB 2MM3A 1LICA 4EXZA 4GRJA 2A0AA 3FLLA 1RXJA 1LIBA 3BY0A 3RDSA 4A60A 1GKAB 3EMMA 4YCEA 1VWJB 3FENA 4Z27A 2BT9A 2X55A 2G78A 1GXAA 3SLOA 1SRGA 3ZUIA 5IRAA 3EBWA 3KQ0A 3WOVA 2HKDA 2RQ0A 1KQWA 5IO7A 4ZFXA 3LV4A 2Q9SA 1S7DA 2HLVA 1JJJA 1LCVA 1STPA 5B10O 1NP4A 4GD9A 1SLEB 4BX6B 4O49A 1E06A 1CJ5A 1KOIA 1SREA 2FHLA 2OVAA 2QOMA 3B2HA 3FR2A 1NBXA 3FR5A 2QO6A 1B56A 5F7GA 2NNQA 3S5XA 1VWOB 3ELZA 5FAZA 2RTQB 5IRWA 1RAVA 3ZZVA 1CRBA 1FE3A 1H91A 5LKFA 3SLJA 3C78X 3IA8A 2P8GA 2OY1O 4OS3A 4EFGA 4FBRA 3NQ9A 2OVDA 3BX8A 4QNIA 4IAWA 3PEDA 2RTOB 3GAQA 1ICMA 4NNTA 3WZOA 1Y52X 1HBQA 1OEKA 1JBHA 2LKKA 4ZHHA 4QYPA 1YWDA 4IMOA 2IZCB 1FJ1E 1VWPB 2X46A 4YH0A 4IB7A 2OFRX 2GTLM 1SLGB 4NW4A 4U8UO 3RDUA 3RDXA 1SWQA 3FA9A 1KL5A 1NQNA 2FS7A 1DF3A 1KZWA 1MX8A 2XSTA 4HPCA 1SY0A 4WFVA 2IZDB 1Y53X 4O4SA 4YGHA 4AZRA 3RBYA 3FDCA 4ZGUA 5AJCA 1OEEA 1TOUA 2X56A 1STRB 3MBTA 3PQSA 4KIIA 3APVA 2AH7X 4TKHA 5HCDC 4Z2PA 1VYFA 1RXHA 2FRSA 4Y0QA 1SXWA 1NP1A 2JW1A 2DM5A 4M7MA 2UYWA 4WBKA 4ZHDA 4I95A 3S60A 4NP1A 4BX5A 1MX7A 1SWOA 1O1UA 1TXLA 1LIFA 2QOSC 2Z4IA 3V8UA 4JNJA 1RLBE 1SWTA 1ZRYA 3STNA 2AVIA 4NYRA 3MX7A 5H8TA 3VG2A 2A2GA 1UYNX 4CV7A 3HWDA 3NQKA 1D3SA 3S5VA 4O3YA 4DQ4A 1OPBA 2RCQA 2RTNB 1IKEA 1K24A 5B2AO 1HXZA 4IABA 4ZJ0A 4YFRA 1I04A 4GETA 3ZWEA 3Q6LA 4U8UM 4CK4A 3BSZE 2A2UA 2I5ZO 5BYPA 1MOYA 2AMMX 4YKOA 1JJUA 2OF8A 3KFIA 3PH5A 5D4AA 1ERXA 4XMCA 5HTDA 1NGLA 4CDCA 3I17A 1PMPA 1QFVA 1SWSA 2AT0X 3EW1A 5EEDA 1VWNB 3UEUA 4YFPA 4ALOA 4ORWA 2RTDB 4TLJA 3TGCA 1AVDA 2Y32A 1VPRA 1EIIA 4OELA 2MO5A 3VU1A 4XMGA 1W6FA 3FA6A
chains in the Genus database with same CATH topology
1SWUA 2IZKA 4U46A 2OF9A 1VWIB 3WYPA 1VWEB 2JGSA 3EW2A 1LCZA 4BX7B 2F01A 2RTFB 3RDOA 1SLDB 1VWAB 1N9YA 1SWJA 2IZEB 1LELA 1VWGB 3RDQA 4Y59A 1VWQB 1SRFA 1NC9A 1VWMB 1SLFB 2IZLB 2ZSCA 4Z2VA 1RXJA 3RDSA 4CPIA 2RTIB 1VWJB 4Z27A 5F2BA 4Y5DA 1SRGA 2MF6A 2IZAA 5CSEA 5IRAA 4CPEA 1SWDA 2IZHB 2CAMA 3SZHA 3T2XA 1LCVA 1SWGA 1STPA 1SWNA 1VWCB 2RTRB 1LDOA 1SLEB 4GD9A 4BJ8A 4BX6B 1SWKA 2A8GA 2RTKA 1SREA 4CPHA 2FHLA 1SWEA 1KL4A 4I60A 3WZNA 1DF8A 1NBXA 4BBOA 4Z28A 4BCSA 3VHMA 1WBIA 3RDMA 4DNEA 1VWKB 3T6LA 1AVEA 4GJSA 1VWOB 3VHIA 4BX5B 2RTQB 1N9MA 2RTLA 2RTJA 1RAVA 1SRJA 2A5CA 1STSB 3PK2A 4JO6A 1PTSA 3RDXA 1LUQA 4BX7A 4IRWA 5K67A 2RTOB 2QCBA 3WZOA 1Y52X 2Y3EA 1MK5A 1SWHA 4GJVA 5L3YA 2RTCB 5IRUA 2FHNX 2IZCB 3RY1A 1VWPB 