1SS1A

Staphylococcal protein a, b-domain, y15w mutant, nmr, 25 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
62
structure length
62
Chain Sequence
GSTADNKFNKEQQNAFWEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From The Cover: Testing protein-folding simulations by experiment: B domain of protein A.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
molecule keywords Immunoglobulin G binding protein A
total genus 16
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2004-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1ss1A00
2OTKE 2UWJE 4JBZA 2WMMA 2M0BA 1JMBA 1BDCA 4GODA 2B89A 2QRXA 1EC5A 4NPFX 1MFTA 2B88A 4ZMDA 1OVUA 2SPZA 5DJUB 1S3JA 2KS1B 2R44A 4CPGA 4HKZH 4ASVA 4IOIH 2HR3A 3PH0A 1ZXGA 2LXBA 2M5AA 2LXCB 4WWIA 3S1KA 1JM0A 2ZAEB 1X0TA 4HJGH 1BDDA 3QWOC 2M5AB 1LP1B 1SS1A 2I8DA 4ZNCA 3FXDA 2RKLA 1NVOA 1EDJA 1OVRA 4K3AA 4GOEA 2B87A 1Q2NA 4NPEA 4KJMA 1U7JA 4GOFA 3MZWB 1EDIA 5C39A 1LP1A 1OVVA 1Y47A 1DEEG 5K5GB 2KI7B 1ZW0A 2KZJA 4NPDA 2B87B 2KIKA 2K3RA 1U7MA 2Q1KA 3ZDMA 4MN4C 4BXLA 4HB1A 5CBOA 1H0TB 4EYYQ 5EFWB 3FXEA 3RGUA 4K35A 2QVAA 1H0TA 3MHVA 5CBNA 2KUBA 5DJTB 1EDKA 2KZIA 1FC2C 2JWDA 4ASWA 1EDLA 2LR2A 2P58A 1LT1A
chains in the Genus database with same CATH superfamily
3PRJA 3RL0D 1EZVE 3PHLA 1FS0E 3L74E 1AQTA 2YMYA 2AXTH 4L76A 4UB6H 2JJLA 2QSIA 2OYIB 1EXIA 1VPCA 2BCCJ 1S5LH 2A45I 2AEFA 2GM4A 3L75E 5B5EH 1FDIA 3H32A 2QJKB 1Q90D 2JKVA 1KYOD 5B66H 2PFXA 1VQMP 2FYUG 5APYA 3RK3C 1Y9BA 3AECC 3W68A 3IN6A 3E7KA 2W27A 3E1RA 3Q5SA 1N73C 5AW2B 3CCSP 4H44C 3ITKA 1NU1J 3L71J 4Y99C 1HVVA 1L2PA 2A06G 2HG5D 3L74D 1YJNP 2W90A 3MD0A 3BCCD 3N7NA 1GU4A 2N9BA 3L35A 2IYOA 3TGUG 2D2CB 1KD1Q 1PPJG 5AW7B 2J59M 2W6BA 1SQPD 3HD7D 5AVQB 4IOIH 1S1CX 2HR3A 2KXPB 3CCVP 1ZXGA 3B5NC 4OGQB 2O1KA 4I1LA 1VQPP 5KAIH 1ZMEC 3L72G 5KJ7A 2MJZA 2WQYC 4M3LA 1BCCG 2ZAEB 3M0DA 1KYOH 3QWOC 1S9KE 2WSEJ 1QEXA 1VQNP 1HGZA 1FZCC 5BU5A 1GMJA 5CMZA 3GHGA 5TISH 2FXMA 5KTBA 5CHXA 3L70D 2M3BA 2E5TA 2L91A 3H1IJ 3V6IA 4ZNCA 2H88C 1AVOA 4L74A 1R5SA 3G4SP 3USSA 3CCRP 3CWBE 2NRGA 2W6JH 1X79B 2C0XA 5AW5B 2H8PD 3V2NA 2QIWA 1NTKK 1L0LE 1J1DB 2P10A 2M3EA 3GLMA 1VL2A 2B87A 3TK1A 1EZVI 3VN0A 4HYTB 1Q2NA 1YQ4C 2KLUA 1GZLA 1SP4A 2Z5HA 3A0BH 5AW1B 5KLVD 3D71A 1EDIA 1BGYJ 1FZBA 1URQC 1EQ7A 1LP1A 1BGYD 1LT9A 1SQVE 2JEEA 3CWBG 1FAVA 4OGQD 1SQQG 4PD4I 1FJPA 1G2CA 3AE6C 4U7JA 2D2CD 2RN0A 2OYHB 1VQ8P 1NTMD 3H25A 1BE3D 1CSBA 1QX8A 3CX5H 1FZGA 1OMIA 2KI7B 3TDKA 2OGUA 1PGPA 2YO2A 4NPDA 1JY3O 4GDOA 4N3YB 4D6TG 5B5EE 5KLIB 1BCCJ 4RJTA 1KILC 2E74B 2OYOA 2ZT9B 1USDA 3CC4P 2KNCB 1QL2A 1PPJD 3H1JD 1AVYA 3HTKA 1BGYE 3P8CD 1M57D 1U7MA 3H1ID 1ZRTE 3L4FA 5GTHH 5AVSB 2HPCB 3TGUE 3MP7B 1E5WA 5CBOA 1H0TB 2KYVA 5AVWB 1BE3E 2PP6A 1LT9C 3M9HA 1NTME 3GF7A 4EIJA 2HLOA 2XDJA 1L0NE 1T2KD 1HJBA 1JB0J 3OW2O 3MTUE 4BRYB 2KSJA 3A0HH 3CLQA 1DH3A 3L71G 3M9QA 2QVAA 3TNUA 1Q81Q 2CPBA 2W6AA 3AE3C 1J1EB 1SVFA 1S72P 1DD4A 1FZAA 2FYNB 2WSSH 1KILB 2E74C 3L70E 3BCCJ 1ZN5A 1OW7A 3L74J 2E42A 2K9YA 3NXSA 1M56D 1FU1A 1KYOE 2XKMA 2ZT9D 1FE6A 1L0LK 1IZNB 1RE4A 1Z56A 1NTKE 2LKMA 2WPSA 