1SS6A

Solution structure of sep domain from human p47
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
GSEKRQHSSQDVHVVLKLWKSGFSLDNGELRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRDEDFVKPKGAFKAFTGEGQKLGSTAPQVLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NSFL1 cofactor p47
publication title The SEP domain of p47 acts as a reversible competitive inhibitor of cathepsin L
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 19
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2004-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08059 SEP SEP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.210 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1ss6A01
1SS6A 1VAZA
chains in the Genus database with same CATH superfamily
2KFZA 2A42A 3ULDA 3ZSWA 3AVMA 2P51A 1JCEA 4JS4A 4KREA 3UKUB 4FM0A 5KQ8A 2YNGA 4RW7A 1QQCA 2QTDA 3AY9A 4H5TA 1UA1A 4BRDA 1FKPA 5JVHL 3IDHA 3M8QA 2FF6A 4OX9K 2O8CB 3ZT2A 1YAGA 1VQNN 4DU1A 2E4LA 3VQPA 4DTXA 5AQIA 3D2EA 3SK3A 1NMDA 3O9RA 4RW9A 1J5OA 4MLHA 3R3LA 1QQMA 1VQLN 1NKEA 2G8WA 3W3DA 1LWEA 4AHCA 1KLNA 1I94K 4BRNA 3AGKA 3OBWA 5HLFA 1ZC6A 3L2QA 3SBTA 1RTHA 3OYJA 3S41A 1NJIO 5CE3A 2UUCK 3F73A 4C1NK 1KVBA 2GTDA 2P5GA 2E2OA 3ZX2A 3CHWA 4CEDA 1VQON 3U9ZA 4DU3A 4LSNA 2D4WA 1NKBA 1VSLA 4JK9A 5AZIB 3JXUA 5AQXA 4CEQA 2OZMA 2FBTA 2RF2A 1K9MO 4EAHD 4FWPA 3LPUA 3ZSOA 2NZTA 5CYMA 3S3OA 3T3FA 4HCCA 4FYDA 5KGXA 4JI0K 3WXJA 1VSMA 4JAXA 3ZSQA 4K0KK 4DV0K 4NCAA 3D2EB 3CYMA 4BRQA 3M8PA 3H46O 3VA0A 1S72N 4FLTA 3QO9A 5TKYA 3FFKB 1QE1A 4JI4K 2D5RA 5HOOA 1YITN 1EP4A 1QZ6A 1QVFM 1M1KO 4FWLA 3U4LA 1R0AA 4FJ9A 4CBXA 3WXLA 4YOTA 1SS6A 1YVNA 4IG0A 3DWLA 1CZBA 4FOEA 3KK3A 4E1NA 1BG3A 1S6QA 2V52B 4FL9A 1DEJA 4WQ5C 1VQ6N 3CCEN 1QSYA 2YCHA 2UU9K 4IO8A 3VTHA 4CFBA 3DOLA 2Q0RA 4XEIA 4IXCA 1HQEA 1CXUA 2YX6A 4CK1A 1IKVA 3L3VA 1CLQA 2F9TA 4B9TA 3O8MA 2QWMA 3HOSA 3VQ9A 4RG8A 4FJ7A 3T1YK 4O8UA 2YHYA 2UXBK 1VQ8N 3I0SA 2G8VA 2GEMA 4FWQA 4M3WA 2ASPA 3C0BA 5GAGP 4R5PA 4Z4IA 3H1QA 1S3XA 4M3XA 1RBRA 3T69A 2G8FA 3OA9A 3L2RA 1HPZA 3KJVA 3V9XA 3MEGA 3VEOA 3TAFA 4WE1A 1HYVA 1HKBA 4CEOA 3QESA 3FR0A 2BUPA 3SQ0A 4WCEL 3OYIA 4CJKA 3AVNA 1TUUA 4CF8A 2D0PA 2WFBA 5FPNA 4X65K 2QKKA 5CHIA 4CHYA 2XY7A 2ZJQL 4HUEA 3VTIA 3CETA 1NNEA 4DS4A 3WUHA 4DS5A 2UUAK 1WOQA 1KAYA 2OZSA 1IG9A 3CJ9A 4BRIA 4CHQA 3KIOA 4KHWA 1TL1A 2P9NA 3WXKA 2UXDK 3DJCA 2HNDA 3ZEUA 1T44A 1IKWA 4DTPA 2P9LA 5HRSA 2Z1JA 1W0HA 1X1PA 1NK6A 5JVGL 3SZ2A 4DMNA 3NDKA 2W6LA 1XMQK 4DQPA 1SL0A 1RBSA 3CM6A 1BIZA 4DTSA 3VF6A 3A8YA 2G8KA 3DMJA 5F2RA 1YJNN 4AHTA 3A5NC 1RT6A 2VGNA 3WQTA 3UB5A 3SMSA 3EKSA 5GAHP 4CJLA 3MMVA 3AVLA 4JD2A 1LOTB 4CD1A 4IFEA 4BE0A 3ISNC 1GLEG 3MEEA 3I56N 3K0SA 5KPRA 1N6QA 1UOCA 3HPHA 3C7NB 3TARA 4JN4A 4JKDA 2YJEA 1EKEA 1YHQN 4FJ8A 1MDUB 1MWMA 1RCHA 1JL2A 1RDBA 3C65A 1WN7A 2JWLA 3PUFA 1KRPA 4LFCK 5KI6A 2GV9A 4B9QA 4CGFA 3L4QA 1JJ2M 1RFQA 5AQNA 3SYZA 3SNNA 5I9EB 1C1CA 1I39A 3TWHA 2ZM6K 3DXKB 3NBPA 4CJSA 3LDLA 1NK7A 4F9OA 4FLZA 3OY9A 4W5NA 4F3OA 2NLXA 4E19A 4DR7K 4B1VA 3BZKA 2CH5A 1T7PA 2WC9A 2DY4A 4I9LA 2KFNA 1D5AA 1Y97A 3N4PA 3V1RA 5A2QO 3I55N 1NK4A 4LC9B 3MXJA 3LAMA 4BRMA 3O4WA 3HM8A 4F2RA 1GLJO 3SQ4A 2D0AA 4BREA 3MK6A 4JD2B 4KH6A 2W6KA 5FDLA 4M41A 1TKXA 5JMVA 4O0IA 1M90O 4JI1K 4DR1K 2O8FB 3ZT1A 2RKIA 2Z1HA 3ATVA 4OVLA 3TSPA 4BRLA 2ZWHA 3O9TA 5M1NA 3OS0A 4RW4A 2V7YA 1U6ZA 2EX3A 3BF1A 5SZTA 1KLMA 4BRFA 3FLCO 3M5RA 3VEZA 1IJJA 1KAZA 3UKRA 4DV1K 5I3UA 1Z6RA 3JSMA 4BG8A 5AQJA 1B9FA 3KLEA 2HBLA 3RRHA 1J6ZA 4FK2A 5AQHA 4DLGA 3VESA 3P38A 1KCFA 3BZCA 5FROA 1IKYA 4AHRA 4DTNA 2QWPA 2VCPA 4DTJA 3VGMA 1NGGA 5DM6L 4CBUA 3CQXA 4ZHRA 1C1AA 2A6AA 4IWVA 2FSJA 2J4RA 4IDHA 4BRCA 4KHUA 2IGIA 1BQNA 3RMDA 4DSKA 1EX4A 4KFBA 1KQSM 5AR0A 3BUZB 3ZSXA 1QSSA 4YOXA 4GV6A 4FVMA 2P9IA 3P4IA 1NJZA 4IEEA 5BRFA 4IOCL 2HHSA 3FZLA 1HX1A 3C94A 3VQ4A 2VQFK 3NMUA 4DR2K 5K14A 5EXWA 4FJIA 4H8KA 3QDKA 4B3OA 3CC7N 2YNHA 5M1PA 1ZBSA 1C1BA 3KLGA 3T7ZA 1TKZA 4O8KA 4FJHA 4JKAA 1VSIA 3QNOA 1CZAN 2ATQA 4LF6K 4FSVA 1KXPA 1NGEA 1BQMA 3EO3A 3LP2A 2ZJPL 5FLXO 3ITHA 4C8KA 2KLAA 3CC4N 2B6AA 1TK8A 4JRPA 4H0XB 2IIRA 5ADXA 1GLFO 4DV3K 4FM2A 1NGAA 4FLXA 4C8OA 2WONA 3C95A 3SQ1A 2G8UA 4JI7K 1NGCA 1OVQA 4JV5K 3H3OB 4CEZA 2E6LA 3LZIA 1VSKA 1RGIA 4YY3K 3SUQA 4FK0A 5MLCQ 2HVIA 3MDQA 2VYPA 3OVNA 5BR8K 2P9IB 1YTAA 5DMRA 1VQ4N 1KSPA 3AO3A 1QZ5A 1JL1A 5FRMA 4DSEA 1LV5A 2H3GX 3THWA 3CI5A 1YIJN 