2IZBA 3RDUA 1HY2A 4OKAA 1SLGB 2GH7A 1NDJA 1HXLA 2OFBA 1SWQA 1VYOA 1KL5A 1NQNA 1KL3A 2RTHB 4YVBA 1KFFA 1SWBA 2BC3A 4GGZA 5JD2A 3X00A 1N4JA 2IZDB 1Y53X 4GGTA 4GDAA 3RY2A 3FDCA 4JHQA 1MEPA 3VHHA 1SWFA 2C4IA 2C1QA 1I9HA 2RTEB 3RE5A 1MM9A 1STRB 1IJ8A 4BX6A 4Z2PA 1RXHA 3WZQA 1VWRB 4CPFA 2C1SA 1RSUB 2UYWA 3WYQA 3RE6A 1RXKA 4BX5A 1NQMA 1SWOA 2RTMA 1SWLA 3MG5A 4JNJA 1LCWA 5B5FA 1SWTA 1VWHB 2AVIA 1SWRA 4Z6JA 2RTGB 2IZJA 1VWFB 5B5GA 5K68A 1Y55X 2IZIA 4Z2OA 2IZFB 5IRWA 2IZGB 2RTNB 1HXZA 1LDQA 1SRIA 3WZPA 1HQQA 2RTAA 1SRHA 1SWPA 2A5BA 2RTPB 3MM0A 3VGWA 5CHKA 4EKVA 1N7YA 1MOYA 4GGRA 2OF8A 3T6FA 1SWAA 1VWLB 1VWDB 2Y3FA 4CPHB 3EW1A 1SWSA 3SZJA 1N43A 1SWCA 1VWNB 2OFAA 2G5LA 2UZ2A 2RTBB 3T2WA 2RTDB 1AVDA 2Y32A 2WPUA 1VWBB 3SZIA 1RSTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SWU A;  2IZK A;  4U46 A;  2OF9 A;  1VWI B;  3WYP A;  1VWE B;  2JGS A;  3EW2 A;  1LCZ A;  4BX7 B;  2F01 A;  2RTF B;  3RDO A;  1SLD B;  1VWA B;  1N9Y A;  1SWJ A;  2IZE B;  1LEL A;  1VWG B;  3RDQ A;  4Y59 A;  1VWQ B;  1SRF A;  1NC9 A;  1VWM B;  1SLF B;  2IZL B;  2ZSC A;  4Z2V A;  1RXJ A;  3RDS A;  4CPI A;  2RTI B;  1VWJ B;  4Z27 A;  5F2B A;  4Y5D A;  1SRG A;  2MF6 A;  2IZA A;  5CSE A;  5IRA A;  4CPE A;  1SWD A;  2IZH B;  2CAM A;  3SZH A;  3T2X A;  1LCV A;  1SWG A;  1STP A;  1SWN A;  1VWC B;  2RTR B;  1LDO A;  1SLE B;  4GD9 A;  4BJ8 A;  4BX6 B;  1SWK A;  2A8G A;  2RTK A;  1SRE A;  4CPH A;  2FHL A;  1SWE A;  1KL4 A;  4I60 A;  3WZN A;  1DF8 A;  1NBX A;  4BBO A;  4Z28 A;  4BCS A;  3VHM A;  1WBI A;  3RDM A;  4DNE A;  1VWK B;  3T6L A;  1AVE A;  4GJS A;  1VWO B;  3VHI A;  4BX5 B;  2RTQ B;  1N9M A;  2RTL A;  2RTJ A;  1RAV A;  1SRJ A;  2A5C A;  1STS B;  3PK2 A;  4JO6 A;  1PTS A;  3RDX A;  1LUQ A;  4BX7 A;  4IRW A;  5K67 A;  2RTO B;  2QCB A;  3WZO A;  1Y52 X;  2Y3E A;  1MK5 A;  1SWH A;  4GJV A;  5L3Y A;  2RTC B;  5IRU A;  2FHN X;  2IZC B;  3RY1 A;  1VWP B;  2IZB A;  3RDU A;  1HY2 A;  4OKA A;  1SLG B;  2GH7 A;  1NDJ A;  1HXL A;  2OFB A;  1SWQ A;  1VYO A;  1KL5 A;  1NQN A;  1KL3 A;  2RTH B;  4YVB A;  1KFF A;  1SWB A;  2BC3 A;  4GGZ A;  5JD2 A;  3X00 A;  1N4J A;  2IZD B;  1Y53 X;  4GGT A;  4GDA A;  3RY2 A;  3FDC A;  4JHQ A;  1MEP A;  3VHH A;  1SWF A;  2C4I A;  2C1Q A;  1I9H A;  2RTE B;  3RE5 A;  1MM9 A;  1STR B;  1IJ8 A;  4BX6 A;  4Z2P A;  1RXH A;  3WZQ A;  1VWR B;  