1ZP0C 3B71A 3H1KD 2FXPA 3IAOA 1OXZA 4W80A 5AVZB 1KV4A 4ZKPA 1GL2C 1SLQA 2Y9YA 3C9IA 3TF5A 4LGDE 5KKZB 3RL0C 1H8AA 4O9BA 1EDLA 2BCCE 2IBZG 2QJKC 3I55P 1SQXJ 2YIUB 3MUDA 1NKZB 3BCCE 1G1JA 2BEQD 3V5BA 1NAYA 1SQBD 2M0BA 2QG4A 4WY4A 1J1EC 2JDIH 1JMBA 1NOHA 2AXCA 3CXHI 4PV1D 1BDCA 1URQA 1M1KQ 4U3FE 3RK2D 1NTZE 3H1KE 2B89A 1SQBG 1KORA 2QRXA 1MZ9A 1MFTA 3M91A 3HD7C 1K9MQ 1SQQD 1KFNA 1L4AA 2OYIA 2B88A 2N1TB 3II6A 3AE1C 4H0LB 5AW9B 1OVUA 1SQVG 3BCCG 4PJ0E 4ZMDA 1RF1C 1N2DC 1MKMA 1SQXK 1YYCA 3H32B 3P32A 1JY3N 1S3JA 1JY2P 4CPGA 1HTLC 3V2PA 2A45H 1DEBA 1KC8Q 5AVXB 2YIUC 1JMMA 3P8MC 1PP9J 1BE3J 1NYHA 2ZVNB 4WY4D 1NU1K 1N7LA 2FBWC 1K8AQ 1FZCB 3FX0A 3CPWO 2BEZF 3CXHE 1JTHB 4WY4C 2WPRA 3H6PA 3PH0A 5H2FH 1M1JA 1IO4A 3GHGB 3AE4C 3O8ZA 3W67A 1KMIZ 2JR8A 1GL2D 2HYNA 1JCDA 3LIEA 5TJHA 3CCUP 1SQPG 1AFOA 3U1CA 2QJYC 4PV1C 3HD7B 1PGQA 1X0TA 3RBZA 1QLED 1QVGO 3C8VA 4TT3H 3RK2C 1YJWP 1M90Q 1SS1A 2ZYAA 3HE4B 2YXRB 5BVZA 2J58A 3LW5J 1JNMA 1ZLLA 2PRRA 1YQ3C 5M1BA 2IYPA 1K73Q 2IZ0A 1J2JB 3MIWA 3VTPC 1M1JB 1LT9B 1OVRA 1PPJE 1CW5A 3F89A 1Y8AA 3LIDA 2OYHC 1HJ0A 1BGYG 3CWBJ 2YKOA 2RH0A 1D7MA 1LTSC 2M8RA 2A06E 3EFFK 4KJMA 3B8EB 5CCHC 1U7JA 2QJPB 4I7ZB 1IFNA 3L73J 3AEDC 1OVVA 1OW6A 3PTZA 3L36A 2HODB 1LWUB 2G8YA 2E75B 1L0ND 1SQPJ 1T8ZA 1VF5C 2MKVA 2B9BA 3HRNA 3CCMP 1MUUA 1KZUB 5E79E 1P84E 2Q9IA 4I6MC 2KZJA 2A06D 3AEEC 2WSFJ 5KLIC 1NTZK 1X8YA 2IFMA 3L71E 1GK4A 2FXOA 2E5YA 2IBZI 3CMEP 2OQQA 1MV8A 3GF3A 4JYBA 1AQ5A 3RBXA 1PGOA 5AW4B 1NTKD 2I1JA 2Q1KA 1K04A 1P84I 4BRYA 1WRGA 2ITAA 4MN4C 5AW6B 5KAFE 3SFDC 3CXHD 4BXLA 3BASA 2NPSA 3L72D 5CJ0A 5CCHA 3G71P 4C7NB 2C9LY 4YXWH 3FWLA 5EFWB 2XNDH 4H44B 2BCCD 3A3YB 2ZT9C 3FXEA 3TGUJ 1NH4A 3T97B 4D6TE 2N9YB 4WVZA 1FOSE 2JWAA 3CXHH 1HWTC 2FYUK 5TISE 1H0TA 1N7SC 3HE5B 2NZ2A 5H2FE 2D2CC 4U3FG 4IFMA 1YI2P 4OVNF 1JCCA 2ZFCA 2OTLP 3L72E 2H89C 3H1HD 1SQQE 1SQPE 4H13C 3IF4A 1ZR4A 1NTZD 2P67A 5APVA 2WTYA 2KZIA 1YITP 1JEKA 1NAFA 1KB9H 3SSUA 4H13D 1IFDA 1MFZA 2Q5UA 2AEJA 3CX5D 4PD4H 1KILA 2V7QJ 1R5LA 1L0NK 3MGNA 1NO4A 4Z1MH 2KOGA 2POHA 2K9JA 1KILE 3WU2H 3N4XA 3TYYA 3QH9A 1IK7A 4L73A 3B4SA 3KZIE 1LTJB 2IFNA 4L75A 2OTKE 2FFDB 1USEA 3PP5A 5AVTB 3FGAD 4JBZA 2AEMA 2WMMA 4H44D 1KQLA 2XV5A 1L4AB 1OZHA 4N6JA 2Y0CA 1PIXA 1GTWA 3P8CE 4YTPC 3S9OA 3CX5E 5KLVG 4RESB 1NWQA 2W8ZA 1GDTA 1LNQA 3RL0B 2C9NY 1IFPA 3VP8A 1EC5A 4NPFX 1VQLP 2K88A 3CI9A 4HH2A 2R5DA 4C7RA 2BASA 3L37A 1L0LD 1LGHB 1URQB 1EZVG 1NTMG 2YKPA 3EQ2A 1S5LX 2ZXEB 3AE2C 3KDPB 1BE3G 1T2KC 2ZVOB 3CC2P 1RY3A 4HKZH 3D6ZA 2BCCG 2IBZE 4PV1B 1SQVD 1T3UA 1BSNA 4IL6E 1SFCB 1RE3A 1VF5D 3FWNA 3H1JG 5AVVB 3V2RA 3B5NA 1LTAC 3H1LG 2YNYA 3AE7C 1SQQK 2AXTE 2Q3EA 1GU5A 1H88A 3BVHA 1N86A 2NPSC 3VMAA 3EFGA 2LXCB 1RH5B 4KT0J 4DJGA 2WPQA 4WWIA 1KQSO 1VQ4P 3CC7P 1PP9D 1LJ2A 2O01J 4LLHA 1FZCA 2P7JA 2O01H 2WPVB 1VQKP 1BDDA 1NHLA 2YKQA 4JPZB 3Q5RA 1WT6A 1JY2O 2M5AB 2H43A 1LP1B 3TNUB 1P84D 2IDBA 3LW5H 2E76D 1NTZJ 2O01N 3GHGC 5AVYB 1QVFO 3HD7A 1OW8A 2V4HA 3B5ND 3H1HJ 3KQGA 1SQQJ 2E76C 4U3FD 2R5BA 3FXDA 4QMAA 2OARA 1RF1A 1IC2A 2RKLA 3KPEA 1RE3C 4JF7A 1U57A 3V4QA 4JQ0D 4K3AA 4PJ0H 2WSFH 