4FLVA 1C0GA 3NF9A 3QEPA 4H5RA 4BVOA 2KHOA 1HMVA 1KD1O 2JLEA 1NBWA 2GUIA 3OS1A 3VQAA 1YJ9N 1W9HA 3OYKA 4HUGA 3MN5A 3J7ZO 4B9SA 1A5XA 1RBUA 2RHKA 3ID6A 3FZMA 2Q3SA 4O5FA 4AQYK 3EZWA 5CZ1A 2NRVA 4BR4A 3S3NA 4PL7A 4DR4K 4DF4A 2BTFA 3VF2A 3HPGA 3DYAA 3K58A 1NGJA 3IRXA 4BE1A 3ASMA 4Z4EA 4M45A 1NLVA 1VQ5N 4CHZA 4MO5A 3WNGA 2V51B 3OW2M 1OH5A 1JCFA 2FBXA 1B9DA 3KWIA 2HSTA 5AZJB 1XWLA 1J53A 3G4SN 1HYSA 3V9ZA 3KLIA 1OH7A 3MWTA 1Q86O 3EY1A 1YT3A 4YDUA 2IOCA 3THXA 3AO1A 4FLYA 1N5YA 3VPZA 2QK9A 3KLHA 4M3ZA 4LF9K 4E7HA 4JKFA 3RVCA 4A59A 1P90A 3E9LA 2ZJRL 4N47A 3CPWM 3BEXA 4DV2K 5CR4A 3HL8A 3AVIA 3THWB 4RW8A 2O8BA 4KTZA 3GDQA 3O08A 1VQMN 5M1KA 4CJRA 1U45A 4B3MK 4B9NA 1HNZK 3AAQA 3R8EA 3NF7A 1RDCA 2QI2A 4ELUA 3TAPA 3GG4A 4KPYA 3PIPL 2O4IA 2G8HA 5ADXH 4CF0A 4CZGA 3CCUN 3ZX0A 3HT3A 3CFPA 3VOVA 2FLOA 3P39A 4DSIA 1X3MA 3TR8A 2Q36A 2YV0X 3DLGA 3VQ6A 4B3TK 4CEEA 3O3FA 4CCHA 4JI8K 4M3TA 1XHXA 3TAEA 4PWDA 1XI1A 1MU2A 2EHGA 1WUAA 1JLQA 4NCGA 1KVCA 2FF3B 3O9QA 3THXB 1TGOA 3QINA 2E1ZA 2A40A 3OJUA 5AZIA 1OH8A 4KB1A 5D3GA 3EL2A 1UA0A 5EY4A 4C8NA 4HCBA 3C6AA 2O8BB 4PL8A 1TK5A 4FPBA 2IAJA 4CZMA 3BY5A 1VHXA 2QWLA 1K6YA 4PKGA 3G71N 4NLBA 3TU5A 3M6GA 4CJVA 1RDWX 3KTQA 3TSQA 4FJLA 1NJXA 2PYJA 2PZSA 3OYNA 1BA0A 2AJQA 2YNIA 4JI5K 3K57A 1C0TA 3BGRA 3DI6A 3DOKA 5LMNK 2QXFA 2F7TA 3FGUA 3P1GA 2YHWA 4B1WB 3HP9A 4FJXA 2GBZA 2VG5A 4A61A 1NKCA 4KH5A 1Q81O 1LAVA 4QS8A 3LP3A 1SAZA 4N5SA 3SUOA 4QAGA 3NGYA 2D0BA 1BWFO 2AP1A 3O9UA 1RNHA 4WFAL 5GIOA 3S3MA 3LDQA 4E0DA 3VQQA 1U2VB 3VEYA 1SV5A 4IDKA 3VQEA 4A62A 3NGZA 4CZFA 4F4KA 5AQOA 3SV4A 3CD6N 2OPPA 1VQ9N 4OKEA 1KC8O 2P9PA 3THVA 3KK1A 2F4VK 3HP6A 5F1XA 4DHYA 3DRRA 3HI0A 4FJ5A 3QEVA 4OPJA 4BDPA 3QFPA 2UXCK 4OPHA 1EETA 1NGHA 4CZKA 1O1WA 1X9WA 2HHHK 2QWNA 4CK2A 2FSNA 4J8FA 3SLCA 4H4MA 3N4QA 3OYAA 2CGLA 3LDOA 1YXQA 4H0TB 3VERA 4K8ZA 3OYBA 4GKJK 3HJFA 4QS9A 4CZJA 1HKGA 4CZLA 4B9MA 4CEAA 1LW0A 1WSEA 4BE2A 4HTLA 2Z1IA 4L3QA 4AHUA 3E9OA 3QNNA 1RILA 3HK2A 3OYEA 3OBYA 4O44A 5IWAK 3HO1A 5BR9A 3NGIA 2W42A 2I7NA 1VSEA 4CW7B 1HYZA 3OYFA 3MN6A 4OLAA 4NYNA 4JK7A 4O55A 4FJMA 4EP4A 3VQDA 4CFDA 3HPOA 4YNQA 2WOMA 2OA8A 1ZYQA 1GLDG 4DR5K 4FLUA 1BI4A 4WQ4A 1RTJA 2XY5A 4ID1A 1HJRA 3PLAA 1L5UA 2P9PB 3K5NA 3QICA 4YOWA 4BVPA 3DRSA 4CJEA 2PYLA 3CCSN 4AHVA 3CM5A 5KRTA 4F2SA 4U7BA 3MXIA 4CJWA 3VEVA 2YI1A 5AQZA 4Y1CA 2R7YA 3BDPA 3MCPA 1LWFA 3U3YA 3V1OA 1VQ7N 2YNFA 3C7NA 3IFRA 4BRAA 3TI0A 2NRXA 3RMAA 3LWMA 3VQ8A 4BQZA 4JYAK 4AH9A 1D8YA 4IOAL 1RDDA 3EEQA 2ITMA 4BRHA 4GV3A 2CGJA 3AV9A 1QHTA 5E84A 1RT5A 3UE5A 1HJOA 3ZLJA 4Z0UA 3VMFB 1X9MA 3JS6A 4DQRA 4KHPK 4K43A 5TKWA 4PA1A 4J2AA 3T1HK 4E1MA 3AVJA 1YVUA 1SKSA 4JKGA 4LD0A 4RCHA 4TSXA 3DXKA 3V9SA 2NRWA 3QEXA 3MWPA 3CMAN 4NB4A 5C15A 2KQ2A 1WLJA 3ZETB 3P5JA 1BI4B 1WAJA 4YDUC 4Y1DA 3CPEA 3SPZA 2XHBA 4BRGA 4A5AA 1JKHA 2A41A 3CFRA 5FPEA 5M1FA 3NE6A 5HBMA 1ZBHA 2GWJA 4JS5A 4KHSA 3HSCA 3TAGA 2W40A 3IAYA 1VQPN 4JI2K 1ITGA 4H03B 4OJRA 3RSEA 2O8FA 4FJGA 1CZ9A 2XY8A 3LAKA 3OYGA 4DSJA 1VSJA 1QHAA 1Y64A 1ILYA 3R1XA 3H3NO 4CJQA 3KK7A 1QS4A 4G9ZA 1JLEA 4W5RA 4OKKA 5HL7L 1NGFA 2X78A 3FFIA 1JLCA 1NGBA 1SQKA 5CY4A 3U3GA 1V4TA 5JICA 3QEWA 5E26A 1GLBG 4DF8A 4JRQA 1X3NA 2A1RA 1FW6A 4JKGB 3OYMA 3ENOA 1OKJA 3QIOA 1VAZA 1SL1A 2E20A 3E01A 4CF1A 2YKMA 4CJ7A 2GELA 2Q1NA 5KTQA 4K8XA 4BY9C 1GOAA 4DV6K 5EOYA 2HVHA 1IBLK 2HHVA 3CJ7A 2QWOA 2ASOA 3F9KA 4KO0A 4PKHA 2OYQA 3TSUA 4BC5A 1MA9B 1LAWA 3L2VA 5CZ2A 4H0PA 1HQUA 1T3VA 2PFUA 3RR7A 4KHNA 3ZT4A 1WBBA 1HPMA 1GOBA 5JS2A 2HHUA 1BHLA 4H5NA 3D0PA 4LSLA 3RSEB 3J81O 5M1QA 2E1YA 2KZMA 3M8RA 4KBOA 3C6TA 4NXNK 4ELVA 3O80A 2HF4A 1IBMK 5AQUA 3ZSYA 4YFUA 3FZKA 2HBMA 5ELZA 4FWRA 3C6HA 4OGEA 4FM1A 4BR7A 2D0OA 2HMIA 2P9SB 4YOVA 2B5JA 4LFAK 1QTMA 3TAMA 1GLCG 1G99A 4W5TA 1TUYA 3BF3A 3CXCM 4LY7A 4XIUA 2GUPA 2E2NA 1VSDA 4A2BA 1Q8IA 4E89A 4BRPA 3CERA 4ISFA 5AQPA 2A1SA 2ZE2A 4BWJA 2P9KA 4E7IA 1N8RO 3TTDA 1MWKA 3LZJA 4I2PA 3AO4A 5KQDA 4QOZB 1W2BM 4DR3K 3PX0A 2BE2A 3HYFA 4HVJA 4CZIA 4DU4A 4DG1A 3SJHA 3CJAA 1TKDA 3HOTA 1L3UA 1QVGM 2WBNA 2VG7A 4CBWA 3O3HA 2CGKA 3HXMA 3F9MA 2B4JA 3ZYYX 4ZTJA 2QW9A 4YHHK 2QWQA 2ZQBA 4BDZA 4DTMA 1QSLA 1NJYA 3O4QA 3NH2A 2I5JA 3LWLA 3Q7BA 4M3RA 1BGXT 5LY3A 2OTLN 3RMBA 4BR0A 1NWKA 1S6PA 2ZGYA 4CJ3A 3NVKA 5H1SQ 5IT9O 3P31A 4H5WA 5HROA 1ATRA 4W5QA 2FC0A 3AVCA 1JCGA 4N76A 4CHOA 3K59A 5AZJA 4CJUA 1VRUA 3DLHA 3QBWA 4FOIA 4WQ4C 3A5MC 4I9QA 4Z4FA 5BPLA 2ZF5O 