4CPF A;  2C1S A;  1RSU B;  2UYW A;  3WYQ A;  3RE6 A;  1RXK A;  4BX5 A;  1NQM A;  1SWO A;  2RTM A;  1SWL A;  3MG5 A;  4JNJ A;  1LCW A;  5B5F A;  1SWT A;  1VWH B;  2AVI A;  1SWR A;  4Z6J A;  2RTG B;  2IZJ A;  1VWF B;  5B5G A;  5K68 A;  1Y55 X;  2IZI A;  4Z2O A;  2IZF B;  5IRW A;  2IZG B;  2RTN B;  1HXZ A;  1LDQ A;  1SRI A;  3WZP A;  1HQQ A;  2RTA A;  1SRH A;  1SWP A;  2A5B A;  2RTP B;  3MM0 A;  3VGW A;  5CHK A;  4EKV A;  1N7Y A;  1MOY A;  4GGR A;  2OF8 A;  3T6F A;  1SWA A;  1VWL B;  1VWD B;  2Y3F A;  4CPH B;  3EW1 A;  1SWS A;  3SZJ A;  1N43 A;  1SWC A;  1VWN B;  2OFA A;  2G5L A;  2UZ2 A;  2RTB B;  3T2W A;  2RTD B;  1AVD A;  2Y32 A;  2WPU A;  1VWB B;  3SZI A;  1RST B; 
#chains in the Genus database with same CATH topology
 4MIR A;  1OBU A;  2IZK A;  3FEL A;  1I06 A;  1URE A;  3CBS A;  1ZNG A;  1GM6 A;  3UEX A;  5L8N A;  1S2P A;  1VWE B;  2JGS A;  3KFG A;  3EW2 A;  1LCZ A;  1ERB A;  4I9R A;  2RTF B;  4XMH A;  2JMB A;  3RDO A;  1VWA B;  5EDC A;  1N9Y A;  1I78 A;  2IZE B;  4B55 A;  3NQ3 A;  4OS0 A;  5D45 A;  5L8I A;  1SRF A;  3ELX A;  3PDF A;  4QZU A;  5IO6 A;  1LPJ A;  4Z2V A;  1GT5 A;  4LKT A;  1Y0G A;  1TVQ A;  2WSJ A;  2I5V O;  2MHD A;  5AJB A;  5EEE A;  4A1H A;  5KIC A;  3FYF A;  2JU7 A;  4FGI B;  5LJK A;  4AYH A;  2MF6 A;  2BHV A;  1ZNH A;  1FTP A;  5EPQ A;  1SWD A;  4A8Z A;  2ACP X;  1UYO X;  5LKE A;  1QQS A;  1IKJ A;  2AT8 X;  4FQB B;  2RTR B;  4GKC A;  3ZW0 B;  2X32 A;  2ZAG A;  4KCA A;  2AT3 X;  2CZT A;  2FT9 A;  1KL4 A;  5LJE A;  5LJC A;  4BBO A;  3RDM A;  4BGF A;  4OMW A;  3C77 X;  4BX5 B;  2G7B A;  1AQB A;  3HOE A;  5FQ7 E;  1ZNE A;  2OY8 A;  2RTL A;  5KHP A;  4ZH9 A;  1SRJ A;  4ZCB A;  3PK2 A;  4L3R A;  5AEO A;  3FEP A;  2IFB A;  3BLG A;  5JR8 A;  2JOZ A;  2GTL O;  4YKM A;  2FR2 A;  3WJE A;  4IRW A;  4IMN A;  1R0U A;  5K67 A;  2A3F X;  2FKJ A;  4CDD A;  5CE4 A;  2WR6 A;  5B27 A;  1KGL A;  5LJG A;  2LA7 A;  1MK5 A;  2OY5 O;  1SWH A;  3DSZ A;  4GJV A;  4TJZ A;  3B2J A;  5K06 A;  1FEL A;  1X8U A;  1BSO A;  2IZB A;  3AKN A;  4ZGF A;  1NDJ A;  2DJG A;  2BS6 A;  4O3Z A;  5CYB A;  1S44 A;  2VFC A;  5JD2 A;  4AZO A;  4HPB A;  3I0A A;  1CBI A;  1QG5 A;  4Y0R A;  2AKQ A;  4GGT A;  3B2I A;  4GDZ A;  4JHQ A;  4O3X B;  3E3C A;  3RWX A;  2WWP A;  3SZI A;  1IFB A;  2ASN X;  2OL7 A;  1SA8 A;  1X8N A;  1HBP A;  2RD7 C;  