1N7SD 3WUVA 1JO5A 1UIXA 3VOPA 3VYIA 2K37A 4IFFA 4PD4E 3UIAA 2HODA 5GTHE 4D6TJ 1LTBC 1KTMA 3VP9A 1NKNA 3S4RA 2O3JA 2CK3H 3H1LJ 3A5TA 4GOFA 1SQXD 4N78E 2ZYGA 2HPCA 3L75J 1Y47A 1FZFA 3AEFC 1Q82Q 3ABVC 1HBWA 2JO1A 4D6TD 4GKGA 1EZVD 1DEEG 3GG2A 3VMXA 5K5GB 1TU3F 5AVUB 3SWKA 4DT0A 1RF0C 1GW3A 3H1KJ 3WUTA 1KB9D 1RQUA 1YTZI 3GW6A 5B66E 1S9KD 1AV1A 2B87B 2FY8A 4C7NA 1NGMB 1PGJA 2QE7H 1A02F 2HFED 3Q2YA 1VF5B 3G9RA 1IJDB 1L0NJ 1LTJC 1SQXE 1X22A 2Q3IA 3O6QA 4N78D 4R4MA 4ZKUA 1NJIQ 3KXDA 2WT7A 3JSVC 4IFDK 1W2EA 3I56P 1ZR2A 1Q7YQ 3CCLP 1YIJP 4OH8B 1PP9G 5APUA 1OFCX 1NTKG 2O1JA 3WMM0 5BU8B 2IX7C 3P7KA 2OYHA 4EDFA 2XU6A 2FKWB 2V7QH 3RGUA 1KILD 3HE5A 1N8RQ 1CI6B 5KJ7D 2WSEH 1BSHA 2E76B 2QM7A 1JY3P 4K35A 3L70G 5APQA 5KAIE 3L75G 3AEBC 3JCUE 3MHVA 4DOJA 5CBNA 1IK9A 5DJTB 3H1JJ 2E43A 1EDKA 5KLVE 2C0WA 3O6QB 3T97A 4Y99B 2E75C 1BCCD 5AVRB 1ZV8A 1W2BO 2I1KA 2WT7B 1LTTC 2KK7A 1FDMA 1KN7A 2NPSD 3NMDA 2R3CA 3M06A 1LTJA 3AE9C 1NU1G 1FDOA 1L0LJ 1RE4C 3OJAB 1PL5A 4H0LC 5AW8B 2Q6QA 3HUSA 2Y9ZA 1CZQA 1SFCD 1KYOI 3CD6P 1GL2A 1QL1A 1W5CE 1DX7A 4EI2A 3CMAP 3G6EP 3MUDC 1E79H 1EXJA 4H13B 1LT1A 3A0HE 2KS1A 1VDFA 3BRVB 2UWJE 3M9BA 5APXA 4DZOA 3RK3B 5KLVJ 4Y28J 4W7YA 5KAFH 4A7PA 3SWFA 2K9JB 3M0DC 3A0BE 1ZRTD 2FYNC 2QEXP 3L73E 1M7LA 1XTCC 1P84H 4GODA 4DCKA 3NFQA 1FOSF 4C46A 3D70A 1JUNA 3L73G 3G3ZA 1FJKA 4XFJA 3F5HA 2QA4P 3CCQP 3E1IA 3RK3E 1S2EA 2ZXXA 1G1IA 1RF0A 1GL2B 4I7ZC 3L70J 2WSCH 1OWAA 1L4AC 2Q7CA 2SPZA 3B5NB 3BATA 4AYCA 5DJUB 3HUSC 2KS1B 2JP3A 2R44A 1GD2E 2IPPA 1HUCA 1LWUC 2A45G 1JY2N 1K05A 1X9VA 2KSEA 2XNXA 3AE8C 1DD3A 3HE4A 4W7ZA 1L0LG 2CPSA 4ASVA 4UB6E 3WUUA 3V4WA 2E75D 3BRTB 2KLVA 3NTNA 3CX5I 1NU1E 4WB4A 1SQBJ 1M1JC 2FFDC 1A02J 3H1HE 3VMYA 3M0AA 3L75D 2LXBA 2Z4EA 2M5AA 3WU2E 1PFIA 3TGUD 2K1AA 2IZ1A 1IFIA 4H0LD 3KZIH 1SFCA 3H1LD 2KB7P 2N1TA 3S1KA 5CCGD 1RQVA 1Q86Q 1JM0A 1SQBE 2QJPC 4HJGH 1H89A 1NTZG 1YBKA 2YMKA 3IFMA 1KQFB 2DW3A 3L72J 4UB8H 1BCCE 5GTIE 4AUWA 1QGKB 2W83C 3L71D 3OA7A 1NU1D 1YHQP 1RF1B 2I8DA 5CCHD 4U3FJ 3VMZA 2FYZA 1KB9E 1NTKJ 5E79H 3SWYA 3A7OA 3JC22 3JCUH 3Q3DA 1LWUA 1SQBK 5CJ4A 3K5BA 5APWA 3EWKA 1JTHA 1OIPA 3R4YA 1HGVA 2GUVA 2PAJA 4IL6X 1KQGB 1NVOA 3H1LE 4TLFA 3C1LA 3V2QA 1SQVK 2ZYDA 1EDJA 5AW3B 4GOEA 3CL3D 1SQXG 2Y0EA 4OWFA 5APSA 4BWNA 2WWWA 2OTJP 4XA4A 1G2CB 1AA0A 4NPEA 1GW4A 4WBAA 1S5LE 2ZJSE 1OX3A 2KP8A 1L4AD 2WVRA 4PD4D 2PGDA 2QJYB 3RL0g 2H7HA 2L5GB 2N1TC 3MZWB 4IL6H 4R4LA 5C39A 3L73D 1VQOP 1HF9A 2FYUE 1GK6A 4XE5B 3KHUA 2NPSB 2XZRA 5CCGC 1URQD 4OGQC 4B86A 3CCEP 1S4XA 4RKUJ 2GUSA 3CWBD 3I5CA 3TSIA 1SQPK 1SQVJ 1N7SB 1ZW0A 3KYQA 2GA1A 1FBMA 3L74G 2J5UA 4KHXA 1DIPA 1L0NG 2KIKA 1IFMA 1KB9I 1M8OB 2P1JA 1JOCA 3AEGC 4YXDC 2K3RA 2FYUD 1NTMJ 1PP9E 3Q5PA 1LTGC 2P2UA 2VRSA 1WMKA 2YXQB 1CI6A 2WZ7A 3ZDMA 1VQ6P 4HB1A 3RK2B 4AQRD 1PV3A 2R32A 2KNCA 1XTGB 2R3SA 1PZQA 1T3JA 3H1IG 1J1DC 3HTKB 4EYYQ 5KJ7C 3SFEC 5KLVK 1N73B 3D6YA 3IR9A 4YPCA 1IFJA 1AJYA 1T6AA 2N1TD 1UIIA 5CCGA 3AE5C 1N7SA 3GMAA 2YO3A 4EOTA 2RMZA 1YTZT 4JYCA 1FZEA 1RHZB 1SFCC 2QM8A 1HH0A 1KFMA 2WITA 2FYUJ 5L8RJ 1NTMK 2OYIC 2FFDA 2KUBA 3H1KG 1YJ9P 1VQ7P 5KKZC 3PJSK 3RK3D 5AW0B 3HUSB 3R2PA 2E74D 2G3AA 4GIFA 1R8EA 3A2AA 4UB8E 3H1IE 5GTIH 3CCJP 4RO0A 2IBZD 3Q1MA 1FC2C 2Z5IA 1N73A 3OAKA 3H1JE 2JWDA 3H1HG 1ZOYC 4GT1A 3PLNA 4ASWA 1VQ9P 1LTIC 1VQ5P 4I2LC 4WY4B 5APTA 3U59A 4LC1A 2Y0DA 2LR2A 3U1AA 2WSCJ 3AEAC 2P58A