2F9WA 3LM9A 4CGDA 1L3VA 5C0YA 2P9KB 2IVNA 4JKEA 4CHPA 1ZBUA 4GW6A 4E7LA 2O8DA 3ZT0A 3LM2A 1TL3A 3L4IA 4JK8A 3OS2A 5KPZA 5AQYA 4JKCA 5J2NA 4AM7A 3PX6A 3MCAB 4H0YB 4YORA 1QQOA 1DTTA 3QBXA 4FXDA 3U8XA 4CJTA 1W97L 4JKBA 1NMNA 4DSLA 4H4OA 5SWMA 5AQVA 3QETA 5EVZA 3RWUA 2JWKA 5AQWA 1YF5L 4B1ZA 4B8CA 3RRGA 4X66K 3QEIA 2HBJA 3K2PA 5LL6Z 4FZYA 1TV6A 3D45A 4AF1A 4B1XB 1WSHA 4ISGA 3SQ2A 1KTQA 3VQ5A 4LF7K 2YKNA 3L8BA 2HF3A 2KKZA 5GADP 2OPSA 1IO2A 5FRNA 3HVTA 1U47A 2CH6A 3M8SA 3O9SA 4XH4A 3V9UA 1A5WA 3S9HA 4FWOA 4L8RB 1S1WA 4K25A 1K8KB 3D6RA 3ZX3A 4MLEA 3RR8A 1WBDA 1T6DA 5EX5A 3LL3A 4BC2A 1NK0A 2O8DB 1TYQA 1RT4A 3OTOK 4DUZK 1YJWN 4B9LA 2O8EA 5B8HA 4M3UA 1NGDA 1IV0A 1DTQA 1HLUA 5DK5A 1XC9A 4CEFA 2XY6A 3VEXA 1RT7A 3J80O 3M3ZA 4DSFA 2V7ZA 4EZ6A 2Z1GA 4NCBA 3IKMA 3HM9A 3CQYA 4J2EA 4JKHA 5C10A 3KWGA 1IBKK 5FPMA 5JS1A 3KK2A 4IFVA 4WFBL 3CJ1A 3EYZA 4GY2B 2E2PA 1RDUA 3AA2A 2EWSA 3ALYA 4KHQA 4HHTA 4M3YA 3MX2A 3ULEA 4DQQA 2Y1IA 1CXQA 5GINA 1JLBA 4J2DA 4IG3A 2FXUA 5AQFA 1E4FT 3HZ6A 3O6WA 1NM1A 2OPQA 2GWKA 3CJCA 3EE8A 5FPDA 4KKOA 1U2VA 2YHAA 1NG9A 4YOYA 3L2UA 2X74A 1GOCA 3WEEA 3B6OA 3K9JA 4WF9L 3DM2A 4RTFD 1OVYA 2XRIA 1TYQB 1C0FA 3FE1A 2O8EB 3IS9A 3PSIA 3ZSVA 1N32K 3NHGA 4DFMA 2QXLA 2HHTA 4A57A 1D4XA 5HRNA 2PY5A 3TPQA 2RN2A 4ELTA 4CVNE 1RBVA 1RTDA 4WYBA 2VGMA 2G8IA 1HNWK 1FXXA 2X6SA 2IVPA 3QERA 3JYTA 1RBTA 3D2FA 3HRGA 4FCYA 4AILC 4FO0A 4FK4A 4IOXA 4IJNA 4OLBA 4H5VA 4MFBA 4ILHA 4BC3A 4E1JA 4GMJB 1JLAA 1Z05A 2D0CA 2O4GA 1WSGA 5T7BA 2DTUA 4DTUA 1ZBLA 3DRPA 2HHWA 5KPTA 3ULEB 2BGGA 4B3RK 1IG8A 1UAXA 2IC3A 4Z4GA 3L2WA 3TAQA 4DQSA 2OPRA 3RTVA 4QCLA 3GOIA 4Q5VA 2VWKA 1VRTA 2KW4A 4Z4CA 2WUSA 5JLHA 5C2FA 1U4BA 4IFYA 4DLEA 4M7YA 3WEEB 1ZBFA 1JLGA 3SUNA 4BROA 3MN9A 5HRRA 1FKOA 4ILJA 3G0ZA 4LF4K 2OCEA 2HNYA 3EKUA 3QLHA 3KKRA 4RW6A 4ID5A 4BC4A 4OPKA 3B8AX 1IH7A 3DLEA 3F2KA 3QIPA 1R59O 4LF5K 4KB0A 1B92A 5J1EA 3ENBA 1ESVA 5HP1A 3D2FB 5C42A 3LDSA 4FJNA 4O4GA 4CFAA 5AQKA 1NGIA 2NRZA 3VETA 4FW1A 2RPIA 3O3GA 2IDOA 4DV4K 4UY8O 3KD1E 1LCUA 1S9EA 4GNIA 2DFFA 1NJWA 4FZZA 3V81A 4O5BA 4JEPA 3TANA 1BDGA 1C6VA 1N36K 4NO7A 3G25A 1C0UA 1U04A 3E9PA 4QS7A 2DPNA 3PIOL 4C1NI 3CCLN 4I6MA 4CIGA 4JLHA 4DQIA 1JLFA 4DV5K 4B3SK 4KI4A 3R6MA 5JLFA 3J7YP 3OYLA 3ZETA 5AQMA 2I7PA 4BR9A 1EXQA 3SBGA 3AA5X 1Z26A 4PKIA 3PV8A 1KAXA 5AFUA 3MXMA 4FWNA 2HNZA 4B9UA 3CF5L 4EHTA 2XO7A 3SAFA 1JXBA 1T8EA 3KD5E 3HTVA 1DLOA 1ASVA 4JI6K 2YJFA 5AJ3K 1VK0A 4CF2A 4I7FA 4JI3K 1XNQK 1NK9A 4KV8A 1UWBA 2NRTA 4BQLA 2UUBK 1O13A 5I42A 2HHQA 3SMPA 1ZBIA 2LSNA 4AHSA 4EP5A 4BR5A 2W41A 4K42A 1VSFA 4BWMA 4C8LA 1SL2A 1Q18A 3CIPA 5BN8A 2QM1A 4OKJA 5C12A 1T03A 3IUCA 1Q82O 2HHXA 3CG7A 4DKWA 3FZHA 1WB9A 3AVGA 1HRHA 1S1TA 3VN5A 4NYFA 3CJBA 3VQ7A 1YI2N 3O1BA 4NLCA 4Z4HA 2Y1JA 2Q2RA 3VGLA 3H1VX 4IO9L 4DUYK 1T05A 4I6MB 4MO4A 2KZZA 4CJPA 5BRDA 4PHTX 4DFPA 3FZFA 1HKCA 1RT2A 1DKGD 4LH4A 3BP8A 2NRRA 4BGAA 1Q9YA 5LJWA 1WSIA 1RDAA 4LH5A 4FWKA 4BDYA 5E41A 3SAGA 4ZTFA 1NOYA 1IKXA 5LJVA 3SAHA 1HUXA 3WQUA 4CECA 1JXEA 3LP1A 5GIPA 2HB5A 3OYDA 4DV7K 4CGIA 3K5LA 4CJ5A 2QA4N 3NF8A 3E1YA 3TABA 5AQTA 1S1UA 4W5OA 3NFAA 5HRPA 1S9GA 3GE1A 4CJFA 4PY5A 3R9PA 4F8RA 3QB0A 1XNRK 4XH1A 4CZEA 4V19S 4KAZA 1HNIA 4IJAA 3DLLL 4WFNL 3CC2N 3V1QA 3H08A 4A2AA 2IS3A 3PY8A 1J9AA 3A0IX 3A5LC 4OGCA 1TK0A 2P9SA 3CFOA 2WTUA 2E8AA 2P9UA 2ZD1A 3C6UA 3MECA 4ISEA 4Q0BA 1REVA 2HBKA 5KGWA 5AFUH 4KRFA 3I8BA 1TAUA 1YUWA 1KFSA 3DLRA 4H0OA 1L3SA 4EZ9A 2JGUA 4KTQA 1RTIA 3L0QA 4JNEA 3TTCA 4X62K 1E3MA 1FJGK 4E7JA 1XMOK 4CHNA 2X6NA 1WAFA 2ETJA 2P9NB 4B1UB 4B8AB 2GX9A 2ITGA 3AVAA 3ZEUB 3K5OA 2Q31A 4GVEA 2P9LB 4EHUA 4CK3A 3QFUA 4KH4A 1TKTA 4A5BA 5CYQA 1ZXOA 2E2QA 3KZBA 3DLBA 3WNHA 2HMPA 4N56A 3JAMO 2AA4A 4EFHA 1EWQA 3PSFA 4B9VA 1XC3A 3I8DA 4DCHA 4CD3A 4BRKA 1BL3A 4DTOA 1K73O 1YTUA 4BGBA 1A5VA 4FPAA 4XH5A 1FK9A 4X64K 5AQSA 4CIFA 2BDPA 2A3ZA 2FBVA 1DT9A 3K5MA 3D7EO 1NU0A 3UIQA 1H1VA 1N33K 1WSJA 1NOZA 1DGKN 3ZSRA 2VQEK 3DAWA 2A5XA 3SV3A 4M7XA 3P83D 3J7AP 3MAQA 1BISA 5J2PA 1NK5A 2P9UB 3HSTB 4N41A 3CCVN 1WSFA 3MN7A 3RMCA 3VF4A 3O4NA 4FWSA 5BPMA 4JHDA 2F96A 1S22A 3TTFA 3PO5A 3J8AA 4E3SA 1D9DA 3VENA 1X9SA 2OTJN 4FZXC 5GAEP 3MEDA 2F8TA 3V9WA 5C2DA 3SI6A 4IZ9A 4C8MA 3NH1A 4YOUA 1HR0K 1BIUA 3EZ5A 3SCXA 3NH0A 3ZT3A 4GVMA 1VQKN 1J5EK 3VGKA 1HNXK 4DR6K 3VEWA 4CI6A 4CE9A 4RWTA 5EU7A 1LW2A 1BOTO 2VG6A 2Q97A 3W0LA 2PBDA 3AVHA 2BANA 3DXMA 4IBNA 4LF8K 4B1YB 4ICLA 3VQBA 