1KT6 A;  2K23 A;  4I3D A;  3FIQ A;  4YBP A;  2HZQ A;  1AEL A;  3ZW2 A;  3H3I A;  5HA0 A;  3VE1 A;  3KFH A;  3UEV A;  3WZQ A;  1KQX A;  1G74 A;  1Y9T A;  4OEM A;  2EU7 X;  2VDF A;  2X8S A;  1N0S A;  2HMB A;  3KZA A;  3WJC A;  4MVI A;  1YWA A;  5HBS A;  3OD9 A;  4LQZ A;  1TW4 A;  1CBQ A;  3CR6 A;  4TKB A;  1EAL A;  1LF7 A;  1X8O A;  2X45 A;  5HZ9 A;  3WJF A;  2AF5 A;  1E5P A;  5B5G A;  4M6S A;  2Q39 A;  5K68 A;  3F9D A;  4Z2O A;  3TZS A;  1CBS A;  3PH6 A;  5DPQ A;  3PP6 A;  1G5W A;  4NV8 A;  1U18 A;  3CBC A;  1IFC A;  4TQ2 A;  1EXS A;  1XKI A;  2RTA A;  1LID A;  2ZAI A;  3BDR A;  2BSZ A;  2RA6 A;  2QMI A;  2RTP B;  3F8A A;  2KTD A;  3BS2 A;  3MM0 A;  3STK A;  3ZW0 A;  1GT4 A;  4OS8 A;  4ARH A;  4EKV A;  4QGV A;  5HCC C;  4HFO A;  4EQA C;  1VWD B;  1MUP A;  1WUB A;  2Y3F A;  3KVN A;  4GU8 A;  4Y0P A;  3VG5 A;  4IB9 A;  1P6P A;  3SZJ A;  2OFA A;  1YP6 A;  2JU8 A;  1X8P A;  2WEW A;  3EBK A;  1YUP A;  2VFB A;  3FW5 A;  2Q2M A;  4GUZ A;  3T2W A;  3UAQ A;  3N91 A;  1FEM A;  1I4U A;  1T68 X;  5HWZ A;  1RST B;  1SWU A;  4UU3 A;  3U0D A;  1LKE A;  1SY3 A;  2F73 A;  4ODD A;  3IFB A;  2F01 A;  2FR3 A;  1GX9 A;  3RY1 A;  1A18 A;  1SWJ A;  1ZNL A;  1PBO A;  2AL0 X;  4ORX A;  4U8U N;  1EIO A;  2GTF X;  2X8T A;  5BVQ A;  3TGB A;  1ZNK A;  4CPI A;  4MIS A;  3GE2 A;  1HMT A;  1Y9L A;  1OSP O;  2RTI B;  4HPA A;  4KC7 A;  1XCA A;  2BLG A;  5F2B A;  1YP7 A;  4ORY A;  1BEB A;  3C76 X;  4NLI A;  4ON1 A;  1DFV A;  3PQU A;  4ZHG A;  2IZH B;  1DZK A;  1JZU A;  1E00 A;  3AEH A;  2OL8 O;  5B3M O;  3SZH A;  3T2X A;  4YGG A;  2N93 A;  3SOT A;  1DZP A;  2POA A;  1VWC B;  2XKL A;  2LB6 A;  1ADL A;  3FA8 A;  2HYS A;  1HMS A;  1SWK A;  3P6D A;  5H9L A;  3FEK A;  1SWE A;  4Y0S A;  5FQ8 E;  5BVS A;  4YBU A;  4EDE A;  4YGZ A;  4Z28 A;  4ML7 B;  3VHM A;  4BCS A;  4DNE A;  2KW1 A;  2R74 A;  3RKG A;  5DG4 A;  3T6L A;  1AVE A;  3VHI A;  5FEN A;  4NV7 A;  4ZHC A;  1N9M A;  2OYB O;  2NNE A;  1LFO A;  4LKP A;  4JO6 A;  1PTS A;  2OFM X;  1EI5 A;  2X8F A;  4YFQ A;  4ORR A;  3ZI8 A;  3KFF A;  1QFT A;  3AKM A;  5LJD A;  3WVM A;  3NX2 A;  2E4J A;  1OBP A;  2Q2P A;  5HZ5 A;  2QCB A;  5FQ6 E;  3ZUO A;  4I3B A;  1G85 A;  2Y3E A;  5H9A A;  4O4U A;  5L3Y A;  1PBY A;  5IRU A;  2FHN X;  4AZM A;  1GT1 A;  1PEE A;  4OKA A;  2JU3 A;  3JQO A;  2OFB A;  2RTH B;  1SMP I;  