1SS1A

Staphylococcal protein a, b-domain, y15w mutant, nmr, 25 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
62
structure length
62
Chain Sequence
GSTADNKFNKEQQNAFWEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G binding protein A
publication title From The Cover: Testing protein-folding simulations by experiment: B domain of protein A.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
total genus 16
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2004-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1ss1A00
2KIKA 1ZXGA 1BDDA 3FXDA 1JM0A 1ZW0A 5EFWB 1U7JA 4K3AA 1X0TA 4JBZA 1DEEG 4NPDA 2WMMA 1EDJA 4ASVA 5C39A 1H0TB 2P58A 3PH0A 4IOIH 2B89A 2LR2A 5K5GB 2LXCB 2UWJE 4K35A 2KUBA 4NPEA 3MHVA 2K3RA 3RGUA 2JWDA 2I8DA 4KJMA 2B87B 3ZDMA 1LP1B 4NPFX 2M5AB 2B88A 1BDCA 4HKZH 2KI7B 1Q2NA 1LT1A 1MFTA 2RKLA 1U7MA 4MN4C 4CPGA 1OVVA 1SS1A 1NVOA 4WWIA 1Y47A 1EDLA 5DJTB 4GOEA 2SPZA 4EYYQ 2LXBA 2B87A 4ZMDA 1JMBA 4BXLA 3FXEA 2M0BA 1FC2C 1LP1A 5CBNA 3QWOC 2KS1B 4HJGH 1H0TA 4GOFA 2QVAA 3MZWB 1OVRA 2ZAEB 1S3JA 2HR3A 2OTKE 5CBOA 2QRXA 4ZNCA 3S1KA 4ASWA 2Q1KA 2KZJA 1EDIA 2KZIA 5DJUB 4HB1A 1EC5A 1OVUA 1EDKA 4GODA 2M5AA 2R44A
chains in the Genus database with same CATH superfamily
2AEJA 1KORA 4GIFA 2P2UA 4U3FJ 1NJIQ 3H6PA 2JWAA 3I56P 2WT7A 1ZR4A 1T3JA 1U57A 1FZFA 1NTZK 1TU3F 3T97B 4L76A 3EQ2A 2WQYC 3KYQA 2NZ2A 5AW7B 1QL2A 3Q3DA 4TLFA 5KAFH 2H8PD 2HLOA 4NPEA 2P67A 1QVFO 1RF0C 1NHLA 1QEXA 2IFMA 2DW3A 1SQQD 4H0LD 3A0BE 1NTKE 1YTZI 3EFGA 1SFCD 4OGQB 1PIXA 5AVTB 5CCGC 3PHLA 2CPBA 3O8ZA 1GZLA 1Y47A 1EXJA 1S4XA 2E74C 4Y99C 1M1KQ 1OXZA 4GKGA 5TJHA 1M1JB 1JY3P 1SFCA 3LIDA 2VRSA 4UB8E 1HH0A 1K73Q 1NGMB 4H44D 5B5EE 1JY2P 3G3ZA 3WUUA 2MJZA 2H7HA 1JY3N 1Y8AA 3M9HA 3TGUD 2V4HA 3CCUP 1H8AA 3GHGB 4D6TG 2Q6QA 3CD6P 3TF5A 4PV1C 1GK6A 3L75E 1URQD 1SQVG 3CCMP 1L0LE 3V2RA 2FFDB 4N6JA 3OW2O 1JTHB 1G2CB 1KILE 1JY2N 1LWUA 2ZVNB 3L37A 2D2CB 3W68A 1S5LX 3VMAA 3MHVA 3KQGA 2XDJA 4LGDE 3L71D 1AVYA 2FYNC 1CI6A 1PP9G 1IFIA 1DX7A 2V7QJ 1URQA 1VQOP 1BCCD 1LTAC 3SWFA 1P84D 4DOJA 4JYBA 1Y9BA 1L4AD 2ZFCA 4U7JA 3N4XA 1LNQA 1NTKK 1SQQE 3LIEA 3CCEP 3B8EB 2JR8A 3L73D 4WY4B 1NWQA 2E5TA 2KP8A 3AE6C 1M90Q 4A7PA 3CCRP 1LTGC 2G3AA 1WRGA 3JSVC 1KQLA 1PZQA 1SQPD 1RE4C 1L4AA 4ZKPA 2O3JA 2G8YA 4I7ZC 2FYUD 2R5DA 1KMIZ 1ZW0A 4RESB 3KZIH 3AE7C 2OYIA 2FBWC 1KZUB 2WSFH 3B71A 1XTCC 1J1DB 1LTIC 1T6AA 3FGAD 1VQMP 1NTMD 3CI9A 3TGUE 2WTYA 3AE9C 1RF1B 1FOSF 1KV4A 2NRGA 3G4SP 2IFNA 3RK2B 1L0LK 4YXWH 5CHXA 5M1BA 3BATA 2BCCG 1MV8A 1WMKA 5AVVB 3PP5A 1GL2D 2ZXEB 2XZRA 5KKZC 3AEBC 1YJ9P 2KXPB 4WWIA 2Q3IA 3GF3A 2KLUA 3L71E 4XE5B 5KLVE 4KHXA 1A02F 1M7LA 2XKMA 1N7SB 3B5NB 1BCCE 1RQUA 1ZV8A 5CBOA 3H1LJ 1P84E 1SVFA 2JDIH 1GL2A 2Q1KA 5BU5A 3L72E 1SQQK 2R5BA 3BCCJ 1Q7YQ 3L73E 2KYVA 4XA4A 3CX5I 2JJLA 3L70E 5EFWB 3L74G 3E1IA 1RF0A 4DJGA 2HPCA 2A06G 1JEKA 3CXHD 4IOIH 3CX5H 2ZJSE 1ZMEC 2HFED 3L73J 2FYUE 1J2JB 1BE3E 2PRRA 1S1CX 1M56D 2BEZF 1JY3O 3SWKA 3RGUA 3H1ID 3Q5PA 4XFJA 1SQPJ 1PP9D 2PGDA 1LT1A 4H0LB 3H1KJ 1NTME 3V2PA 1G1JA 3Q5SA 1VPCA 1DIPA 1SFCB 1JY2O 2E76C 1SQBE 