3LANA 3H45C 1BO5O 4GV9A 3NVMA 3OYHA 1U48A 1W7AA 2NRHA 4OO1J 1SKRA 3H6EA 2NNWA 1BA1A 1RT3A 2YHXA 4B08A 4NXMK 3M1FA 3DLKA 5M1OA 4FWMA 1SZ2A 3CCQN 3GBTA 3WNEA 1EQYA 3UKRB 4Z94A 3O1WA 1S1XA 1J54A 5AQLA 3QMLA 2DFHA 2HOEA 4MDBA 5BREA 4JHDB 3O5BA 4KHYA 5J2QA 3AARA 1S1VA 2IVOA 1K8KA 3ATUA 3OJSA 3G10A 3ZSZA 4CESA 2NUBA 3NCIA 4WQ5A 4KTWA 4IKFA 1BCMA 3B6PA 3CQ8A 3GL1A 3KKSA 2DFEA 4DQ8A 3THYA 4CGJA 1XHZA 4CERA 3ZCMA 3KLFA 3ENHA 4LFBK 1TVRA 1Q7YO 3A2FA 3U6FA 4DWIA 4Y0WA 1XUPO 1U49A 3VA3A 1V4SA 3SPYA 2PAVA 5F0XA 2FSKA 2VWJA 2OANA 1SKWA 1EO1A 3DXMB 2E88A 4DB3A 1WNSA 2QWRA 3EN9A 3I0RA 3L6QA 3LDPA 4CGGA 3WNFA 4UQGA 1Q9XA 4ILGB 4CEBA 2ASMA 3I33A 4CZHA 4BR2A 3AAPA 2QKBA 3V6DA 4BACA 3AGRA 5AQQA 1N34K 1EWRA 2Q0UA 4F3TA 4GKKK 3T1AA 3WXMB 1BUPA 3CMEN 2F8SA 4DFJA 1OH6A 1X9JA 3V4IA 4AM6A 3CCMN 5BRHA 1XQSC 1TAQA 4CF9A 3AO2A 3HBTA 3CCRN 3A5OC 3L3UA 1I3AA 4HTUA 5BPNA 1HNVA 4IEIA 3F5TA 1F21A 3Q7CA 3IG1A 5AQGA 2D1KA 1GLAG 5LMUK 3E66A 1C0MA 3VQCA 2BH1A 3THYB 5DM7L 3AA3A 1ATSA 4U67L 3T19A 2P1JA 4I2QA 4PQUA 1ASUA 1P8ZA 3LPTA 3AVBA 4C23A 4DTRA 3AO5A 3KVGA 2UYTA 4HUFA 2ZGZA 4E7KA 2RE2A 3U9DA 3UKUA 4R79A 1T6CA 5BN9A 4M42A 4CFCA 4CIEA 5AQRA 2YHBA 2HW3A 3NF6A 3ID8A 4CJ4A 1KVAA 1L3TA 2O8CA 3SJJA 1NK8A 1BU6O 3SUPA 4K41A 4M63C 4G1QA 3HVRA 4OPAA 4H0VB 5KRSA 2E5LK 3LDNA 3OYCA 3PX4A 4FLWA 1D9FA 3AVFA 3AVKA 3LALA 1RT1A 4J2BA 2E6MA 3NAEA 3WXIA 1ATNA 1Z25A 4EIAA 1KFDA 3CCJN 4MQ3A 2KTQA 4FVUA 1SUQA 1S5JA 4DFKA 2P5OA 2VWBA 1G15A 3MX5A 3G6EN 4FJJA 1LWCA 5C25A 3K9KA 4FW2A 1BCOA 3LP0A 4MDAA 1GLLO 3PO4A 4FJKA 1QQNA 4HWIA 3OHRA 3KHYA 5J2MA 4O0JA 1E4GT 1ASWA 4BG9A 4CGHA 2QEXN 2FBYA 4PUOA 3EE9A 1K8AO 5C24A 3WT0A 1VSHA 4KI6A 3IMXA 3AA4A
chains in the Genus database with same CATH topology
2YJFA 2A42A 4H0PA 1VQ4N 1T3VA 2PFUA 1JCEA 3UKUB 5KQ8A 1HPMA 1QZ5A 2QTDA 3AY9A 4H5TA 2NRTA 4H5NA 4BQLA 4BRDA 3RSEB 2H3GX 1O13A 3IDHA 5JVHL 3SMPA 3CI5A 1YIJN 5M1QA 1C0GA 2E1YA 2FF6A 4H5RA 4BVOA 4BR5A 2W41A 2KHOA 4KBOA 1KD1O 1NBWA 4K42A 1YAGA 1YJ9N 1VQNN 3MN5A 1Q18A 3CIPA 2HF4A 3O80A 2QM1A 5BN8A 3J7ZO 5C12A 3IUCA 5AQUA 1Q82O 5AQIA 3FZKA 2HBMA 3D2EA 3SK3A 4DKWA 5ELZA 3FZHA 2RHKA 3ID6A 3FZMA 1NMDA 3O9RA 4O5FA 4FWRA 3CJBA 4MLHA 1YI2N 3EZWA 3O1BA 3R3LA 4NLCA 2NRVA 1QQMA 3C6HA 1VQLN 4BR4A 4BR7A 4PL7A 2Q2RA 3W3DA 3VGLA 3H1VX 2D0OA 2BTFA 3VF2A 4IO9L 2P9SB 4I6MB 4BRNA 1NGJA 4MO4A 4YOVA 3AGKA 3OBWA 5BRDA 4PHTX 1ZC6A 3FZFA 1HKCA 1NLVA 1VQ5N 1DKGD 1GLCG 4MO5A 1G99A 2V51B 3OW2M 3BP8A 1TUYA 3SBTA 3BF3A 2NRRA 4BGAA 3S41A 1NJIO 5CE3A 5LJWA 3CXCM 1JCFA 4C1NK 3KWIA 2HSTA 4FWKA 5AZJB 3SAGA 2GUPA 2GTDA 2E2NA 2E2OA 3ZX2A 3G4SN 4A2BA 5LJVA 3MWTA 3CHWA 4BRPA 1HUXA 3SAHA 3CERA 1Q86O 1VQON 4YDUA 4ISFA 3U9ZA 3WQUA 5AQPA 3VPZA 2D4WA 4JK9A 5AZIB 3JXUA 5AQXA 5GIPA 4JKFA 2P9KA 3RVCA 1K9MO 4EAHD 4A59A 2QA4N 1P90A 3E9LA 4FWPA 3TTDA 3CPWM 3BEXA 1MWKA 2ZJRL 1N8RO 3E1YA 5CR4A 2NZTA 5KQDA 5AQTA 1W2BM 3GE1A 3GDQA 3O08A 1VQMN 4CZIA 3R9PA 5M1KA 3QB0A 3AAQA 3R8EA 3WXJA 4XH1A 3SJHA 4CZEA 4JAXA 3CJAA 4IJAA 3DLLL 3HOTA 2QI2A 1QVGM 2WBNA 4WFNL 3GG4A 3CC2N 4CBWA 2CGKA 3D2EB 3F9MA 3ZYYX 3PIPL 4BRQA 2QW9A 5ADXH 3H46O 4CZGA 3CCUN 3ZX0A 1S72N 4A2AA 2QWQA 3VOVA 3A0IX 2FLOA 3A5LC 5TKYA 3P39A 3FFKB 1X3MA 2P9SA 3Q7BA 5HOOA 1YITN 1QVFM 1QZ6A 2E8AA 2P9UA 2Q36A 2OTLN 4ISEA 5LY3A 1M1KO 2HBKA 4BR0A 4FWLA 3U4LA 1NWKA 2ZGYA 3NVKA 5AFUH 4CBXA 3I8BA 5H1SQ 3P31A 4H5WA 3WXLA 4YOTA 1ATRA 1SS6A 1YUWA 1YVNA 3DWLA 4FOEA 1JCGA 4H0OA 5AZJA 1WUAA 1BG3A 2V52B 4FL9A 4WQ5C 1DEJA 1VQ6N 3L0QA 4JNEA 3TTCA 2FF3B 3CCEN 2YCHA 3QBWA 4FOIA 4WQ4C 3A5MC 4IO8A 3O9QA 2P9NB 3VTHA 4B1UB 5BPLA 2ZF5O 2GX9A 2Q0RA 4XEIA 4IXCA 2E1ZA 2F9WA 3ZEUB 2A40A 2Q31A 3LM9A 2YX6A 4GVEA 2P9LB 5AZIA 5C0YA 4EHUA 2F9TA 2P9KB 3QFUA 3EL2A 4KH4A 4A5BA 2IVNA 2QWMA 1ZXOA 3O8MA 4JKEA 5EY4A 3HOSA 3C6AA 2E2QA 3KZBA 2HMPA 4PL8A 2AA4A 3LM2A 3L4IA 4FPBA 2YHYA 4JK8A 4O8UA 4CZMA 4EFHA 1VQ8N 2GEMA 4FWQA 5KPZA 4DCHA 2ASPA 3C0BA 2QWLA 4PKGA 5AQYA 3G71N 4JKCA 4CD3A 5GAGP 4BRKA 3H1QA 1S3XA 4NLBA 3TU5A 4AM7A 1K73O 3MCAB 3M6GA 4H0YB 1QQOA 4YORA 1RDWX 3T69A 3OA9A 3TSQA 3QBXA 4BGBA 4FPAA 4XH5A 5AQSA 3U8XA 1W97L 4JKBA 1BA0A 2A3ZA 3VEOA 1DT9A 1HKBA 3D7EO 2BUPA 3FR0A 1H1VA 4WCEL 5AQVA 1DGKN 5EVZA 2JWKA 3DAWA 1YF5L 5AQWA 4B1ZA 2A5XA 2F7TA 1TUUA 4M7XA 3FGUA 4B1WB 2YHWA 2D0PA 2WFBA 5FPNA 5CHIA 2P9UB 2HBJA 4B1XB 4A61A 4AF1A 2ZJQL 4ISGA 4KH5A 3VTIA 3CCVN 1Q81O 3CETA 4QS8A 3WUHA 3MN7A 2HF3A 2KKZA 1SAZA 