1W4T A;  1GX8 A;  4FBO A;  3S26 A;  5BVT A;  2CBS A;  1KFF A;  1SWB A;  2BC3 A;  4GGZ A;  3Q34 A;  4MVK A;  1GX3 A;  1HQP A;  4NLJ A;  3CKG A;  4ZH6 A;  3STM X;  3HPE A;  2L9C A;  2PY1 A;  2FKG A;  1BRP A;  5KID A;  1U17 A;  3EM0 A;  1YWC A;  1MEP A;  1JYJ A;  1SWF A;  3VG4 A;  2C4I A;  2QM9 A;  2MJI A;  4MVE A;  4NYQ A;  1U0X A;  1MM9 A;  1CBR A;  1T8V A;  1IJ8 A;  3QKG A;  4AZP A;  4D6B A;  3BX7 A;  3NX1 A;  1KZX A;  4COT A;  2CM4 A;  4BOE A;  3CQR A;  1VWR B;  2ALL X;  1YWB A;  2K62 A;  1LIE A;  2C1S A;  3K3L A;  2G79 A;  3NR3 A;  1JV4 A;  3P6G A;  1EPA A;  2RCT A;  4QAE A;  3WYQ A;  1RXK A;  4GNY A;  1TOW A;  2OVS A;  4BVM A;  2RTM A;  3MG5 A;  1SWL A;  5LJB A;  1SXU A;  4BQU A;  3ZQ3 A;  1VWH B;  4QGW A;  1JQP A;  4UU2 A;  1SWR A;  4Z6J A;  2GJ5 A;  4ES7 A;  4RUN A;  1VYG A;  3D9W A;  1UZ2 X;  1Y55 X;  2A13 A;  3FID A;  1G7N A;  2KD2 A;  2BS5 A;  2WQ9 A;  3FA7 A;  2IZF B;  1OBQ A;  4IAX A;  2RN4 A;  1B8E A;  3D96 A;  2IZG B;  3D97 A;  2CM9 A;  4GK9 A;  4TNN A;  5B11 O;  5F6Z A;  1W5R A;  3WZP A;  1HQQ A;  3P6C A;  1SRH A;  3JS1 A;  2LBA A;  1SWP A;  1SXY A;  2A5B A;  4WFU A;  1EUO A;  1QWD A;  3VGW A;  3O2Y A;  4GGR A;  3VPJ E;  2OVE A;  3T6F A;  5HZ6 A;  3P02 A;  1A2D A;  2QO4 A;  1VWL B;  2FGS A;  3MVF A;  1BSQ A;  4YCH A;  1HN2 A;  4LZU A;  1BLR A;  2UZ2 A;  2CZU A;  3OBL A;  2G5L A;  2O62 A;  4LZV A;  3UEW A;  4D6A A;  3BU9 A;  3QQ2 A;  1JMZ A;  2CBR A;  4BX6 A;  2DJF A;  3FR4 A;  5HA1 A;  2GTL N;  2LBV A;  3VE2 A;  4I3C A;  3LTW A;  1QY1 A;  1X8Q A;  3B2K A;  3NPO A;  4U46 A;  2LFO A;  2FLJ A;  4QZT A;  1B4M A;  5FFH A;  1DZJ A;  1OEJ A;  1IIU A;  1VWI B;  4FBV A;  1SY2 A;  4KH8 A;  4RUU A;  5F1E A;  3CWK A;  1KT5 A;  5D48 A;  4DCB A;  2HZR A;  4QGX A;  1KT4 A;  2PI3 O;  4O4X A;  1A3Y A;  1ZND A;  1VWG B;  3HOL A;  3TF6 A;  3RDQ A;  4A1Y A;  2F09 A;  5H9N A;  1SLF B;  4N7C A;  1YIV A;  4U9C A;  2IZL B;  1EPB A;  2ZSC A;  1BM5 A;  3OJY C;  5D8J A;  3WJG A;  4I6S A;  1B0O A;  4GNW A;  2AT6 X;  4L1N A;  1PM1 X;  5HCE C;  3L4R A;  1BSY A;  4IB6 A;  4Y5D A;  5CSE A;  2IZA A;  3FW4 A;  5HAE A;  4CPE A;  2KTS A;  1OPA A;  2CAM A;  1SY1 A;  4OMX A;  1SWG A;  1SWN A;  4O3W A;  1O1V A;  1LDO A;  1AVG I;  4BJ8 A;  1O8V A;  2A8G A;  2RTK A;  4CPH A;  3WBG A;  1X71 A;  4I60 A;  1EQD A;  5H9K A;  1T0V A;  4MVL A;  3VG3 