4UB6E 2IX7C 1GD2E 4AYCA 5AW4B 2YIUB 2NPSC 1LP1A 1X22A 2QJPC 3RK3C 2FFDA 1FZCC 4N3YB 2N1TD 3CWBE 2I1JA 4U3FD 1KB9D 5KLVK 1OZHA 2KZIA 3M0DC 2PP6A 4QMAA 2E43A 1MKMA 1EDKA 3CPWO 2R44A 3CCLP 3V5BA 3I55P 1LWUB 1S5LH 1K05A 1L0NG 2N1TA 4JYCA 1HVVA 2IBZI 1YI2P 2HODB 5AW8B 1T2KC 3R4YA 1A02J 1W5CE 3D6ZA 1URQB 1HJBA 3HRNA 1N86A 2UWJE 1GU4A 2K1AA 1VQ8P 1SQXG 2K3RA 2N9YB 2FYUK 1J1EC 3MP7B 2BCCD 5GTIH 2L5GB 1KYOD 2JEEA 1BGYG 1PFIA 2OYHB 1DD3A 3H1IE 2SPZA 1NOHA 3IN6A 4D6TJ 1L4AB 2W83C 1NTMK 3AEAC 1SQVJ 2QJYC 2QM8A 2W8ZA 3H1JG 4IL6X 2C9NY 5GTHH 2MKVA 5KJ7C 3V2QA 1SQBK 1LGHB 2YXQB 5H2FE 1G1IA 4RKUJ 1W2EA 2K37A 2KK7A 1X79B 4JQ0D 1GDTA 1PP9J 1EQ7A 4U3FE 2Q3EA 4PD4H 3RL0g 5GTIE 1KB9E 1DEBA 3P8CE 4JBZA 2QJKC 1HWTC 3L74D 1LT9C 2Y0EA 5AVZB 2A06D 1IZNB 2LXCB 2ZXXA 5GTHE 1FZEA 4HH2A 2KOGA 1N7LA 1PGJA 4NPFX 1OWAA 1VDFA 5E79E 2B88A 5CCHC 5APSA 2KI7B 3H1HG 2YKOA 3MIWA 2OTLP 1R5LA 4I1LA 1GL2B 4PD4E 2AXCA 4UB8H 1FJPA 1XTGB 1OW8A 3VN0A 5B5EH 1CZQA 2ZAEB 1NH4A 4EDFA 2GA1A 1KYOE 2WSEH 4OGQC 3P32A 3D71A 2Q7CA 3KPEA 1H88A 3SFEC 5DJUB 2JO1A 2HPCB 2A45I 3MGNA 1VQNP 1M1JC 2E75C 1EZVI 2BCCJ 2E76D 1QLED 1ZXGA 3FXDA 1VL2A 1JM0A 3VYIA 2WZ7A 1VQLP 2NPSD 1L0ND 3HUSA 1Q90D 4K3AA 4Y99B 2A45H 2AEFA 3L35A 3SSUA 1FJKA 2YKPA 2WSCH 3GG2A 1NU1G 1HJ0A 2J59M 2LR2A 3U1AA 1VQ5P 4BRYA 4K35A 3G6EP 2QE7H 1GU5A 1KQFB 3GHGC 4B86A 3M9BA 2JWDA 4KJMA 5APQA 1PPJE 3WUVA 2NPSA 1LP1B 1JB0J 1BDCA 2O1JA 1NTZG 3AE5C 2ZT9D 2OGUA 3H1LD 3K5BA 1MFTA 5APTA 2W27A 3LW5H 1T2KD 2D2CC 1NVOA 2HODA 4GOEA 2Y0DA 3BCCD 1LTJC 3L74J 4AQRD 4M3LA 4EIJA 2IZ1A 3FWLA 3AE4C 3A0HE 3H1JD 3NXSA 1HTLC 2CK3H 2N1TB 4ASWA 2O1KA 2KB7P 1LJ2A 2YXRB 2FYNB 4Z1MH 2P10A 4GDOA 1X8YA 1VQ4P 4WY4C 1FE6A 1NAYA 2IBZG 1NAFA 2LKMA 3S4RA 2CPSA 3MUDC 3GW6A 4NPDA 4RJTA 2OYHA 2FXPA 1S9KD 4H13D 1BSNA 2M3BA 5C39A 2YMKA 2B89A 3H1KD 1P84I 2KUBA 3A5TA 4BWNA 2QG4A 3H25A 1LTTC 5APVA 4I7ZB 2WPSA 1P84H 3H1HD 2IZ0A 2RKLA 2N9BA 1ZRTD 1RE3A 1KQGB 1KQSO 2GUSA 1N73A 1RF1C 4WVZA 4L74A 2R32A 1L0NJ 1EDLA 5DJTB 4EYYQ 3VMXA 2O01J 3G71P 5AW3B 3RL0C 2FXOA 1YJNP 3H1LE 2E5YA 1YJWP 2OTKE 4HYTB 1OIPA 1HGZA 5CCHD 3BCCE 1YTZT 1SQXJ 3KHUA 5BU8B 2J58A 1ZOYC 1VF5C 1NTKG 3B5NC 2IYPA 4IL6E 3PRJA 4GT1A 2K9YA 3IR9A 1BGYJ 4JPZB 2YO3A 5KLIB 4L73A 1L2PA 3D70A 5CCGD 1FDMA 4IFFA 3CC4P 2K9JA 3GMAA 3HD7C 2E74D 1LTBC 3H1JJ 3TYYA 5APXA 2OYOA 2WPVB 4UB6H 3AE2C 2YMYA 4D6TD 1KILC 1IC2A 1SQPE 4Y28J 1JO5A 5AVRB 1SQVD 3H1KE 3TSIA 2WSFJ 5CCGA 3JC22 1OVVA 1JMMA 5APUA 3CCJP 3L75G 1M57D 1E5WA 2B87A 3VMZA 1L0LG 1S72P 3GF7A 1IFPA 1PL5A 2KNCA 3A7OA 3MTUE 5CJ4A 2PAJA 1OVRA 1S3JA 2WITA 2XNDH 4YTPC 1ZRTE 3R2PA 1FOSE 4H0LC 4PV1D 3HE5A 3HUSB 1EDIA 3P8MC 5AVUB 1AJYA 3TNUA 2A45G 2POHA 1EZVG 2OQQA 3Q2YA 2YIUC 3C8VA 2H88C 3SWYA 1KFMA 1GTWA 1QGKB 4YPCA 2L91A 1AQTA 4BRYB 1EXIA 3H1HJ 1YBKA 1YHQP 2E76B 2IBZD 4EI2A 3QH9A 1BSHA 2NPSB 1S2EA 3W67A 1SQQG 2AEMA 5TISH 2JKVA 3PH0A 3OJAB 3JCUH 3WU2E 5K5GB 4H44C 1NKNA 5AVWB 1LWUC 3Q1MA 1SLQA 5CJ0A 3AE1C 5AW5B 1K8AQ 1GW3A 3M9QA 4OH8B 1QX8A 2P7JA 1URQC 3A2AA 2WPQA 2ZT9B 3FX0A 5H2FH 1SQPK 1CSBA 1KB9I 4D6TE 2LXBA 2XU6A 3M06A 3E7KA 1NYHA 3AE8C 