3VF4A 5GADP 4FWSA 1WOQA 5BPMA 1KAYA 1BWFO 4JHDA 3CJ9A 2AP1A 3O9UA 3TTFA 1S22A 2CH6A 4BRIA 4WFAL 3O9SA 4XH4A 3J8AA 5GIOA 3VENA 4FWOA 2P9NA 3WXKA 3LDQA 4K25A 2OTJN 1K8KB 3D6RA 3DJCA 3ZX3A 5GAEP 3ZEUA 4MLEA 1U2VB 1T44A 3VEYA 2P9LA 5C2DA 4IZ9A 4A62A 4YOUA 4CZFA 5JVGL 5AQOA 1T6DA 5EX5A 3CD6N 3LL3A 4BC2A 1VQ9N 1KC8O 1TYQA 2P9PA 1YJWN 1VQKN 3VGKA 5F1XA 5B8HA 3VF6A 3A8YA 3HI0A 1NGDA 5F2RA 3VEWA 4DHYA 1YJNN 1HLUA 4CI6A 4RWTA 3A5NC 2VGNA 3QFPA 3WQTA 1BOTO 3UB5A 2Q97A 4OPHA 3SMSA 1NGHA 3EKSA 3W0LA 4CZKA 2PBDA 5GAHP 3VEXA 3MMVA 4JD2A 4CD1A 1LOTB 3DXMA 4IFEA 3M3ZA 1GLEG 2QWNA 4B1YB 3I56N 2V7ZA 2FSNA 5KPRA 3IKMA 4J8FA 3SLCA 3CQYA 3C7NB 3H45C 1BO5O 4GV9A 3N4QA 4JKHA 3NVMA 4JN4A 4JKDA 2CGLA 2YJEA 3LDOA 1YXQA 4H0TB 5C10A 1YHQN 2NRHA 3KWGA 1MDUB 3VERA 4OO1J 3H6EA 2NNWA 5FPMA 1MWMA 1BA1A 2YHXA 4QS9A 4CZJA 4WFBL 1HKGA 4CZLA 3C65A 3CJ1A 3M1FA 2JWLA 4GY2B 2E2PA 5M1OA 1RDUA 4FWMA 1SZ2A 3CCQN 2EWSA 3GBTA 4B9QA 1EQYA 3UKRB 3L4QA 4Z94A 3O1WA 1JJ2M 1RFQA 5AQNA 4HTLA 5AQLA 3MX2A 4L3QA 3QMLA 3ULEA 2HOEA 3E9OA 4MDBA 5BREA 4JHDB 5I9EB 3O5BA 5GINA 3OBYA 2FXUA 5AQFA 1E4FT 5BR9A 3HZ6A 3AARA 2I7NA 1NM1A 3O6WA 2GWKA 2IVOA 3DXKB 3CJCA 3EE8A 3MN6A 5FPDA 1K8KA 3ATUA 3LDLA 4JK7A 1U2VA 4YOYA 4WQ5A 4F9OA 1GLDG 3WEEA 4WQ4A 3GL1A 2NLXA 4DQ8A 3K9JA 4B1VA 3ENHA 4WF9L 3PLAA 4RTFD 1OVYA 2CH5A 1TYQB 2P9PB 1Q7YO 1C0FA 3FE1A 2WC9A 3QICA 4YOWA 4BVPA 2QXLA 4Y0WA 1XUPO 3N4PA 4A57A 3I55N 1D4XA 4LC9B 3CCSN 1V4SA 3TPQA 4BRMA 3O4WA 2PAVA 3HM8A 5F0XA 2FSKA 1GLJO 4WYBA 4U7BA 2VGMA 2OANA 2YI1A 3VEVA 4BREA 3MK6A 5AQZA 4JD2B 4KH6A 1EO1A 3DXMB 2E88A 4DB3A 5JMVA 2QWRA 1M90O 2IVPA 3EN9A 3MCPA 3L6QA 3LDPA 3D2FA 1VQ7N 3HRGA 3ATVA 3TSPA 3C7NA 3IFRA 4FO0A 4BRLA 2ZWHA 4ILGB 2ASMA 3I33A 3O9TA 4IOXA 4BRAA 4BR2A 4CZHA 4IJNA 2NRXA 3AAPA 5M1NA 4H5VA 4BQZA 2V7YA 4IOAL 4ILHA 3AGRA 5AQQA 1U6ZA 2Q0UA 2ITMA 4BC3A 4BRHA 3BF1A 2CGJA 4E1JA 4GV3A 5E84A 3WXMB 1BUPA 3CMEN 1Z05A 4BRFA 1X9JA 3FLCO 3M5RA 3UE5A 4AM6A 1HJOA 3VEZA 1IJJA 3VMFB 1KAZA 3JS6A 1XQSC 3UKRA 5BRHA 3CCMN 1Z6RA 3HBTA 3CCRN 5KPTA 4BG8A 5AQJA 3ULEB 2HBLA 3A5OC 4K43A 1J6ZA 5BPNA 1IG8A 5AQHA 3P38A 4IEIA 3F5TA 5TKWA 3VESA 3Q7CA 5AQGA 4JKGA 2QWPA 2D1KA 2VCPA 3DXKA 3GOIA 4RCHA 1NGGA 3VGMA 5DM6L 4CBUA 2NRWA 1GLAG 3CQXA 5JLHA 2WUSA 3MWPA 5C2FA 3CMAN 4NB4A 5C15A 3E66A 2A6AA 4IWVA 4M7YA 2FSJA 2J4RA 3WEEB 3ZETB 4IDHA 4YDUC 2BH1A 3CPEA 4BRCA 5DM7L 1ATSA 4BROA 4U67L 3MN9A 4ILJA 1KQSM 5AR0A 3BUZB 4BRGA 3EKUA 1P8ZA 4A5AA 4C23A 4YOXA 4GV6A 4BC4A 3KVGA 3B8AX 2A41A 2P9IA 3P4IA 5FPEA 2UYTA 5M1FA 4IEEA 3F2KA 5BRFA 1R59O 4IOCL 2ZGZA 3FZLA 2GWJA 3IMXA 3HSCA 2RE2A 3U9DA 3UKUA 1HX1A 4R79A 2W40A 1T6CA 5BN9A 3NMUA 1VQPN 5EXWA 4H03B 3ENBA 1ESVA 3QDKA 5AQRA 3D2FB 3RSEA 3CC7N 3ID8A 5AQKA 1NGIA 2NRZA 5M1PA 3VETA 1ZBSA 3T7ZA 4UY8O 1LCUA 1QHAA 4GNIA 4JKAA 4O8KA 1Y64A 1BU6O 1ILYA 3R1XA 3H3NO 4K41A 4M63C 1CZAN 3KK7A 4G9ZA 4FSVA 4JEPA 1KXPA 1NGEA 3EO3A 4OPAA 4H0VB 2ZJPL 3LDNA 2KLAA 5HL7L 3CC4N 1BDGA 1NGFA 1NGBA 1SQKA 1V4TA 4NO7A 3G25A 5JICA 4H0XB 3WXIA 1GLBG 1ATNA 2IIRA 5E26A 3E9PA 4QS7A 4EIAA 5ADXA 2DPNA 3CCJN 1GLFO 1X3NA 3PIOL 1NGAA 4C1NI 4JKGB 3CCLN 4I6MA 4FVUA 3ENOA 2VWBA 1OKJA 1VAZA 3MX5A 3G6EN 2E20A 1NGCA 4CJ7A 3K9KA 2GELA 2Q1NA 3H3OB 3R6MA 5JLFA 4MDAA 1GLLO 3ZETA 5AQMA 4BY9C 2I7PA 1QQNA 5EOYA 4BR9A 4HWIA 3OHRA 3SBGA 3KHYA 1RGIA 3CJ7A 4PKIA 1E4GT 1KAXA 2QWOA 4BG9A 5AFUA 2ASOA 4PKHA 2QEXN 4FWNA 5MLCQ 3EE9A 3CF5L 3TSUA 4EHTA 1K8AO 4BC5A 3SAFA 3MDQA 3WT0A 2VYPA 1MA9B 1XC3A 2P9IB 3HTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SS6 A;  1VAZ A; 
#chains in the Genus database with same CATH topology
 2KFZ A;  2A42 A;  3ULD A;  3ZSW A;  3AVM A;  2P51 A;  1JCE A;  4JS4 A;  4KRE A;  3UKU B;  4FM0 A;  5KQ8 A;  2YNG A;  4RW7 A;  1QQC A;  2QTD A;  3AY9 A;  4H5T A;  1UA1 A;  4BRD A;  1FKP A;  5JVH L;  3IDH A;  3M8Q A;  2FF6 A;  4OX9 K;  2O8C B;  3ZT2 A;  1YAG A;  1VQN N;  4DU1 A;  2E4L A;  3VQP A;  4DTX A;  5AQI A;  3D2E A;  3SK3 A;  1NMD A;  3O9R A;  4RW9 A;  1J5O A;  4MLH A;  3R3L A;  1QQM A;  1VQL N;  1NKE A;  2G8W A;  3W3D A;  1LWE A;  4AHC A;  1KLN A;  1I94 K;  4BRN A;  3AGK A;  3OBW A;  5HLF A;  1ZC6 A;  3L2Q A;  3SBT A;  1RTH A;  3OYJ A;  3S41 A;  1NJI O;  5CE3 A;  2UUC K;  3F73 A;  4C1N K;  1KVB A;  2GTD A;  2P5G A;  2E2O A;  3ZX2 A;  3CHW A;  4CED A;  1VQO N;  3U9Z A;  4DU3 A;  4LSN A;  2D4W A;  1NKB A;  1VSL A;  4JK9 A;  5AZI B;  