A;  3WZN A;  1DF8 A;  3ZW1 B;  1JYD A;  4HPD A;  4ID2 A;  1WBI A;  3HWE A;  2FWV A;  4DQ3 A;  1VWK B;  1MVG A;  2ACO A;  3VG7 A;  2W2F A;  4GJS A;  4YMY A;  3P6H A;  1D2U A;  2RTJ A;  1BRQ A;  2A5C A;  4PJ2 A;  1STS B;  2L68 A;  2WEX A;  4NNS A;  3T1D A;  3VG6 A;  4INN A;  3RZY A;  2Q4N A;  3CKF A;  1LUQ A;  4YDB A;  4BX7 A;  1ICN A;  2L5P A;  4ZR2 A;  3HWF A;  1AB0 A;  4IB8 A;  3EC5 A;  5IXG A;  3DTQ A;  1GT3 A;  4ALB A;  2L67 A;  3PEC A;  1E2T A;  2MWH A;  2RTC B;  1DZM A;  4N7D A;  1HY2 A;  1GGL A;  3U9P C;  4GZV A;  2GH7 A;  1HXL A;  1I05 A;  1GKA A;  3JSQ A;  1VYO A;  1KL3 A;  4AZQ A;  3BRN A;  4YVB A;  1E02 A;  2FTB A;  4CDF A;  3X00 A;  4XMD A;  1N4J A;  1QY2 A;  3WJB A;  4GDA A;  3SLT A;  3RY2 A;  2QO5 A;  5HZQ A;  4CSB A;  5EDB A;  2JN3 A;  4EEJ A;  2AT5 X;  3VHH A;  2YMS A;  2RTE B;  2C1Q A;  1I9H A;  1KT3 A;  4PSQ A;  3RE5 A;  3D4R A;  3FMZ A;  2HNX A;  4U3Q A;  2WQA E;  3P6F A;  5F6B A;  1DC9 A;  2WUT A;  3CQN A;  5F58 A;  2M4L A;  4AW8 A;  1L6M A;  1JIW I;  1BJ7 A;  1HMR A;  1SXX A;  1KT7 A;  4CPF A;  4XME A;  3U03 A;  5B29 A;  1X89 A;  1RSU B;  2NND A;  4I9S A;  2Z4H A;  5LJH A;  1K3B A;  3G7X A;  3RE6 A;  4QYN A;  1NQM A;  3OE3 A;  3P6E A;  3NBX X;  5B5F A;  1LCW A;  1MDC A;  2G8C O;  2ANS A;  2OL6 O;  3APX A;  2RTG B;  2IZJ A;  3LHN A;  3P24 A;  1FEN A;  5EZ2 A;  3PPT A;  4C5P A;  2GC9 A;  4GE1 A;  1QY0 A;  1VWF B;  4JGL A;  2NP1 A;  1LNM A;  2IZI A;  4MEE A;  3SAO A;  1JMX A;  2KT4 B;  1DV9 A;  1IW2 A;  4TKJ A;  4GH7 A;  4WHI A;  4AZN A;  1ACD A;  3BU1 A;  4ZHF A;  4YDA A;  1SRI A;  1LDQ A;  3EYC A;  3ZW1 A;  1QAB E;  2X4M A;  3TGA A;  1BBP A;  3WJD A;  1Z24 A;  4ORS A;  3AUM O;  5L8O A;  4QQ1 A;  2FS6 A;  5CHK A;  4CDE A;  1N7Y A;  4O9S A;  3APW A;  1RBP A;  5C0N A;  1SWA A;  5HTE A;  3HK1 A;  3CMP A;  1FDQ A;  1KXO A;  1EW3 A;  1ALB A;  1ML7 A;  2R56 A;  3B2L A;  3O22 A;  4CPH B;  2W2B A;  1N43 A;  1SWC A;  4IBA A;  3D95 A;  3NP1 A;  2W2A A;  2RTB B;  4KC8 A;  3O19 A;  5IO5 A;  4KT5 A;  1A57 A;  4HWM A;  2WPU A;  1VWB B;  3F6Z B;  5AQ6 A;  2R73 A;  4XMF A;  3RSW A;  1BWY A;  1JJX A;  2OF9 A;  3WYP A;  4R0B A;  3HWG A;  4BX7 B;  5HZ8 A;  3NAD A;  1SLD B;  4ORU A;  2OZQ A;  3APU A;  3WXQ A;  2OY7 A;  3HTY A;  1LEL A;  4O4O A;  2YG2 A;  4Y59 A;  2X34 A;  4K19 A;  1VWQ B;  4QRL A;  5D47 A;  1NC9 