4PJ0H 1SQVE 3CXHE 2W6AA 5TISE 4IFDK 1NU1J 3JCUE 1KB9H 1MZ9A 3TGUG 3WMM0 4W80A 1AV1A 1AFOA 4HB1A 3U1CA 1RE4A 2IYOA 3CL3D 1L4AC 2RN0A 1PP9E 1W2BO 2QM7A 4GODA 1NTKD 2KIKA 4I6MC 1NTZJ 1QVGO 2R3SA 4PD4I 3L71G 3RL0D 1X0TA 5KLVG 1FS0E 5AW1B 1ZN5A 1EDJA 5E79H 2OYIC 1KFNA 5BVZA 3WUTA 4H13B 1RY3A 1Q86Q 3BRVB 1BCCG 4PJ0E 3CCVP 3NFQA 1HUCA 1AQ5A 4YXDC 1N73B 2C0XA 3L72G 4N78D 1GW4A 1VF5D 3ZDMA 2WSSH 1JNMA 1KYOH 2YO2A 4RO0A 3L70G 3ITKA 1ZP0C 3HE4A 1SS1A 2FXMA 1NKZB 4C7NA 5AVYB 1RQVA 1FZGA 4LC1A 3CMEP 2Z5IA 1Z56A 3HD7D 2QVAA 3MZWB 3B4SA 1YITP 5AVXB 2FYUG 3V4WA 1BE3G 3CC7P 1KILD 3L36A 1GL2C 3USSA 2GUVA 2KZJA 1KD1Q 1CW5A 3HTKA 1SQVK 2XNXA 4OWFA 1K9MQ 1WT6A 4DCKA 1IJDB 3NTNA 2BCCE 1EZVD 3IFMA 1PV3A 2BASA 2ZVOB 1NTMG 2K9JB 2W6BA 3HD7A 1T3UA 2WWWA 1IK7A 1SQBG 1KILA 3VP8A 3NMDA 1FAVA 2V7QH 2J5UA 2Q9IA 2ZYGA 2ITAA 3M91A 3CWBG 5AVSB 1N2DC 1IFNA 2QSIA 2HYNA 2E74B 3RK3D 3G9RA 2FKWB 2B87B 1YQ3C 2E75B 1FDIA 2M5AB 2KNCB 3A0HH 1NTKJ 3KXDA 1U7MA 4MN4C 3HE5B 4N78E 5KAFE 3TNUB 3L74E 1SQXD 4BXLA 3FXEA 2RH0A 1JCDA 3QWOC 2KS1B 2A06E 4HJGH 3KDPB 2FFDC 1FZCA 2HR3A 3U59A 4L75A 1HF9A 3M0DA 3RBZA 4PV1B 1BGYD 3ABVC 5CMZA 3EFFK 1VQ7P 3E1RA 1AA0A 1JCCA 2ZYDA 4LLHA 2O01H 2N1TC 2RMZA 3GLMA 3H1IG 2WSEJ 1LTJB 3EWKA 5KLVD 1KC8Q 1H0TB 1EZVE 1HBWA 3L75J 5AW2B 3CCQP 3OAKA 2W6JH 1L0LJ 2OARA 3H32A 2K88A 2WPRA 4W7ZA 3AEGC 3L72D 1KN7A 4WBAA 1JOCA 1GMJA 1LTSC 2R3CA 3CC2P 5KJ7D 2GM4A 4HKZH 4U3FG 2WSCJ 1FU1A 3PLNA 4CPGA 3L70D 1IFMA 1L0NE 2YKQA 3RK3E 1SP4A 5AW6B 1RH5B 1PGOA 4EOTA 4GOFA 3M0AA 1SQQJ 4WB4A 3O6QA 1J1DC 5KJ7A 4IL6H 3II6A 1RHZB 1Q81Q 1BE3D 3N7NA 3SFDC 3BVHA 1E79H 1SQXE 3LW5J 3RK2C 3BASA 5AW0B 2HG5D 1VQ6P 2XV5A 1PGPA 1IO4A 1BDDA 3I5CA 3V6IA 3C9IA 1BGYE 2QEXP 1NO4A 4ZKUA 2WMMA 1SQBD 1LT9A 3RL0B 2IPPA 1R5SA 1N7SC 3PTZA 3CWBD 3CCSP 3H1JE 3CX5D 5KKZB 3OA7A 3HE4B 2JP3A 1K04A 3TGUJ 4C7NB 1FZAA 1ZR2A 3KZIE 5KLIC 1VF5B 3T97A 5CCHA 3F89A 4OGQD 4IFMA 1FZBA 1NU1D 2YNYA 2ZYAA 2WT7B 3HTKB 1S9KE 3RBXA 2E75D 1OW7A 3L71J 2BEQD 2E42A 2Z5HA 5KLVJ 3VOPA 3Q5RA 1L0NK 1NTZD 3HD7B 1BCCJ 4ZNCA 3AEDC 4OVNF 3FWNA 1UIIA 1KILB 1PPJG 3A3YB 2C9LY 3L72J 2PFXA 5APYA 1H89A 1M1JA 1JUNA 1DH3A 2M5AA 3WU2H 5KAIH 1UIXA 4TT3H 3H1HE 1SQXK 1AVOA 4W7YA 2B9BA 2C0WA 1VQPP 4JF7A 3L70J 3PJSK 1SFCC 3IAOA 3HUSC 4R4LA 1KTMA 2KSEA 3D6YA 2QIWA 2H89C 2KS1A 2Y0CA 3CXHI 2D2CD 3VMYA 1OMIA 2FYZA 2FYUJ 2Z4EA 4KT0J 4DZOA 1M8OB 1BE3J 3GHGA 1FBMA 3UIAA 1T8ZA 1IFDA 3CXHH 2QJPB 3RK3B 2M3EA 1HGVA 1IFJA 1FZCB 1Q2NA 3AE3C 3MD0A 1MFZA 3CX5E 5KAIE 1JTHA 1G2CA 4C7RA 1NTMJ 2KLVA 3P8CD 3CLQA 1X9VA 1LTJA 1QL1A 4ZMDA 1JMBA 1SQBJ 1FC2C 4WY4D 1Q82Q 2AXTH 1H0TA 3VP9A 2I1KA 4H44B 1NU1E 1OW6A 4DT0A 2QRXA 3S1KA 3CWBJ 2ZT9C 3IF4A 2O01N 3AEEC 1CI6B 3BRTB 1FDOA 1OVUA 3H32B 4WY4A 1NTZE 1R8EA 4R4MA 1N8RQ 3P7KA 4PD4D 3MUDA 1U7JA 1YQ4C 1DEEG 2OYHC 4ASVA 2WVRA 1J1EB 1MUUA 2FY8A 2P58A 5AW9B 3H1LG 2AXTE 1OX3A 2Q5UA 1D7MA 2Y9YA 3F5HA 3RK2D 2P1JA 3CMAP 1S5LE 3BCCG 1VQKP 1YYCA 5B66H 3TK1A 2I8DA 4C46A 2H43A 3AECC 3L4FA 2IDBA 1DD4A 3VTPC 4H13C 1PGQA 4I2LC 2QJYB 3O6QB 1YIJP 3AEFC 1RE3C 2IBZE 1KYOI 3TDKA 1RF1A 1OFCX 1N73C 2W90A 2M8RA 2OYIB 3S9OA 2OTJP 3H1IJ 1N7SD 2M0BA 3B5ND 5CBNA 5APWA 3L73G 3V2NA 1IK9A 1ZLLA 5AVQB 5L8RJ 1USEA 5KTBA 2Y9ZA 1USDA 2QJKB 1SQPG 3C1LA 4AUWA 1LT9B 1VQ9P 1NU1K 1PPJD 2KSJA 1EC5A 3L75D 5B66E 2QA4P 3A0BH 1GK4A 4O9BA 3V4QA 1L0LD 3H1KG 1N7SA 3B5NA