3JXU A;  5AQX A;  4CEQ A;  2OZM A;  2FBT A;  2RF2 A;  1K9M O;  4EAH D;  4FWP A;  3LPU A;  3ZSO A;  2NZT A;  5CYM A;  3S3O A;  3T3F A;  4HCC A;  4FYD A;  5KGX A;  4JI0 K;  3WXJ A;  1VSM A;  4JAX A;  3ZSQ A;  4K0K K;  4DV0 K;  4NCA A;  3D2E B;  3CYM A;  4BRQ A;  3M8P A;  3H46 O;  3VA0 A;  1S72 N;  4FLT A;  3QO9 A;  5TKY A;  3FFK B;  1QE1 A;  4JI4 K;  2D5R A;  5HOO A;  1YIT N;  1EP4 A;  1QZ6 A;  1QVF M;  1M1K O;  4FWL A;  3U4L A;  1R0A A;  4FJ9 A;  4CBX A;  3WXL A;  4YOT A;  1SS6 A;  1YVN A;  4IG0 A;  3DWL A;  1CZB A;  4FOE A;  3KK3 A;  4E1N A;  1BG3 A;  1S6Q A;  2V52 B;  4FL9 A;  1DEJ A;  4WQ5 C;  1VQ6 N;  3CCE N;  1QSY A;  2YCH A;  2UU9 K;  4IO8 A;  3VTH A;  4CFB A;  3DOL A;  2Q0R A;  4XEI A;  4IXC A;  1HQE A;  1CXU A;  2YX6 A;  4CK1 A;  1IKV A;  3L3V A;  1CLQ A;  2F9T A;  4B9T A;  3O8M A;  2QWM A;  3HOS A;  3VQ9 A;  4RG8 A;  4FJ7 A;  3T1Y K;  4O8U A;  2YHY A;  2UXB K;  1VQ8 N;  3I0S A;  2G8V A;  2GEM A;  4FWQ A;  4M3W A;  2ASP A;  3C0B A;  5GAG P;  4R5P A;  4Z4I A;  3H1Q A;  1S3X A;  4M3X A;  1RBR A;  3T69 A;  2G8F A;  3OA9 A;  3L2R A;  1HPZ A;  3KJV A;  3V9X A;  3MEG A;  3VEO A;  3TAF A;  4WE1 A;  1HYV A;  1HKB A;  4CEO A;  3QES A;  3FR0 A;  2BUP A;  3SQ0 A;  4WCE L;  3OYI A;  4CJK A;  3AVN A;  1TUU A;  4CF8 A;  2D0P A;  2WFB A;  5FPN A;  4X65 K;  2QKK A;  5CHI A;  4CHY A;  2XY7 A;  2ZJQ L;  4HUE A;  3VTI A;  3CET A;  1NNE A;  4DS4 A;  3WUH A;  4DS5 A;  2UUA K;  1WOQ A;  1KAY A;  2OZS A;  1IG9 A;  3CJ9 A;  4BRI A;  4CHQ A;  3KIO A;  4KHW A;  1TL1 A;  2P9N A;  3WXK A;  2UXD K;  3DJC A;  2HND A;  3ZEU A;  1T44 A;  1IKW A;  4DTP A;  2P9L A;  5HRS A;  2Z1J A;  1W0H A;  1X1P A;  1NK6 A;  5JVG L;  3SZ2 A;  4DMN A;  3NDK A;  2W6L A;  1XMQ K;  4DQP A;  1SL0 A;  1RBS A;  3CM6 A;  1BIZ A;  4DTS A;  3VF6 A;  3A8Y A;  2G8K A;  3DMJ A;  5F2R A;  1YJN N;  4AHT A;  3A5N C;  1RT6 A;  2VGN A;  3WQT A;  3UB5 A;  3SMS A;  3EKS A;  5GAH P;  4CJL A;  3MMV A;  3AVL A;  4JD2 A;  1LOT B;  4CD1 A;  4IFE A;  4BE0 A;  3ISN C;  1GLE G;  3MEE A;  3I56 N;  3K0S A;  5KPR A;  1N6Q A;  1UOC A;  3HPH A;  3C7N B;  3TAR A;  4JN4 A;  4JKD A;  2YJE A;  1EKE A;  1YHQ N;  4FJ8 A;  1MDU B;  1MWM A;  1RCH A;  1JL2 A;  1RDB A;  3C65 A;  1WN7 A;  2JWL A;  3PUF A;  1KRP A;  4LFC K;  5KI6 A;  2GV9 A;  4B9Q A;  4CGF A;  3L4Q A;  1JJ2 M;  1RFQ A;  5AQN A;  3SYZ A;  3SNN A;  5I9E B;  1C1C A;  1I39 A;  3TWH A;  2ZM6 K;  3DXK B;  3NBP A;  4CJS A;  3LDL A;  1NK7 A;  4F9O A;  4FLZ A;  3OY9 A;  4W5N A;  4F3O A;  2NLX A;  4E19 A;  4DR7 K;  4B1V A;  3BZK A;  2CH5 A;  1T7P A;  2WC9 A;  2DY4 A;  4I9L A;  2KFN A;  1D5A A;  1Y97 A;  3N4P A;  3V1R A;  5A2Q O;  3I55 N;  1NK4 A;  4LC9 B;  3MXJ A;  3LAM A;  4BRM A;  3O4W A;  3HM8 A;  4F2R A;  1GLJ O;  3SQ4 A;  2D0A A;  4BRE A;  3MK6 A;  4JD2 B;  4KH6 A;  2W6K A;  5FDL A;  4M41 A;  1TKX A;  5JMV A;  4O0I A;  1M90 O;  4JI1 K;  4DR1 K;  2O8F B;  3ZT1 A;  2RKI A;  2Z1H A;  3ATV A;  4OVL A;  3TSP A;  4BRL A;  2ZWH A;  3O9T A;  5M1N A;  3OS0 A;  4RW4 A;  2V7Y A;  1U6Z A;  2EX3 A;  3BF1 A;  5SZT A;  1KLM A;  4BRF A;  3FLC O;  3M5R A;  3VEZ A;  1IJJ A;  1KAZ A;  3UKR A;  4DV1 K;  5I3U A;  1Z6R A;  3JSM A;  4BG8 A;  5AQJ A;  1B9F A;  3KLE A;  2HBL A;  3RRH A;  1J6Z A;  4FK2 A;  5AQH A;  4DLG A;  3VES A;  3P38 A;  1KCF A;  3BZC A;  5FRO A;  1IKY A;  4AHR A;  4DTN A;  2QWP A;  2VCP A;  4DTJ A;  3VGM A;  1NGG A;  5DM6 L;  4CBU A;  3CQX A;  4ZHR A;  1C1A A;  2A6A A;  4IWV A;  2FSJ A;  2J4R A;  4IDH A;  4BRC A;  4KHU A;  2IGI A;  1BQN A;  3RMD A;  4DSK A;  1EX4 A;  4KFB A;  1KQS M;  5AR0 A;  3BUZ B;  3ZSX A;  1QSS A;  4YOX A;  4GV6 A;  4FVM A;  2P9I A;  3P4I A;  1NJZ A;  4IEE A;  5BRF A;  4IOC L;  2HHS A;  3FZL A;  1HX1 A;  3C94 A;  3VQ4 A;  2VQF K;  3NMU A;  4DR2 K;  5K14 A;  5EXW A;  4FJI A;  4H8K A;  3QDK A;  4B3O A;  3CC7 N;  2YNH A;  5M1P A;  1ZBS A;  1C1B A;  3KLG A;  3T7Z A;  1TKZ A;  4O8K A;  4FJH A;  4JKA A;  1VSI A;  3QNO A;  1CZA N;  2ATQ A;  4LF6 K;  4FSV A;  1KXP A;  1NGE A;  1BQM A;  3EO3 A;  3LP2 A;  2ZJP L;  5FLX O;  3ITH A;  4C8K A;  2KLA A;  3CC4 N;  2B6A A;  1TK8 A;  4JRP A;  4H0X B;  2IIR A;  5ADX A;  1GLF O;  4DV3 K;  4FM2 A;  1NGA A;  4FLX A;  4C8O A;  2WON A;  3C95 A;  3SQ1 A;  2G8U A;  4JI7 K;  1NGC A;  1OVQ A;  4JV5 K;  3H3O B;  4CEZ A;  2E6L A;  3LZI A;  1VSK A;  1RGI A;  4YY3 K;  3SUQ A;  