chains in the Genus database with same CATH topology
2OTKE 2UWJE 4JBZA 2WMMA 2M0BA 1JMBA 1BDCA 4GODA 2B89A 2QRXA 1EC5A 4NPFX 1MFTA 2B88A 4ZMDA 1OVUA 2SPZA 5DJUB 1S3JA 2KS1B 2R44A 4CPGA 4HKZH 4ASVA 4IOIH 2HR3A 3PH0A 1ZXGA 2LXBA 2M5AA 2LXCB 4WWIA 3S1KA 1JM0A 2ZAEB 1X0TA 4HJGH 1BDDA 3QWOC 2M5AB 1LP1B 1SS1A 2I8DA 4ZNCA 3FXDA 2RKLA 1NVOA 1EDJA 1OVRA 4K3AA 4GOEA 2B87A 1Q2NA 4NPEA 4KJMA 1U7JA 4GOFA 3MZWB 1EDIA 5C39A 1LP1A 1OVVA 1Y47A 1DEEG 5K5GB 2KI7B 1ZW0A 2KZJA 4NPDA 2B87B 2KIKA 2K3RA 1U7MA 2Q1KA 3ZDMA 4MN4C 4BXLA 4HB1A 5CBOA 1H0TB 4EYYQ 5EFWB 3FXEA 3RGUA 4K35A 2QVAA 1H0TA 3MHVA 5CBNA 2KUBA 5DJTB 1EDKA 2KZIA 1FC2C 2JWDA 4ASWA 1EDLA 2LR2A 2P58A 1LT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTK E;  2UWJ E;  4JBZ A;  2WMM A;  2M0B A;  1JMB A;  1BDC A;  4GOD A;  2B89 A;  2QRX A;  1EC5 A;  4NPF X;  1MFT A;  2B88 A;  4ZMD A;  1OVU A;  2SPZ A;  5DJU B;  1S3J A;  2KS1 B;  2R44 A;  4CPG A;  4HKZ H;  4ASV A;  4IOI H;  2HR3 A;  3PH0 A;  1ZXG A;  2LXB A;  2M5A A;  2LXC B;  4WWI A;  3S1K A;  1JM0 A;  2ZAE B;  1X0T A;  4HJG H;  1BDD A;  3QWO C;  2M5A B;  1LP1 B;  1SS1 A;  2I8D A;  4ZNC A;  3FXD A;  2RKL A;  1NVO A;  1EDJ A;  1OVR A;  4K3A A;  4GOE A;  2B87 A;  1Q2N A;  4NPE A;  4KJM A;  1U7J A;  4GOF A;  3MZW B;  1EDI A;  5C39 A;  1LP1 A;  1OVV A;  1Y47 A;  1DEE G;  5K5G B;  2KI7 B;  1ZW0 A;  2KZJ A;  4NPD A;  2B87 B;  2KIK A;  2K3R A;  1U7M A;  2Q1K A;  3ZDM A;  4MN4 C;  4BXL A;  4HB1 A;  5CBO A;  1H0T B;  4EYY Q;  5EFW B;  3FXE A;  3RGU A;  4K35 A;  2QVA A;  1H0T A;  3MHV A;  5CBN A;  2KUB A;  5DJT B;  1EDK A;  2KZI A;  1FC2 C;  2JWD A;  4ASW A;  1EDL A;  2LR2 A;  2P58 A;  1LT1 A; 
#chains in the Genus database with same CATH topology
 3PRJ A;  3RL0 D;  1EZV E;  3PHL A;  1FS0 E;  3L74 E;  1AQT A;  2YMY A;  2AXT H;  4L76 A;  4UB6 H;  2JJL A;  2QSI A;  2OYI B;  1EXI A;  1VPC A;  2BCC J;  1S5L H;  2A45 I;  2AEF A;  2GM4 A;  3L75 E;  5B5E H;  1FDI A;  3H32 A;  2QJK B;  1Q90 D;  2JKV A;  1KYO D;  5B66 H;  2PFX A;  1VQM P;  2FYU G;  5APY A;  3RK3 C;  1Y9B A;  3AEC C;  3W68 A;  3IN6 A;  3E7K A;  2W27 A;  3E1R A;  3Q5S A;  1N73 C;  5AW2 B;  3CCS P;  4H44 C;  3ITK A;  1NU1 J;  3L71 J;  4Y99 C;  1HVV A;  1L2P A;  2A06 G;  2HG5 D;  3L74 D;  1YJN P;  2W90 A;  3MD0 A;  3BCC D;  3N7N A;  1GU4 A;  2N9B A;  3L35 A;  2IYO A;  3TGU G;  2D2C B;  1KD1 Q;  1PPJ G;  5AW7 B;  2J59 M;  2W6B A;  1SQP D;  3HD7 D;  5AVQ B;  4IOI H;  1S1C X;  2HR3 A;  2KXP B;  3CCV P;  1ZXG A;  3B5N C;  4OGQ B;  2O1K A;  4I1L A;  1VQP P;  5KAI H;  1ZME C;  3L72 G;  5KJ7 A;  2MJZ A;  2WQY C;  4M3L A;  1BCC G;  2ZAE B;  3M0D A;  1KYO H;  3QWO C;  1S9K E;  2WSE J;  1QEX A;  1VQN P;  1HGZ A;  1FZC C;  5BU5 A;  1GMJ A;  5CMZ A;  3GHG A;  5TIS H;  2FXM A;  5KTB A;  5CHX A;  3L70 D;  2M3B A;  2E5T A;  