chains in the Genus database with same CATH topology
2KIKA 1ZXGA 1BDDA 3FXDA 1JM0A 1ZW0A 5EFWB 1U7JA 4K3AA 1X0TA 4JBZA 1DEEG 4NPDA 2WMMA 1EDJA 4ASVA 5C39A 1H0TB 2P58A 3PH0A 4IOIH 2B89A 2LR2A 5K5GB 2LXCB 2UWJE 4K35A 2KUBA 4NPEA 3MHVA 2K3RA 3RGUA 2JWDA 2I8DA 4KJMA 2B87B 3ZDMA 1LP1B 4NPFX 2M5AB 2B88A 1BDCA 4HKZH 2KI7B 1Q2NA 1LT1A 1MFTA 2RKLA 1U7MA 4MN4C 4CPGA 1OVVA 1SS1A 1NVOA 4WWIA 1Y47A 1EDLA 5DJTB 4GOEA 2SPZA 4EYYQ 2LXBA 2B87A 4ZMDA 1JMBA 4BXLA 3FXEA 2M0BA 1FC2C 1LP1A 5CBNA 3QWOC 2KS1B 4HJGH 1H0TA 4GOFA 2QVAA 3MZWB 1OVRA 2ZAEB 1S3JA 2HR3A 2OTKE 5CBOA 2QRXA 4ZNCA 3S1KA 4ASWA 2Q1KA 2KZJA 1EDIA 2KZIA 5DJUB 4HB1A 1EC5A 1OVUA 1EDKA 4GODA 2M5AA 2R44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIK A;  1ZXG A;  1BDD A;  3FXD A;  1JM0 A;  1ZW0 A;  5EFW B;  1U7J A;  4K3A A;  1X0T A;  4JBZ A;  1DEE G;  4NPD A;  2WMM A;  1EDJ A;  4ASV A;  5C39 A;  1H0T B;  2P58 A;  3PH0 A;  4IOI H;  2B89 A;  2LR2 A;  5K5G B;  2LXC B;  2UWJ E;  4K35 A;  2KUB A;  4NPE A;  3MHV A;  2K3R A;  3RGU A;  2JWD A;  2I8D A;  4KJM A;  2B87 B;  3ZDM A;  1LP1 B;  4NPF X;  2M5A B;  2B88 A;  1BDC A;  4HKZ H;  2KI7 B;  1Q2N A;  1LT1 A;  1MFT A;  2RKL A;  1U7M A;  4MN4 C;  4CPG A;  1OVV A;  1SS1 A;  1NVO A;  4WWI A;  1Y47 A;  1EDL A;  5DJT B;  4GOE A;  2SPZ A;  4EYY Q;  2LXB A;  2B87 A;  4ZMD A;  1JMB A;  4BXL A;  3FXE A;  2M0B A;  1FC2 C;  1LP1 A;  5CBN A;  3QWO C;  2KS1 B;  4HJG H;  1H0T A;  4GOF A;  2QVA A;  3MZW B;  1OVR A;  2ZAE B;  1S3J A;  2HR3 A;  2OTK E;  5CBO A;  2QRX A;  4ZNC A;  3S1K A;  4ASW A;  2Q1K A;  2KZJ A;  1EDI A;  2KZI A;  5DJU B;  4HB1 A;  1EC5 A;  1OVU A;  1EDK A;  4GOD A;  2M5A A;  2R44 A; 
#chains in the Genus database with same CATH topology
 2AEJ A;  1KOR A;  4GIF A;  2P2U A;  4U3F J;  1NJI Q;  3H6P A;  2JWA A;  3I56 P;  2WT7 A;  1ZR4 A;  1T3J A;  1U57 A;  1FZF A;  1NTZ K;  1TU3 F;  3T97 B;  4L76 A;  3EQ2 A;  2WQY C;  3KYQ A;  2NZ2 A;  5AW7 B;  1QL2 A;  3Q3D A;  4TLF A;  5KAF H;  2H8P D;  2HLO A;  4NPE A;  2P67 A;  1QVF O;  1RF0 C;  1NHL A;  1QEX A;  2IFM A;  2DW3 A;  1SQQ D;  4H0L D;  3A0B E;  1NTK E;  1YTZ I;  3EFG A;  1SFC D;  4OGQ B;  1PIX A;  5AVT B;  5CCG C;  3PHL A;  2CPB A;  3O8Z A;  1GZL A;  1Y47 A;  1EXJ A;  1S4X A;  2E74 C;  4Y99 C;  1M1K Q;  1OXZ A;  4GKG A;  5TJH A;  1M1J B;  1JY3 P;  1SFC A;  3LID A;  2VRS A;  4UB8 E;  1HH0 A;  1K73 Q;  1NGM B;  4H44 D;  5B5E E;  1JY2 P;  3G3Z A;  3WUU A;  2MJZ A;  2H7H A;  1JY3 N;  1Y8A A;  3M9H A;  3TGU D;  2V4H A;  3CCU P;  1H8A A;  3GHG B;  4D6T G;  2Q6Q A;  3CD6 P;  3TF5 A;  4PV1 C;  1GK6 A;  3L75 E;  1URQ D;  1SQV G;  3CCM P;  1L0L E;  3V2R A;  2FFD B;  4N6J A;  3OW2 O;  1JTH B;  1G2C B;  1KIL E;  1JY2 N;  1LWU A;  2ZVN B;  3L37 A;  2D2C B;  3W68 A;  1S5L X;  3VMA A;  3MHV A;  3KQG A;  2XDJ A;  4LGD E;  3L71 D;  