A;  1VWM B;  2MM3 A;  1LIC A;  4EXZ A;  4GRJ A;  2A0A A;  3FLL A;  1RXJ A;  1LIB A;  3BY0 A;  3RDS A;  4A60 A;  1GKA B;  3EMM A;  4YCE A;  1VWJ B;  3FEN A;  4Z27 A;  2BT9 A;  2X55 A;  2G78 A;  1GXA A;  3SLO A;  1SRG A;  3ZUI A;  5IRA A;  3EBW A;  3KQ0 A;  3WOV A;  2HKD A;  2RQ0 A;  1KQW A;  5IO7 A;  4ZFX A;  3LV4 A;  2Q9S A;  1S7D A;  2HLV A;  1JJJ A;  1LCV A;  1STP A;  5B10 O;  1NP4 A;  4GD9 A;  1SLE B;  4BX6 B;  4O49 A;  1E06 A;  1CJ5 A;  1KOI A;  1SRE A;  2FHL A;  2OVA A;  2QOM A;  3B2H A;  3FR2 A;  1NBX A;  3FR5 A;  2QO6 A;  1B56 A;  5F7G A;  2NNQ A;  3S5X A;  1VWO B;  3ELZ A;  5FAZ A;  2RTQ B;  5IRW A;  1RAV A;  3ZZV A;  1CRB A;  1FE3 A;  1H91 A;  5LKF A;  3SLJ A;  3C78 X;  3IA8 A;  2P8G A;  2OY1 O;  4OS3 A;  4EFG A;  4FBR A;  3NQ9 A;  2OVD A;  3BX8 A;  4QNI A;  4IAW A;  3PED A;  2RTO B;  3GAQ A;  1ICM A;  4NNT A;  3WZO A;  1Y52 X;  1HBQ A;  1OEK A;  1JBH A;  2LKK A;  4ZHH A;  4QYP A;  1YWD A;  4IMO A;  2IZC B;  1FJ1 E;  1VWP B;  2X46 A;  4YH0 A;  4IB7 A;  2OFR X;  2GTL M;  1SLG B;  4NW4 A;  4U8U O;  3RDU A;  3RDX A;  1SWQ A;  3FA9 A;  1KL5 A;  1NQN A;  2FS7 A;  1DF3 A;  1KZW A;  1MX8 A;  2XST A;  4HPC A;  1SY0 A;  4WFV A;  2IZD B;  1Y53 X;  4O4S A;  4YGH A;  4AZR A;  3RBY A;  3FDC A;  4ZGU A;  5AJC A;  1OEE A;  1TOU A;  2X56 A;  1STR B;  3MBT A;  3PQS A;  4KII A;  3APV A;  2AH7 X;  4TKH A;  5HCD C;  4Z2P A;  1VYF A;  1RXH A;  2FRS A;  4Y0Q A;  1SXW A;  1NP1 A;  2JW1 A;  2DM5 A;  4M7M A;  2UYW A;  4WBK A;  4ZHD A;  4I95 A;  3S60 A;  4NP1 A;  4BX5 A;  1MX7 A;  1SWO A;  1O1U A;  1TXL A;  1LIF A;  2QOS C;  2Z4I A;  3V8U A;  4JNJ A;  1RLB E;  1SWT A;  1ZRY A;  3STN A;  2AVI A;  4NYR A;  3MX7 A;  5H8T A;  3VG2 A;  2A2G A;  1UYN X;  4CV7 A;  3HWD A;  3NQK A;  1D3S A;  3S5V A;  4O3Y A;  4DQ4 A;  1OPB A;  2RCQ A;  2RTN B;  1IKE A;  1K24 A;  5B2A O;  1HXZ A;  4IAB A;  4ZJ0 A;  4YFR A;  1I04 A;  4GET A;  3ZWE A;  3Q6L A;  4U8U M;  4CK4 A;  3BSZ E;  2A2U A;  2I5Z O;  5BYP A;  1MOY A;  2AMM X;  4YKO A;  1JJU A;  2OF8 A;  3KFI A;  3PH5 A;  5D4A A;  1ERX A;  4XMC A;  5HTD A;  1NGL A;  4CDC A;  3I17 A;  1PMP A;  1QFV A;  1SWS A;  2AT0 X;  3EW1 A;  5EED A;  1VWN B;  3UEU A;  4YFP A;  4ALO A;  4ORW A;  2RTD B;  4TLJ A;  3TGC A;  1AVD A;  2Y32 A;  1VPR A;  1EII A;  4OEL A;  2MO5 A;  3VU1 A;  4XMG A;  1W6F A;  3FA6 A; 