4FK0 A;  5MLC Q;  2HVI A;  3MDQ A;  2VYP A;  3OVN A;  5BR8 K;  2P9I B;  1YTA A;  5DMR A;  1VQ4 N;  1KSP A;  3AO3 A;  1QZ5 A;  1JL1 A;  5FRM A;  4DSE A;  1LV5 A;  2H3G X;  3THW A;  3CI5 A;  1YIJ N;  4FLV A;  1C0G A;  3NF9 A;  3QEP A;  4H5R A;  4BVO A;  2KHO A;  1HMV A;  1KD1 O;  2JLE A;  1NBW A;  2GUI A;  3OS1 A;  3VQA A;  1YJ9 N;  1W9H A;  3OYK A;  4HUG A;  3MN5 A;  3J7Z O;  4B9S A;  1A5X A;  1RBU A;  2RHK A;  3ID6 A;  3FZM A;  2Q3S A;  4O5F A;  4AQY K;  3EZW A;  5CZ1 A;  2NRV A;  4BR4 A;  3S3N A;  4PL7 A;  4DR4 K;  4DF4 A;  2BTF A;  3VF2 A;  3HPG A;  3DYA A;  3K58 A;  1NGJ A;  3IRX A;  4BE1 A;  3ASM A;  4Z4E A;  4M45 A;  1NLV A;  1VQ5 N;  4CHZ A;  4MO5 A;  3WNG A;  2V51 B;  3OW2 M;  1OH5 A;  1JCF A;  2FBX A;  1B9D A;  3KWI A;  2HST A;  5AZJ B;  1XWL A;  1J53 A;  3G4S N;  1HYS A;  3V9Z A;  3KLI A;  1OH7 A;  3MWT A;  1Q86 O;  3EY1 A;  1YT3 A;  4YDU A;  2IOC A;  3THX A;  3AO1 A;  4FLY A;  1N5Y A;  3VPZ A;  2QK9 A;  3KLH A;  4M3Z A;  4LF9 K;  4E7H A;  4JKF A;  3RVC A;  4A59 A;  1P90 A;  3E9L A;  2ZJR L;  4N47 A;  3CPW M;  3BEX A;  4DV2 K;  5CR4 A;  3HL8 A;  3AVI A;  3THW B;  4RW8 A;  2O8B A;  4KTZ A;  3GDQ A;  3O08 A;  1VQM N;  5M1K A;  4CJR A;  1U45 A;  4B3M K;  4B9N A;  1HNZ K;  3AAQ A;  3R8E A;  3NF7 A;  1RDC A;  2QI2 A;  4ELU A;  3TAP A;  3GG4 A;  4KPY A;  3PIP L;  2O4I A;  2G8H A;  5ADX H;  4CF0 A;  4CZG A;  3CCU N;  3ZX0 A;  3HT3 A;  3CFP A;  3VOV A;  2FLO A;  3P39 A;  4DSI A;  1X3M A;  3TR8 A;  2Q36 A;  2YV0 X;  3DLG A;  3VQ6 A;  4B3T K;  4CEE A;  3O3F A;  4CCH A;  4JI8 K;  4M3T A;  1XHX A;  3TAE A;  4PWD A;  1XI1 A;  1MU2 A;  2EHG A;  1WUA A;  1JLQ A;  4NCG A;  1KVC A;  2FF3 B;  3O9Q A;  3THX B;  1TGO A;  3QIN A;  2E1Z A;  2A40 A;  3OJU A;  5AZI A;  1OH8 A;  4KB1 A;  5D3G A;  3EL2 A;  1UA0 A;  5EY4 A;  4C8N A;  4HCB A;  3C6A A;  2O8B B;  4PL8 A;  1TK5 A;  4FPB A;  2IAJ A;  4CZM A;  3BY5 A;  1VHX A;  2QWL A;  1K6Y A;  4PKG A;  3G71 N;  4NLB A;  3TU5 A;  3M6G A;  4CJV A;  1RDW X;  3KTQ A;  3TSQ A;  4FJL A;  1NJX A;  2PYJ A;  2PZS A;  3OYN A;  1BA0 A;  2AJQ A;  2YNI A;  4JI5 K;  3K57 A;  1C0T A;  3BGR A;  3DI6 A;  3DOK A;  5LMN K;  2QXF A;  2F7T A;  3FGU A;  3P1G A;  2YHW A;  4B1W B;  3HP9 A;  4FJX A;  2GBZ A;  2VG5 A;  4A61 A;  1NKC A;  4KH5 A;  1Q81 O;  1LAV A;  4QS8 A;  3LP3 A;  1SAZ A;  4N5S A;  3SUO A;  4QAG A;  3NGY A;  2D0B A;  1BWF O;  2AP1 A;  3O9U A;  1RNH A;  4WFA L;  5GIO A;  3S3M A;  3LDQ A;  4E0D A;  3VQQ A;  1U2V B;  3VEY A;  1SV5 A;  4IDK A;  3VQE A;  4A62 A;  3NGZ A;  4CZF A;  4F4K A;  5AQO A;  3SV4 A;  3CD6 N;  2OPP A;  1VQ9 N;  4OKE A;  1KC8 O;  2P9P A;  3THV A;  3KK1 A;  2F4V K;  3HP6 A;  5F1X A;  4DHY A;  3DRR A;  3HI0 A;  4FJ5 A;  3QEV A;  4OPJ A;  4BDP A;  3QFP A;  2UXC K;  4OPH A;  1EET A;  1NGH A;  4CZK A;  1O1W A;  1X9W A;  2HHH K;  2QWN A;  4CK2 A;  2FSN A;  4J8F A;  3SLC A;  4H4M A;  3N4Q A;  3OYA A;  2CGL A;  3LDO A;  1YXQ A;  4H0T B;  3VER A;  4K8Z A;  3OYB A;  4GKJ K;  3HJF A;  4QS9 A;  4CZJ A;  1HKG A;  4CZL A;  4B9M A;  4CEA A;  1LW0 A;  1WSE A;  4BE2 A;  4HTL A;  2Z1I A;  4L3Q A;  4AHU A;  3E9O A;  3QNN A;  1RIL A;  3HK2 A;  3OYE A;  3OBY A;  4O44 A;  5IWA K;  3HO1 A;  5BR9 A;  3NGI A;  2W42 A;  2I7N A;  1VSE A;  4CW7 B;  1HYZ A;  3OYF A;  3MN6 A;  4OLA A;  4NYN A;  4JK7 A;  4O55 A;  4FJM A;  4EP4 A;  3VQD A;  4CFD A;  3HPO A;  4YNQ A;  2WOM A;  2OA8 A;  1ZYQ A;  1GLD G;  4DR5 K;  4FLU A;  1BI4 A;  4WQ4 A;  1RTJ A;  2XY5 A;  4ID1 A;  1HJR A;  3PLA A;  1L5U A;  2P9P B;  3K5N A;  3QIC A;  4YOW A;  4BVP A;  3DRS A;  4CJE A;  2PYL A;  3CCS N;  4AHV A;  3CM5 A;  5KRT A;  4F2S A;  4U7B A;  3MXI A;  4CJW A;  3VEV A;  2YI1 A;  5AQZ A;  4Y1C A;  2R7Y A;  3BDP A;  3MCP A;  1LWF A;  3U3Y A;  3V1O A;  1VQ7 N;  2YNF A;  3C7N A;  3IFR A;  4BRA A;  3TI0 A;  2NRX A;  3RMA A;  3LWM A;  3VQ8 A;  4BQZ A;  4JYA K;  4AH9 A;  1D8Y A;  4IOA L;  1RDD A;  3EEQ A;  2ITM A;  4BRH A;  4GV3 A;  2CGJ A;  3AV9 A;  1QHT A;  5E84 A;  1RT5 A;  3UE5 A;  1HJO A;  3ZLJ A;  4Z0U A;  3VMF B;  1X9M A;  3JS6 A;  4DQR A;  4KHP K;  4K43 A;  5TKW A;  4PA1 A;  4J2A A;  3T1H K;  4E1M A;  3AVJ A;  1YVU A;  1SKS A;  4JKG A;  4LD0 A;  4RCH A;  4TSX A;  3DXK A;  3V9S A;  2NRW A;  3QEX A;  3MWP A;  3CMA N;  4NB4 A;  5C15 A;  2KQ2 A;  1WLJ A;  3ZET B;  3P5J A;  1BI4 B;  1WAJ A;  4YDU C;  4Y1D A;  3CPE A;  