1AVY A;  2FYN C;  1CI6 A;  1PP9 G;  1IFI A;  1DX7 A;  2V7Q J;  1URQ A;  1VQO P;  1BCC D;  1LTA C;  3SWF A;  1P84 D;  4DOJ A;  4JYB A;  1Y9B A;  1L4A D;  2ZFC A;  4U7J A;  3N4X A;  1LNQ A;  1NTK K;  1SQQ E;  3LIE A;  3CCE P;  3B8E B;  2JR8 A;  3L73 D;  4WY4 B;  1NWQ A;  2E5T A;  2KP8 A;  3AE6 C;  1M90 Q;  4A7P A;  3CCR P;  1LTG C;  2G3A A;  1WRG A;  3JSV C;  1KQL A;  1PZQ A;  1SQP D;  1RE4 C;  1L4A A;  4ZKP A;  2O3J A;  2G8Y A;  4I7Z C;  2FYU D;  2R5D A;  1KMI Z;  1ZW0 A;  4RES B;  3KZI H;  3AE7 C;  2OYI A;  2FBW C;  1KZU B;  2WSF H;  3B71 A;  1XTC C;  1J1D B;  1LTI C;  1T6A A;  3FGA D;  1VQM P;  1NTM D;  3CI9 A;  3TGU E;  2WTY A;  3AE9 C;  1RF1 B;  1FOS F;  1KV4 A;  2NRG A;  3G4S P;  2IFN A;  3RK2 B;  1L0L K;  4YXW H;  5CHX A;  5M1B A;  3BAT A;  2BCC G;  1MV8 A;  1WMK A;  5AVV B;  3PP5 A;  1GL2 D;  2ZXE B;  2XZR A;  5KKZ C;  3AEB C;  1YJ9 P;  2KXP B;  4WWI A;  2Q3I A;  3GF3 A;  2KLU A;  3L71 E;  4XE5 B;  5KLV E;  4KHX A;  1A02 F;  1M7L A;  2XKM A;  1N7S B;  3B5N B;  1BCC E;  1RQU A;  1ZV8 A;  5CBO A;  3H1L J;  1P84 E;  1SVF A;  2JDI H;  1GL2 A;  2Q1K A;  5BU5 A;  3L72 E;  1SQQ K;  2R5B A;  3BCC J;  1Q7Y Q;  3L73 E;  2KYV A;  4XA4 A;  3CX5 I;  2JJL A;  3L70 E;  5EFW B;  3L74 G;  3E1I A;  1RF0 A;  4DJG A;  2HPC A;  2A06 G;  1JEK A;  3CXH D;  4IOI H;  3CX5 H;  2ZJS E;  1ZME C;  2HFE D;  3L73 J;  2FYU E;  1J2J B;  1BE3 E;  2PRR A;  1S1C X;  1M56 D;  2BEZ F;  1JY3 O;  3SWK A;  3RGU A;  3H1I D;  3Q5P A;  4XFJ A;  1SQP J;  1PP9 D;  2PGD A;  1LT1 A;  4H0L B;  3H1K J;  1NTM E;  3V2P A;  1G1J A;  3Q5S A;  1VPC A;  1DIP A;  1SFC B;  1JY2 O;  2E76 C;  1SQB E;  4UB6 E;  2IX7 C;  1GD2 E;  4AYC A;  5AW4 B;  2YIU B;  2NPS C;  1LP1 A;  1X22 A;  2QJP C;  3RK3 C;  2FFD A;  1FZC C;  4N3Y B;  2N1T D;  3CWB E;  2I1J A;  4U3F D;  1KB9 D;  5KLV K;  1OZH A;  2KZI A;  3M0D C;  2PP6 A;  4QMA A;  2E43 A;  1MKM A;  1EDK A;  3CPW O;  2R44 A;  3CCL P;  3V5B A;  3I55 P;  1LWU B;  1S5L H;  1K05 A;  1L0N G;  2N1T A;  4JYC A;  1HVV A;  2IBZ I;  1YI2 P;  2HOD B;  5AW8 B;  1T2K C;  3R4Y A;  1A02 J;  1W5C E;  3D6Z A;  1URQ B;  1HJB A;  3HRN A;  1N86 A;  2UWJ E;  1GU4 A;  2K1A A;  1VQ8 P;  1SQX G;  2K3R A;  2N9Y B;  2FYU K;  1J1E C;  3MP7 B;  2BCC D;  5GTI H;  2L5G B;  1KYO D;  2JEE A;  1BGY G;  1PFI A;  2OYH B;  1DD3 A;  3H1I E;  2SPZ A;  1NOH A;  3IN6 A;  4D6T J;  1L4A B;  2W83 C;  1NTM K;  3AEA C;  1SQV J;  2QJY C;  2QM8 A;  2W8Z A;  3H1J G;  4IL6 X;  2C9N Y;  5GTH H;  2MKV A;  5KJ7 C;  3V2Q A;  1SQB K;  1LGH B;  2YXQ B;  5H2F E;  1G1I A;  4RKU J;  1W2E A;  2K37 A;  2KK7 A;  1X79 B;  4JQ0 D;  1GDT A;  1PP9 J;  1EQ7 A;  4U3F E;  2Q3E A;  4PD4 H;  3RL0 g;  5GTI E;  1KB9 E;  1DEB A;  3P8C E;  4JBZ A;  2QJK C;  1HWT C;  3L74 D;  1LT9 C;  2Y0E A;  5AVZ B;  2A06 D;  1IZN B;  2LXC B;  2ZXX A;  5GTH E;  1FZE A;  4HH2 A;  2KOG A;  1N7L A;  1PGJ A;  4NPF X;  1OWA A;  1VDF A;  5E79 E;  2B88 A;  5CCH C;  5APS A;  2KI7 B;  3H1H G;  2YKO A;  3MIW A;  2OTL P;  1R5L A;  4I1L A;  1GL2 B;  4PD4 E;  2AXC A;  4UB8 H;  1FJP A;  1XTG B;  1OW8 A;  