2L91 A;  3H1I J;  3V6I A;  4ZNC A;  2H88 C;  1AVO A;  4L74 A;  1R5S A;  3G4S P;  3USS A;  3CCR P;  3CWB E;  2NRG A;  2W6J H;  1X79 B;  2C0X A;  5AW5 B;  2H8P D;  3V2N A;  2QIW A;  1NTK K;  1L0L E;  1J1D B;  2P10 A;  2M3E A;  3GLM A;  1VL2 A;  2B87 A;  3TK1 A;  1EZV I;  3VN0 A;  4HYT B;  1Q2N A;  1YQ4 C;  2KLU A;  1GZL A;  1SP4 A;  2Z5H A;  3A0B H;  5AW1 B;  5KLV D;  3D71 A;  1EDI A;  1BGY J;  1FZB A;  1URQ C;  1EQ7 A;  1LP1 A;  1BGY D;  1LT9 A;  1SQV E;  2JEE A;  3CWB G;  1FAV A;  4OGQ D;  1SQQ G;  4PD4 I;  1FJP A;  1G2C A;  3AE6 C;  4U7J A;  2D2C D;  2RN0 A;  2OYH B;  1VQ8 P;  1NTM D;  3H25 A;  1BE3 D;  1CSB A;  1QX8 A;  3CX5 H;  1FZG A;  1OMI A;  2KI7 B;  3TDK A;  2OGU A;  1PGP A;  2YO2 A;  4NPD A;  1JY3 O;  4GDO A;  4N3Y B;  4D6T G;  5B5E E;  5KLI B;  1BCC J;  4RJT A;  1KIL C;  2E74 B;  2OYO A;  2ZT9 B;  1USD A;  3CC4 P;  2KNC B;  1QL2 A;  1PPJ D;  3H1J D;  1AVY A;  3HTK A;  1BGY E;  3P8C D;  1M57 D;  1U7M A;  3H1I D;  1ZRT E;  3L4F A;  5GTH H;  5AVS B;  2HPC B;  3TGU E;  3MP7 B;  1E5W A;  5CBO A;  1H0T B;  2KYV A;  5AVW B;  1BE3 E;  2PP6 A;  1LT9 C;  3M9H A;  1NTM E;  3GF7 A;  4EIJ A;  2HLO A;  2XDJ A;  1L0N E;  1T2K D;  1HJB A;  1JB0 J;  3OW2 O;  3MTU E;  4BRY B;  2KSJ A;  3A0H H;  3CLQ A;  1DH3 A;  3L71 G;  3M9Q A;  2QVA A;  3TNU A;  1Q81 Q;  2CPB A;  2W6A A;  3AE3 C;  1J1E B;  1SVF A;  1S72 P;  1DD4 A;  1FZA A;  2FYN B;  2WSS H;  1KIL B;  2E74 C;  3L70 E;  3BCC J;  1ZN5 A;  1OW7 A;  3L74 J;  2E42 A;  2K9Y A;  3NXS A;  1M56 D;  1FU1 A;  1KYO E;  2XKM A;  2ZT9 D;  1FE6 A;  1L0L K;  1IZN B;  1RE4 A;  1Z56 A;  1NTK E;  2LKM A;  2WPS A;  1ZP0 C;  3B71 A;  3H1K D;  2FXP A;  3IAO A;  1OXZ A;  4W80 A;  5AVZ B;  1KV4 A;  4ZKP A;  1GL2 C;  1SLQ A;  2Y9Y A;  3C9I A;  3TF5 A;  4LGD E;  5KKZ B;  3RL0 C;  1H8A A;  4O9B A;  1EDL A;  2BCC E;  2IBZ G;  2QJK C;  3I55 P;  1SQX J;  2YIU B;  3MUD A;  1NKZ B;  3BCC E;  1G1J A;  2BEQ D;  3V5B A;  1NAY A;  1SQB D;  2M0B A;  2QG4 A;  4WY4 A;  1J1E C;  2JDI H;  1JMB A;  1NOH A;  2AXC A;  3CXH I;  4PV1 D;  1BDC A;  1URQ A;  1M1K Q;  4U3F E;  3RK2 D;  1NTZ E;  3H1K E;  2B89 A;  1SQB G;  1KOR A;  2QRX A;  1MZ9 A;  1MFT A;  3M91 A;  3HD7 C;  1K9M Q;  1SQQ D;  1KFN A;  1L4A A;  2OYI A;  2B88 A;  2N1T B;  3II6 A;  3AE1 C;  4H0L B;  5AW9 B;  1OVU A;  1SQV G;  3BCC G;  4PJ0 E;  4ZMD A;  1RF1 C;  1N2D C;  1MKM A;  1SQX K;  1YYC A;  3H32 B;  3P32 A;  1JY3 N;  1S3J A;  1JY2 P;  4CPG A;  1HTL C;  3V2P A;  2A45 H;  1DEB A;  1KC8 Q;  5AVX B;  2YIU C;  1JMM A;  3P8M C;  1PP9 J;  1BE3 J;  1NYH A;  2ZVN B;  4WY4 D;  1NU1 K;  1N7L A;  2FBW C;  1K8A Q;  1FZC B;  3FX0 A;  3CPW O;  2BEZ F;  3CXH E;  1JTH B;  4WY4 C;  2WPR A;  3H6P A;  3PH0 A;  5H2F H;  1M1J A;  1IO4 A;  3GHG B;  3AE4 C;  3O8Z A;  3W67 A;  1KMI Z;  2JR8 A;  1GL2 D;  2HYN A;  1JCD A;  3LIE A;  5TJH A;  3CCU P;  1SQP G;  1AFO A;  3U1C A;  2QJY C;  4PV1 C;  3HD7 B;  1PGQ A;  1X0T A;  3RBZ A;  1QLE D;  1QVG O;  3C8V A;  4TT3 H;  3RK2 C;  1YJW P;  1M90 Q;  1SS1 A;  2ZYA A;  3HE4 B;  2YXR B;  5BVZ A;  2J58 A;  3LW5 J;  1JNM