#chains in the Genus database with same CATH homology
 1SWU A;  2IZK A;  4U46 A;  2OF9 A;  1VWI B;  3WYP A;  1VWE B;  2JGS A;  3EW2 A;  1LCZ A;  4BX7 B;  2F01 A;  2RTF B;  3RDO A;  1SLD B;  1VWA B;  1N9Y A;  1SWJ A;  2IZE B;  1LEL A;  1VWG B;  3RDQ A;  4Y59 A;  1VWQ B;  1SRF A;  1NC9 A;  1VWM B;  1SLF B;  2IZL B;  2ZSC A;  4Z2V A;  1RXJ A;  3RDS A;  4CPI A;  2RTI B;  1VWJ B;  4Z27 A;  5F2B A;  4Y5D A;  1SRG A;  2MF6 A;  2IZA A;  5CSE A;  5IRA A;  4CPE A;  1SWD A;  2IZH B;  2CAM A;  3SZH A;  3T2X A;  1LCV A;  1SWG A;  1STP A;  1SWN A;  1VWC B;  2RTR B;  1LDO A;  1SLE B;  4GD9 A;  4BJ8 A;  4BX6 B;  1SWK A;  2A8G A;  2RTK A;  1SRE A;  4CPH A;  2FHL A;  1SWE A;  1KL4 A;  4I60 A;  3WZN A;  1DF8 A;  1NBX A;  4BBO A;  4Z28 A;  4BCS A;  3VHM A;  1WBI A;  3RDM A;  4DNE A;  1VWK B;  3T6L A;  1AVE A;  4GJS A;  1VWO B;  3VHI A;  4BX5 B;  2RTQ B;  1N9M A;  2RTL A;  2RTJ A;  1RAV A;  1SRJ A;  2A5C A;  1STS B;  3PK2 A;  4JO6 A;  1PTS A;  3RDX A;  1LUQ A;  4BX7 A;  4IRW A;  5K67 A;  2RTO B;  2QCB A;  3WZO A;  1Y52 X;  2Y3E A;  1MK5 A;  1SWH A;  4GJV A;  5L3Y A;  2RTC B;  5IRU A;  2FHN X;  2IZC B;  3RY1 A;  1VWP B;  2IZB A;  3RDU A;  1HY2 A;  4OKA A;  1SLG B;  2GH7 A;  1NDJ A;  1HXL A;  2OFB A;  1SWQ A;  1VYO A;  1KL5 A;  1NQN A;  1KL3 A;  2RTH B;  4YVB A;  1KFF A;  1SWB A;  2BC3 A;  4GGZ A;  5JD2 A;  3X00 A;  1N4J A;  2IZD B;  1Y53 X;  4GGT A;  4GDA A;  3RY2 A;  3FDC A;  4JHQ A;  1MEP A;  3VHH A;  1SWF A;  2C4I A;  2C1Q A;  1I9H A;  2RTE B;  3RE5 A;  1MM9 A;  1STR B;  1IJ8 A;  4BX6 A;  4Z2P A;  1RXH A;  3WZQ A;  1VWR B;  4CPF A;  2C1S A;  1RSU B;  2UYW A;  3WYQ A;  3RE6 A;  1RXK A;  4BX5 A;  1NQM A;  1SWO A;  2RTM A;  1SWL A;  3MG5 A;  4JNJ A;  1LCW A;  5B5F A;  1SWT A;  1VWH B;  2AVI A;  1SWR A;  4Z6J A;  2RTG B;  2IZJ A;  1VWF B;  5B5G A;  5K68 A;  1Y55 X;  2IZI A;  4Z2O A;  2IZF B;  5IRW A;  2IZG B;  2RTN B;  1HXZ A;  1LDQ A;  1SRI A;  3WZP A;  1HQQ A;  2RTA A;  1SRH A;  1SWP A;  2A5B A;  2RTP B;  3MM0 A;  3VGW A;  5CHK A;  4EKV A;  1N7Y A;  1MOY A;  4GGR A;  2OF8 A;  3T6F A;  1SWA A;  1VWL B;  1VWD B;  2Y3F A;  4CPH B;  3EW1 A;  1SWS A;  3SZJ A;  1N43 A;  1SWC A;  1VWN B;  2OFA A;  2G5L A;  2UZ2 A;  2RTB B;  3T2W A;  2RTD B;  1AVD A;  2Y32 A;  2WPU A;  1VWB B;  3SZI A;  1RST B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...