3VN0 A;  5B5E H;  1CZQ A;  2ZAE B;  1NH4 A;  4EDF A;  2GA1 A;  1KYO E;  2WSE H;  4OGQ C;  3P32 A;  3D71 A;  2Q7C A;  3KPE A;  1H88 A;  3SFE C;  5DJU B;  2JO1 A;  2HPC B;  2A45 I;  3MGN A;  1VQN P;  1M1J C;  2E75 C;  1EZV I;  2BCC J;  2E76 D;  1QLE D;  1ZXG A;  3FXD A;  1VL2 A;  1JM0 A;  3VYI A;  2WZ7 A;  1VQL P;  2NPS D;  1L0N D;  3HUS A;  1Q90 D;  4K3A A;  4Y99 B;  2A45 H;  2AEF A;  3L35 A;  3SSU A;  1FJK A;  2YKP A;  2WSC H;  3GG2 A;  1NU1 G;  1HJ0 A;  2J59 M;  2LR2 A;  3U1A A;  1VQ5 P;  4BRY A;  4K35 A;  3G6E P;  2QE7 H;  1GU5 A;  1KQF B;  3GHG C;  4B86 A;  3M9B A;  2JWD A;  4KJM A;  5APQ A;  1PPJ E;  3WUV A;  2NPS A;  1LP1 B;  1JB0 J;  1BDC A;  2O1J A;  1NTZ G;  3AE5 C;  2ZT9 D;  2OGU A;  3H1L D;  3K5B A;  1MFT A;  5APT A;  2W27 A;  3LW5 H;  1T2K D;  2D2C C;  1NVO A;  2HOD A;  4GOE A;  2Y0D A;  3BCC D;  1LTJ C;  3L74 J;  4AQR D;  4M3L A;  4EIJ A;  2IZ1 A;  3FWL A;  3AE4 C;  3A0H E;  3H1J D;  3NXS A;  1HTL C;  2CK3 H;  2N1T B;  4ASW A;  2O1K A;  2KB7 P;  1LJ2 A;  2YXR B;  2FYN B;  4Z1M H;  2P10 A;  4GDO A;  1X8Y A;  1VQ4 P;  4WY4 C;  1FE6 A;  1NAY A;  2IBZ G;  1NAF A;  2LKM A;  3S4R A;  2CPS A;  3MUD C;  3GW6 A;  4NPD A;  4RJT A;  2OYH A;  2FXP A;  1S9K D;  4H13 D;  1BSN A;  2M3B A;  5C39 A;  2YMK A;  2B89 A;  3H1K D;  1P84 I;  2KUB A;  3A5T A;  4BWN A;  2QG4 A;  3H25 A;  1LTT C;  5APV A;  4I7Z B;  2WPS A;  1P84 H;  3H1H D;  2IZ0 A;  2RKL A;  2N9B A;  1ZRT D;  1RE3 A;  1KQG B;  1KQS O;  2GUS A;  1N73 A;  1RF1 C;  4WVZ A;  4L74 A;  2R32 A;  1L0N J;  1EDL A;  5DJT B;  4EYY Q;  3VMX A;  2O01 J;  3G71 P;  5AW3 B;  3RL0 C;  2FXO A;  1YJN P;  3H1L E;  2E5Y A;  1YJW P;  2OTK E;  4HYT B;  1OIP A;  1HGZ A;  5CCH D;  3BCC E;  1YTZ T;  1SQX J;  3KHU A;  5BU8 B;  2J58 A;  1ZOY C;  1VF5 C;  1NTK G;  3B5N C;  2IYP A;  4IL6 E;  3PRJ A;  4GT1 A;  2K9Y A;  3IR9 A;  1BGY J;  4JPZ B;  2YO3 A;  5KLI B;  4L73 A;  1L2P A;  3D70 A;  5CCG D;  1FDM A;  4IFF A;  3CC4 P;  2K9J A;  3GMA A;  3HD7 C;  2E74 D;  1LTB C;  3H1J J;  3TYY A;  5APX A;  2OYO A;  2WPV B;  4UB6 H;  3AE2 C;  2YMY A;  4D6T D;  1KIL C;  1IC2 A;  1SQP E;  4Y28 J;  1JO5 A;  5AVR B;  1SQV D;  3H1K E;  3TSI A;  2WSF J;  5CCG A;  3JC2 2;  1OVV A;  1JMM A;  5APU A;  3CCJ P;  3L75 G;  1M57 D;  1E5W A;  2B87 A;  3VMZ A;  1L0L G;  1S72 P;  3GF7 A;  1IFP A;  1PL5 A;  2KNC A;  3A7O A;  3MTU E;  5CJ4 A;  2PAJ A;  1OVR A;  1S3J A;  2WIT A;  2XND H;  4YTP C;  1ZRT E;  3R2P A;  1FOS E;  4H0L C;  4PV1 D;  3HE5 A;  3HUS B;  1EDI A;  3P8M C;  5AVU B;  1AJY A;  3TNU A;  2A45 G;  2POH A;  1EZV G;  2OQQ A;  3Q2Y A;  2YIU C;  3C8V A;  2H88 C;  3SWY A;  1KFM A;  1GTW A;  1QGK B;  4YPC A;  2L91 A;  1AQT A;  4BRY B;  1EXI A;  3H1H J;  1YBK A;  1YHQ P;  2E76 B;  2IBZ D;  4EI2 A;  3QH9 A;  1BSH A;  2NPS B;  1S2E A;  3W67 A;  1SQQ G;  2AEM A;  5TIS H;  2JKV A;  3PH0 A;  3OJA B;  3JCU H;  3WU2 E;  5K5G B;  4H44 C;  1NKN A;  5AVW B;  1LWU C;  3Q1M A;  1SLQ A;  5CJ0 A;  3AE1 C;  5AW5 B;  1K8A Q;  1GW3 A;  3M9Q A;  4OH8 B;  1QX8 A;  2P7J A;  1URQ C;  3A2A A;  2WPQ A;  2ZT9 B;  3FX0 