A;  1ZLL A;  2PRR A;  1YQ3 C;  5M1B A;  2IYP A;  1K73 Q;  2IZ0 A;  1J2J B;  3MIW A;  3VTP C;  1M1J B;  1LT9 B;  1OVR A;  1PPJ E;  1CW5 A;  3F89 A;  1Y8A A;  3LID A;  2OYH C;  1HJ0 A;  1BGY G;  3CWB J;  2YKO A;  2RH0 A;  1D7M A;  1LTS C;  2M8R A;  2A06 E;  3EFF K;  4KJM A;  3B8E B;  5CCH C;  1U7J A;  2QJP B;  4I7Z B;  1IFN A;  3L73 J;  3AED C;  1OVV A;  1OW6 A;  3PTZ A;  3L36 A;  2HOD B;  1LWU B;  2G8Y A;  2E75 B;  1L0N D;  1SQP J;  1T8Z A;  1VF5 C;  2MKV A;  2B9B A;  3HRN A;  3CCM P;  1MUU A;  1KZU B;  5E79 E;  1P84 E;  2Q9I A;  4I6M C;  2KZJ A;  2A06 D;  3AEE C;  2WSF J;  5KLI C;  1NTZ K;  1X8Y A;  2IFM A;  3L71 E;  1GK4 A;  2FXO A;  2E5Y A;  2IBZ I;  3CME P;  2OQQ A;  1MV8 A;  3GF3 A;  4JYB A;  1AQ5 A;  3RBX A;  1PGO A;  5AW4 B;  1NTK D;  2I1J A;  2Q1K A;  1K04 A;  1P84 I;  4BRY A;  1WRG A;  2ITA A;  4MN4 C;  5AW6 B;  5KAF E;  3SFD C;  3CXH D;  4BXL A;  3BAS A;  2NPS A;  3L72 D;  5CJ0 A;  5CCH A;  3G71 P;  4C7N B;  2C9L Y;  4YXW H;  3FWL A;  5EFW B;  2XND H;  4H44 B;  2BCC D;  3A3Y B;  2ZT9 C;  3FXE A;  3TGU J;  1NH4 A;  3T97 B;  4D6T E;  2N9Y B;  4WVZ A;  1FOS E;  2JWA A;  3CXH H;  1HWT C;  2FYU K;  5TIS E;  1H0T A;  1N7S C;  3HE5 B;  2NZ2 A;  5H2F E;  2D2C C;  4U3F G;  4IFM A;  1YI2 P;  4OVN F;  1JCC A;  2ZFC A;  2OTL P;  3L72 E;  2H89 C;  3H1H D;  1SQQ E;  1SQP E;  4H13 C;  3IF4 A;  1ZR4 A;  1NTZ D;  2P67 A;  5APV A;  2WTY A;  2KZI A;  1YIT P;  1JEK A;  1NAF A;  1KB9 H;  3SSU A;  4H13 D;  1IFD A;  1MFZ A;  2Q5U A;  2AEJ A;  3CX5 D;  4PD4 H;  1KIL A;  2V7Q J;  1R5L A;  1L0N K;  3MGN A;  1NO4 A;  4Z1M H;  2KOG A;  2POH A;  2K9J A;  1KIL E;  3WU2 H;  3N4X A;  3TYY A;  3QH9 A;  1IK7 A;  4L73 A;  3B4S A;  3KZI E;  1LTJ B;  2IFN A;  4L75 A;  2OTK E;  2FFD B;  1USE A;  3PP5 A;  5AVT B;  3FGA D;  4JBZ A;  2AEM A;  2WMM A;  4H44 D;  1KQL A;  2XV5 A;  1L4A B;  1OZH A;  4N6J A;  2Y0C A;  1PIX A;  1GTW A;  3P8C E;  4YTP C;  3S9O A;  3CX5 E;  5KLV G;  4RES B;  1NWQ A;  2W8Z A;  1GDT A;  1LNQ A;  3RL0 B;  2C9N Y;  1IFP A;  3VP8 A;  1EC5 A;  4NPF X;  1VQL P;  2K88 A;  3CI9 A;  4HH2 A;  2R5D A;  4C7R A;  2BAS A;  3L37 A;  1L0L D;  1LGH B;  1URQ B;  1EZV G;  1NTM G;  2YKP A;  3EQ2 A;  1S5L X;  2ZXE B;  3AE2 C;  3KDP B;  1BE3 G;  1T2K C;  2ZVO B;  3CC2 P;  1RY3 A;  4HKZ H;  3D6Z A;  2BCC G;  2IBZ E;  4PV1 B;  1SQV D;  1T3U A;  1BSN A;  4IL6 E;  1SFC B;  1RE3 A;  1VF5 D;  3FWN A;  3H1J G;  5AVV B;  3V2R A;  3B5N A;  1LTA C;  3H1L G;  2YNY A;  3AE7 C;  1SQQ K;  2AXT E;  2Q3E A;  1GU5 A;  1H88 A;  3BVH A;  1N86 A;  2NPS C;  3VMA A;  3EFG A;  2LXC B;  1RH5 B;  4KT0 J;  4DJG A;  2WPQ A;  4WWI A;  1KQS O;  1VQ4 P;  3CC7 P;  1PP9 D;  1LJ2 A;  2O01 J;  4LLH A;  1FZC A;  2P7J A;  2O01 H;  2WPV B;  1VQK P;  1BDD A;  1NHL A;  2YKQ A;  4JPZ B;  3Q5R A;  1WT6 A;  1JY2 O;  2M5A B;  2H43 A;  1LP1 B;  3TNU B;  1P84 D;  2IDB A;  3LW5 H;  2E76 D;  1NTZ J;  2O01 N;  3GHG C;  5AVY B;  1QVF O;  3HD7 A;  1OW8 A;  2V4H A;  3B5N D;  3H1H J;  3KQG A;  1SQQ J;  2E76 C;  4U3F D;  2R5B A;  3FXD A;  4QMA A;  2OAR A;  1RF1 A;  1IC2 A;  2RKL A;  3KPE A;  1RE3 C;  4JF7 A;  1U57 A;  3V4Q A;  4JQ0 D;  4K3A A;  4PJ0 H;  2WSF H;  1N7S D;  3WUV A;  1JO5 A;  1UIX A;  3VOP A;  3VYI A;  2K37 A;  4IFF A;  4PD4 E;  3UIA A;  2HOD A;  5GTH E;  4D6T J;  1LTB C;  1KTM A;  3VP9 A;  1NKN A;  3S4R A;  2O3J A;  2CK3 H;  3H1L J;  3A5T A;  4GOF A;  1SQX D;  4N78 E;  2ZYG A;  2HPC A;  3L75 J;  1Y47 A;  1FZF A;  3AEF C;  1Q82 Q;  3ABV C;  1HBW A;  2JO1 A;  4D6T D;  4GKG A;  1EZV D;  1DEE G;  3GG2 A;  3VMX A;  5K5G B;  1TU3 F;  5AVU B;  3SWK A;  4DT0 A;  1RF0 C;  1GW3 A;  3H1K J;  3WUT A;  1KB9 D;  1RQU A;  1YTZ I;  3GW6 A;  5B66 E;  1S9K D;  1AV1 A;  2B87 B;  2FY8 A;  4C7N A;  1NGM B;  1PGJ A;  2QE7 H;  1A02 F;  2HFE D;  3Q2Y A;  1VF5 B;  3G9R A;  1IJD B;  1L0N J;  1LTJ C;  1SQX E;  1X22 A;  2Q3I A;  3O6Q A;  4N78 D;  4R4M A;  4ZKU A;  1NJI Q;  3KXD A;  2WT7 A;  3JSV C;  4IFD K;  1W2E A;  3I56 P;  1ZR2 A;  1Q7Y Q;  3CCL P;  1YIJ P;  4OH8 B;  1PP9 G;  5APU A;  1OFC X;  1NTK G;  2O1J A;  3WMM 0;  5BU8 B;  2IX7 C;  3P7K A;  2OYH A;  4EDF A;  2XU6 A;  2FKW B;  2V7Q H;  3RGU A;  1KIL D;  3HE5 A;  1N8R Q;  1CI6 B;  5KJ7 D;  2WSE H;  1BSH A;  2E76 B;  2QM7 A;  1JY3 P;  4K35 A;  3L70 G;  5APQ A;  5KAI E;  3L75 G;  3AEB C;  3JCU E;  3MHV A;  4DOJ A;  5CBN A;  1IK9 A;  5DJT B;  3H1J J;  2E43 A;  1EDK A;  5KLV E;  2C0W A;  3O6Q B;  3T97 A;  4Y99 B;  2E75 C;  1BCC D;  5AVR B;  1ZV8 A;  1W2B O;  2I1K A;  2WT7 B;  1LTT C;  2KK7 A;  1FDM A;  1KN7 A;  2NPS D;  3NMD A;  2R3C A;  3M06 A;  1LTJ A;  3AE9 C;  1NU1 G;  1FDO A;  1L0L J;  1RE4 C;  3OJA B;  1PL5 A;  4H0L C;  5AW8 B;  2Q6Q A;  3HUS A;  2Y9Z A;  1CZQ A;  1SFC D;  1KYO I;  3CD6 P;  1GL2 A;  1QL1 A;  1W5C E;  1DX7 A;  4EI2 A;  3CMA P;  3G6E P;  3MUD C;  1E79 H;  1EXJ A;  4H13 B;  1LT1 A;  3A0H E;  2KS1 A;  1VDF A;  3BRV B;  2UWJ E;  3M9B A;  5APX A;  4DZO A;  3RK3 B;  5KLV J;  4Y28 J;  4W7Y A;  5KAF H;  4A7P A;  3SWF A;  2K9J B;  3M0D C;  3A0B E;  1ZRT D;  2FYN C;  2QEX P;  3L73 E;  1M7L A;  1XTC C;  1P84 H;  4GOD A;  4DCK A;  3NFQ A;  1FOS F;  4C46 A;  3D70 A;  1JUN A;  3L73 G;  3G3Z A;  1FJK A;  4XFJ A;  3F5H A;  2QA4 P;  3CCQ P;  3E1I A;  3RK3 E;  1S2E A;  2ZXX A;  1G1I A;  1RF0 A;  1GL2 B;  4I7Z C;  3L70 J;  2WSC H;  1OWA A;  1L4A C;  2Q7C A;  2SPZ A;  3B5N B;  3BAT A;  4AYC A;  5DJU B;  3HUS C;  2KS1 B;  2JP3 A;  2R44 A;  1GD2 E;  2IPP A;  1HUC A;  1LWU C;  2A45 G;  1JY2 N;  1K05 A;  1X9V A;  2KSE A;  2XNX A;  3AE8 C;  1DD3 A;  3HE4 A;  4W7Z A;  1L0L G;  2CPS A;  4ASV A;  4UB6 E;  3WUU A;  3V4W A;  2E75 D;  3BRT B;  2KLV A;  3NTN A;  3CX5 I;  1NU1 E;  4WB4 A;  1SQB J;  1M1J C;  2FFD C;  1A02 J;  3H1H E;  3VMY A;  3M0A A;  3L75 D;  2LXB A;  2Z4E A;  2M5A A;  3WU2 E;  1PFI A;  3TGU D;  2K1A A;  2IZ1 A;  1IFI A;  4H0L D;  3KZI H;  1SFC A;  3H1L D;  2KB7 P;  2N1T A;  3S1K A;  5CCG D;  1RQV A;  1Q86 Q;  1JM0 A;  1SQB E;  2QJP C;  4HJG H;  1H89 A;  1NTZ G;  1YBK A;  2YMK A;  3IFM A;  1KQF B;  2DW3 A;  3L72 J;  4UB8 H;  1BCC E;  5GTI E;  4AUW A;  1QGK B;  2W83 C;  3L71 D;  3OA7 A;  1NU1 D;  1YHQ P;  1RF1 B;  2I8D A;  5CCH D;  4U3F J;  3VMZ A;  2FYZ A;  1KB9 E;  1NTK J;  5E79 H;  3SWY A;  3A7O A;  3JC2 2;  3JCU H;  3Q3D A;  1LWU A;  1SQB K;  5CJ4 A;  3K5B A;  5APW A;  3EWK A;  1JTH A;  1OIP A;  3R4Y A;  1HGV A;  2GUV A;  2PAJ A;  4IL6 X;  1KQG B;  1NVO A;  3H1L E;  4TLF A;  3C1L A;  3V2Q A;  1SQV K;  2ZYD A;  1EDJ A;  5AW3 B;  4GOE A;  3CL3 D;  1SQX G;  2Y0E A;  4OWF A;  5APS A;  4BWN A;  2WWW A;  2OTJ P;  4XA4 A;  1G2C B;  1AA0 A;  4NPE A;  1GW4 A;  4WBA A;  1S5L E;  2ZJS E;  1OX3 A;  2KP8 A;  1L4A D;  2WVR A;  4PD4 D;  2PGD A;  2QJY B;  3RL0 g;  2H7H A;  2L5G B;  2N1T C;  3MZW B;  4IL6 H;  4R4L A;  5C39 A;  3L73 D;  1VQO P;  1HF9 A;  2FYU E;  1GK6 A;  4XE5 B;  3KHU A;  2NPS B;  2XZR A;  5CCG C;  1URQ D;  4OGQ C;  4B86 A;  3CCE P;  1S4X A;  4RKU J;  2GUS A;  3CWB D;  3I5C A;  3TSI A;  1SQP K;  1SQV J;  1N7S B;  1ZW0 A;  3KYQ A;  2GA1 A;  1FBM A;  3L74 G;  2J5U A;  4KHX A;  1DIP A;  1L0N G;  2KIK A;  1IFM A;  1KB9 I;  1M8O B;  2P1J A;  1JOC A;  3AEG C;  4YXD C;  2K3R A;  2FYU D;  1NTM J;  1PP9 E;  3Q5P A;  1LTG C;  2P2U A;  2VRS A;  1WMK A;  2YXQ B;  1CI6 A;  2WZ7 A;  3ZDM A;  1VQ6 P;  4HB1 A;  3RK2 B;  4AQR D;  1PV3 A;  2R32 A;  2KNC A;  1XTG B;  2R3S A;  1PZQ A;  1T3J A;  3H1I G;  1J1D C;  3HTK B;  4EYY Q;  5KJ7 C;  3SFE C;  5KLV K;  1N73 B;  3D6Y A;  3IR9 A;  4YPC A;  1IFJ A;  1AJY A;  1T6A A;  2N1T D;  1UII A;  5CCG A;  3AE5 C;  1N7S A;  3GMA A;  2YO3 A;  4EOT A;  2RMZ A;  1YTZ T;  4JYC A;  1FZE A;  1RHZ B;  1SFC C;  2QM8 A;  1HH0 A;  1KFM A;  2WIT A;  2FYU J;  5L8R J;  1NTM K;  2OYI C;  2FFD A;  2KUB A;  3H1K G;  1YJ9 P;  1VQ7 P;  5KKZ C;  3PJS K;  3RK3 D;  5AW0 B;  3HUS B;  3R2P A;  2E74 D;  2G3A A;  4GIF A;  1R8E A;  3A2A A;  4UB8 E;  3H1I E;  5GTI H;  3CCJ P;  4RO0 A;  2IBZ D;  3Q1M A;  1FC2 C;  2Z5I A;  1N73 A;  3OAK A;  3H1J E;  2JWD A;  3H1H G;  1ZOY C;  4GT1 A;  3PLN A;  4ASW A;  1VQ9 P;  1LTI C;  1VQ5 P;  4I2L C;  4WY4 B;  5APT A;  3U59 A;  4LC1 A;  2Y0D A;  2LR2 A;  3U1A A;  2WSC J;  3AEA C;  2P58 A; 
#chains in the Genus database with same CATH homology
 2OTK E;  2UWJ E;  4JBZ A;  2WMM A;  2M0B A;  1JMB A;  1BDC A;  4GOD A;  2B89 A;  2QRX A;  1EC5 A;  4NPF X;  1MFT A;  2B88 A;  4ZMD A;  1OVU A;  2SPZ A;  5DJU B;  1S3J A;  2KS1 B;  2R44 A;  4CPG A;  4HKZ H;  4ASV A;  4IOI H;  2HR3 A;  3PH0 A;  1ZXG A;  2LXB A;  2M5A A;  2LXC B;  4WWI A;  3S1K A;  1JM0 A;  2ZAE B;  1X0T A;  4HJG H;  1BDD A;  3QWO C;  2M5A B;  1LP1 B;  1SS1 A;  2I8D A;  4ZNC A;  3FXD A;  2RKL A;  1NVO A;  1EDJ A;  1OVR A;  4K3A A;  4GOE A;  2B87 A;  1Q2N A;  4NPE A;  4KJM A;  1U7J A;  4GOF A;  3MZW B;  1EDI A;  5C39 A;  1LP1 A;  1OVV A;  1Y47 A;  1DEE G;  5K5G B;  2KI7 B;  1ZW0 A;  2KZJ A;  4NPD A;  2B87 B;  2KIK A;  2K3R A;  1U7M A;  2Q1K A;  3ZDM A;  4MN4 C;  4BXL A;  4HB1 A;  5CBO A;  1H0T B;  4EYY Q;  5EFW B;  3FXE A;  3RGU A;  4K35 A;  2QVA A;  1H0T A;  3MHV A;  5CBN A;  2KUB A;  5DJT B;  1EDK A;  2KZI A;  1FC2 C;  2JWD A;  4ASW A;  1EDL A;  2LR2 A;  2P58 A;  1LT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...