A;  5H2F H;  1SQP K;  1CSB A;  1KB9 I;  4D6T E;  2LXB A;  2XU6 A;  3M06 A;  3E7K A;  1NYH A;  3AE8 C;  4PJ0 H;  1SQV E;  3CXH E;  2W6A A;  5TIS E;  4IFD K;  1NU1 J;  3JCU E;  1KB9 H;  1MZ9 A;  3TGU G;  3WMM 0;  4W80 A;  1AV1 A;  1AFO A;  4HB1 A;  3U1C A;  1RE4 A;  2IYO A;  3CL3 D;  1L4A C;  2RN0 A;  1PP9 E;  1W2B O;  2QM7 A;  4GOD A;  1NTK D;  2KIK A;  4I6M C;  1NTZ J;  1QVG O;  2R3S A;  4PD4 I;  3L71 G;  3RL0 D;  1X0T A;  5KLV G;  1FS0 E;  5AW1 B;  1ZN5 A;  1EDJ A;  5E79 H;  2OYI C;  1KFN A;  5BVZ A;  3WUT A;  4H13 B;  1RY3 A;  1Q86 Q;  3BRV B;  1BCC G;  4PJ0 E;  3CCV P;  3NFQ A;  1HUC A;  1AQ5 A;  4YXD C;  1N73 B;  2C0X A;  3L72 G;  4N78 D;  1GW4 A;  1VF5 D;  3ZDM A;  2WSS H;  1JNM A;  1KYO H;  2YO2 A;  4RO0 A;  3L70 G;  3ITK A;  1ZP0 C;  3HE4 A;  1SS1 A;  2FXM A;  1NKZ B;  4C7N A;  5AVY B;  1RQV A;  1FZG A;  4LC1 A;  3CME P;  2Z5I A;  1Z56 A;  3HD7 D;  2QVA A;  3MZW B;  3B4S A;  1YIT P;  5AVX B;  2FYU G;  3V4W A;  1BE3 G;  3CC7 P;  1KIL D;  3L36 A;  1GL2 C;  3USS A;  2GUV A;  2KZJ A;  1KD1 Q;  1CW5 A;  3HTK A;  1SQV K;  2XNX A;  4OWF A;  1K9M Q;  1WT6 A;  4DCK A;  1IJD B;  3NTN A;  2BCC E;  1EZV D;  3IFM A;  1PV3 A;  2BAS A;  2ZVO B;  1NTM G;  2K9J B;  2W6B A;  3HD7 A;  1T3U A;  2WWW A;  1IK7 A;  1SQB G;  1KIL A;  3VP8 A;  3NMD A;  1FAV A;  2V7Q H;  2J5U A;  2Q9I A;  2ZYG A;  2ITA A;  3M91 A;  3CWB G;  5AVS B;  1N2D C;  1IFN A;  2QSI A;  2HYN A;  2E74 B;  3RK3 D;  3G9R A;  2FKW B;  2B87 B;  1YQ3 C;  2E75 B;  1FDI A;  2M5A B;  2KNC B;  3A0H H;  1NTK J;  3KXD A;  1U7M A;  4MN4 C;  3HE5 B;  4N78 E;  5KAF E;  3TNU B;  3L74 E;  1SQX D;  4BXL A;  3FXE A;  2RH0 A;  1JCD A;  3QWO C;  2KS1 B;  2A06 E;  4HJG H;  3KDP B;  2FFD C;  1FZC A;  2HR3 A;  3U59 A;  4L75 A;  1HF9 A;  3M0D A;  3RBZ A;  4PV1 B;  1BGY D;  3ABV C;  5CMZ A;  3EFF K;  1VQ7 P;  3E1R A;  1AA0 A;  1JCC A;  2ZYD A;  4LLH A;  2O01 H;  2N1T C;  2RMZ A;  3GLM A;  3H1I G;  2WSE J;  1LTJ B;  3EWK A;  5KLV D;  1KC8 Q;  1H0T B;  1EZV E;  1HBW A;  3L75 J;  5AW2 B;  3CCQ P;  3OAK A;  2W6J H;  1L0L J;  2OAR A;  3H32 A;  2K88 A;  2WPR A;  4W7Z A;  3AEG C;  3L72 D;  1KN7 A;  4WBA A;  1JOC A;  1GMJ A;  1LTS C;  2R3C A;  3CC2 P;  5KJ7 D;  2GM4 A;  4HKZ H;  4U3F G;  2WSC J;  1FU1 A;  3PLN A;  4CPG A;  3L70 D;  1IFM A;  1L0N E;  2YKQ A;  3RK3 E;  1SP4 A;  5AW6 B;  1RH5 B;  1PGO A;  4EOT A;  4GOF A;  3M0A A;  1SQQ J;  4WB4 A;  3O6Q A;  1J1D C;  5KJ7 A;  4IL6 H;  3II6 A;  1RHZ B;  1Q81 Q;  1BE3 D;  3N7N A;  3SFD C;  3BVH A;  1E79 H;  1SQX E;  3LW5 J;  3RK2 C;  3BAS A;  5AW0 B;  2HG5 D;  1VQ6 P;  2XV5 A;  1PGP A;  1IO4 A;  1BDD A;  3I5C A;  3V6I A;  3C9I A;  1BGY E;  2QEX P;  1NO4 A;  4ZKU A;  2WMM A;  1SQB D;  1LT9 A;  3RL0 B;  2IPP A;  1R5S A;  1N7S C;  3PTZ A;  3CWB D;  3CCS P;  3H1J E;  3CX5 D;  5KKZ B;  3OA7 A;  3HE4 B;  2JP3 A;  1K04 A;  3TGU J;  4C7N B;  1FZA A;  1ZR2 A;  3KZI E;  5KLI C;  1VF5 B;  3T97 A;  5CCH A;  3F89 A;  4OGQ D;  4IFM A;  1FZB A;  1NU1 D;  2YNY A;  2ZYA A;  2WT7 B;  3HTK B;  1S9K E;  3RBX A;  2E75 D;  1OW7 A;  3L71 J;  2BEQ D;  2E42 A;  2Z5H A;  5KLV J;  3VOP A;  3Q5R A;  1L0N K;  1NTZ D;  3HD7 B;  1BCC J;  4ZNC A;  3AED C;  4OVN F;  3FWN A;  1UII A;  1KIL B;  1PPJ G;  3A3Y B;  2C9L Y;  3L72 J;  2PFX A;  5APY A;  1H89 A;  1M1J A;  1JUN A;  1DH3 A;  2M5A A;  3WU2 H;  5KAI H;  1UIX A;  4TT3 H;  3H1H E;  1SQX K;  1AVO A;  4W7Y A;  2B9B A;  2C0W A;  1VQP P;  4JF7 A;  3L70 J;  3PJS K;  1SFC C;  3IAO A;  3HUS C;  4R4L A;  1KTM A;  2KSE A;  3D6Y A;  2QIW A;  2H89 C;  2KS1 A;  2Y0C A;  3CXH I;  2D2C D;  3VMY A;  1OMI A;  2FYZ A;  2FYU J;  2Z4E A;  4KT0 J;  4DZO A;  1M8O B;  1BE3 J;  3GHG A;  1FBM A;  3UIA A;  1T8Z A;  1IFD A;  3CXH H;  2QJP B;  3RK3 B;  2M3E A;  1HGV A;  1IFJ A;  1FZC B;  1Q2N A;  3AE3 C;  3MD0 A;  1MFZ A;  3CX5 E;  5KAI E;  1JTH A;  1G2C A;  4C7R A;  1NTM J;  2KLV A;  3P8C D;  3CLQ A;  1X9V A;  1LTJ A;  1QL1 A;  4ZMD A;  1JMB A;  1SQB J;  1FC2 C;  4WY4 D;  1Q82 Q;  2AXT H;  1H0T A;  3VP9 A;  2I1K A;  4H44 B;  1NU1 E;  1OW6 A;  4DT0 A;  2QRX A;  3S1K A;  3CWB J;  2ZT9 C;  3IF4 A;  2O01 N;  3AEE C;  1CI6 B;  3BRT B;  1FDO A;  1OVU A;  3H32 B;  4WY4 A;  1NTZ E;  1R8E A;  4R4M A;  1N8R Q;  3P7K A;  4PD4 D;  3MUD A;  1U7J A;  1YQ4 C;  1DEE G;  2OYH C;  4ASV A;  2WVR A;  1J1E B;  1MUU A;  2FY8 A;  2P58 A;  5AW9 B;  3H1L G;  2AXT E;  1OX3 A;  2Q5U A;  1D7M A;  2Y9Y A;  3F5H A;  3RK2 D;  2P1J A;  3CMA P;  1S5L E;  3BCC G;  1VQK P;  1YYC A;  5B66 H;  3TK1 A;  2I8D A;  4C46 A;  2H43 A;  3AEC C;  3L4F A;  2IDB A;  1DD4 A;  3VTP C;  4H13 C;  1PGQ A;  4I2L C;  2QJY B;  3O6Q B;  1YIJ P;  3AEF C;  1RE3 C;  2IBZ E;  1KYO I;  3TDK A;  1RF1 A;  1OFC X;  1N73 C;  2W90 A;  2M8R A;  2OYI B;  3S9O A;  2OTJ P;  3H1I J;  1N7S D;  2M0B A;  3B5N D;  5CBN A;  5APW A;  3L73 G;  3V2N A;  1IK9 A;  1ZLL A;  5AVQ B;  5L8R J;  1USE A;  5KTB A;  2Y9Z A;  1USD A;  2QJK B;  1SQP G;  3C1L A;  4AUW A;  1LT9 B;  1VQ9 P;  1NU1 K;  1PPJ D;  2KSJ A;  1EC5 A;  3L75 D;  5B66 E;  2QA4 P;  3A0B H;  1GK4 A;  4O9B A;  3V4Q A;  1L0L D;  3H1K G;  1N7S A;  3B5N A; 
#chains in the Genus database with same CATH homology
 2KIK A;  1ZXG A;  1BDD A;  3FXD A;  1JM0 A;  1ZW0 A;  5EFW B;  1U7J A;  4K3A A;  1X0T A;  4JBZ A;  1DEE G;  4NPD A;  2WMM A;  1EDJ A;  4ASV A;  5C39 A;  1H0T B;  2P58 A;  3PH0 A;  4IOI H;  2B89 A;  2LR2 A;  5K5G B;  2LXC B;  2UWJ E;  4K35 A;  2KUB A;  4NPE A;  3MHV A;  2K3R A;  3RGU A;  2JWD A;  2I8D A;  4KJM A;  2B87 B;  3ZDM A;  1LP1 B;  4NPF X;  2M5A B;  2B88 A;  1BDC A;  4HKZ H;  2KI7 B;  1Q2N A;  1LT1 A;  1MFT A;  2RKL A;  1U7M A;  4MN4 C;  4CPG A;  1OVV A;  1SS1 A;  1NVO A;  4WWI A;  1Y47 A;  1EDL A;  5DJT B;  4GOE A;  2SPZ A;  4EYY Q;  2LXB A;  2B87 A;  4ZMD A;  1JMB A;  4BXL A;  3FXE A;  2M0B A;  1FC2 C;  1LP1 A;  5CBN A;  3QWO C;  2KS1 B;  4HJG H;  1H0T A;  4GOF A;  2QVA A;  3MZW B;  1OVR A;  2ZAE B;  1S3J A;  2HR3 A;  2OTK E;  5CBO A;  2QRX A;  4ZNC A;  3S1K A;  4ASW A;  2Q1K A;  2KZJ A;  1EDI A;  2KZI A;  5DJU B;  4HB1 A;  1EC5 A;  1OVU A;  1EDK A;  4GOD A;  2M5A A;  2R44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...