3SPZ A;  2XHB A;  4BRG A;  4A5A A;  1JKH A;  2A41 A;  3CFR A;  5FPE A;  5M1F A;  3NE6 A;  5HBM A;  1ZBH A;  2GWJ A;  4JS5 A;  4KHS A;  3HSC A;  3TAG A;  2W40 A;  3IAY A;  1VQP N;  4JI2 K;  1ITG A;  4H03 B;  4OJR A;  3RSE A;  2O8F A;  4FJG A;  1CZ9 A;  2XY8 A;  3LAK A;  3OYG A;  4DSJ A;  1VSJ A;  1QHA A;  1Y64 A;  1ILY A;  3R1X A;  3H3N O;  4CJQ A;  3KK7 A;  1QS4 A;  4G9Z A;  1JLE A;  4W5R A;  4OKK A;  5HL7 L;  1NGF A;  2X78 A;  3FFI A;  1JLC A;  1NGB A;  1SQK A;  5CY4 A;  3U3G A;  1V4T A;  5JIC A;  3QEW A;  5E26 A;  1GLB G;  4DF8 A;  4JRQ A;  1X3N A;  2A1R A;  1FW6 A;  4JKG B;  3OYM A;  3ENO A;  1OKJ A;  3QIO A;  1VAZ A;  1SL1 A;  2E20 A;  3E01 A;  4CF1 A;  2YKM A;  4CJ7 A;  2GEL A;  2Q1N A;  5KTQ A;  4K8X A;  4BY9 C;  1GOA A;  4DV6 K;  5EOY A;  2HVH A;  1IBL K;  2HHV A;  3CJ7 A;  2QWO A;  2ASO A;  3F9K A;  4KO0 A;  4PKH A;  2OYQ A;  3TSU A;  4BC5 A;  1MA9 B;  1LAW A;  3L2V A;  5CZ2 A;  4H0P A;  1HQU A;  1T3V A;  2PFU A;  3RR7 A;  4KHN A;  3ZT4 A;  1WBB A;  1HPM A;  1GOB A;  5JS2 A;  2HHU A;  1BHL A;  4H5N A;  3D0P A;  4LSL A;  3RSE B;  3J81 O;  5M1Q A;  2E1Y A;  2KZM A;  3M8R A;  4KBO A;  3C6T A;  4NXN K;  4ELV A;  3O80 A;  2HF4 A;  1IBM K;  5AQU A;  3ZSY A;  4YFU A;  3FZK A;  2HBM A;  5ELZ A;  4FWR A;  3C6H A;  4OGE A;  4FM1 A;  4BR7 A;  2D0O A;  2HMI A;  2P9S B;  4YOV A;  2B5J A;  4LFA K;  1QTM A;  3TAM A;  1GLC G;  1G99 A;  4W5T A;  1TUY A;  3BF3 A;  3CXC M;  4LY7 A;  4XIU A;  2GUP A;  2E2N A;  1VSD A;  4A2B A;  1Q8I A;  4E89 A;  4BRP A;  3CER A;  4ISF A;  5AQP A;  2A1S A;  2ZE2 A;  4BWJ A;  2P9K A;  4E7I A;  1N8R O;  3TTD A;  1MWK A;  3LZJ A;  4I2P A;  3AO4 A;  5KQD A;  4QOZ B;  1W2B M;  4DR3 K;  3PX0 A;  2BE2 A;  3HYF A;  4HVJ A;  4CZI A;  4DU4 A;  4DG1 A;  3SJH A;  3CJA A;  1TKD A;  3HOT A;  1L3U A;  1QVG M;  2WBN A;  2VG7 A;  4CBW A;  3O3H A;  2CGK A;  3HXM A;  3F9M A;  2B4J A;  3ZYY X;  4ZTJ A;  2QW9 A;  4YHH K;  2QWQ A;  2ZQB A;  4BDZ A;  4DTM A;  1QSL A;  1NJY A;  3O4Q A;  3NH2 A;  2I5J A;  3LWL A;  3Q7B A;  4M3R A;  1BGX T;  5LY3 A;  2OTL N;  3RMB A;  4BR0 A;  1NWK A;  1S6P A;  2ZGY A;  4CJ3 A;  3NVK A;  5H1S Q;  5IT9 O;  3P31 A;  4H5W A;  5HRO A;  1ATR A;  4W5Q A;  2FC0 A;  3AVC A;  1JCG A;  4N76 A;  4CHO A;  3K59 A;  5AZJ A;  4CJU A;  1VRU A;  3DLH A;  3QBW A;  4FOI A;  4WQ4 C;  3A5M C;  4I9Q A;  4Z4F A;  5BPL A;  2ZF5 O;  2F9W A;  3LM9 A;  4CGD A;  1L3V A;  5C0Y A;  2P9K B;  2IVN A;  4JKE A;  4CHP A;  1ZBU A;  4GW6 A;  4E7L A;  2O8D A;  3ZT0 A;  3LM2 A;  1TL3 A;  3L4I A;  4JK8 A;  3OS2 A;  5KPZ A;  5AQY A;  4JKC A;  5J2N A;  4AM7 A;  3PX6 A;  3MCA B;  4H0Y B;  4YOR A;  1QQO A;  1DTT A;  3QBX A;  4FXD A;  3U8X A;  4CJT A;  1W97 L;  4JKB A;  1NMN A;  4DSL A;  4H4O A;  5SWM A;  5AQV A;  3QET A;  5EVZ A;  3RWU A;  2JWK A;  5AQW A;  1YF5 L;  4B1Z A;  4B8C A;  3RRG A;  4X66 K;  3QEI A;  2HBJ A;  3K2P A;  5LL6 Z;  4FZY A;  1TV6 A;  3D45 A;  4AF1 A;  4B1X B;  1WSH A;  4ISG A;  3SQ2 A;  1KTQ A;  3VQ5 A;  4LF7 K;  2YKN A;  3L8B A;  2HF3 A;  2KKZ A;  5GAD P;  2OPS A;  1IO2 A;  5FRN A;  3HVT A;  1U47 A;  2CH6 A;  3M8S A;  3O9S A;  4XH4 A;  3V9U A;  1A5W A;  3S9H A;  4FWO A;  4L8R B;  1S1W A;  4K25 A;  1K8K B;  3D6R A;  3ZX3 A;  4MLE A;  3RR8 A;  1WBD A;  1T6D A;  5EX5 A;  3LL3 A;  4BC2 A;  1NK0 A;  2O8D B;  1TYQ A;  1RT4 A;  3OTO K;  4DUZ K;  1YJW N;  4B9L A;  2O8E A;  5B8H A;  4M3U A;  1NGD A;  1IV0 A;  1DTQ A;  1HLU A;  5DK5 A;  1XC9 A;  4CEF A;  2XY6 A;  3VEX A;  1RT7 A;  3J80 O;  3M3Z A;  4DSF A;  2V7Z A;  4EZ6 A;  2Z1G A;  4NCB A;  3IKM A;  3HM9 A;  3CQY A;  4J2E A;  4JKH A;  5C10 A;  3KWG A;  1IBK K;  5FPM A;  5JS1 A;  3KK2 A;  4IFV A;  4WFB L;  3CJ1 A;  3EYZ A;  4GY2 B;  2E2P A;  1RDU A;  3AA2 A;  2EWS A;  3ALY A;  4KHQ A;  4HHT A;  4M3Y A;  3MX2 A;  3ULE A;  4DQQ A;  2Y1I A;  1CXQ A;  5GIN A;  1JLB A;  4J2D A;  4IG3 A;  2FXU A;  5AQF A;  1E4F T;  3HZ6 A;  3O6W A;  1NM1 A;  2OPQ A;  2GWK A;  3CJC A;  3EE8 A;  5FPD A;  4KKO A;  1U2V A;  2YHA A;  1NG9 A;  4YOY A;  3L2U A;  2X74 A;  1GOC A;  3WEE A;  3B6O A;  3K9J A;  4WF9 L;  3DM2 A;  4RTF D;  1OVY A;  2XRI A;  1TYQ B;  1C0F A;  3FE1 A;  2O8E B;  3IS9 A;  3PSI A;  3ZSV A;  1N32 K;  3NHG A;  4DFM A;  2QXL A;  2HHT A;  4A57 A;  1D4X A;  5HRN A;  2PY5 A;  3TPQ A;  2RN2 A;  4ELT A;  4CVN E;  1RBV A;  1RTD A;  4WYB A;  2VGM A;  2G8I A;  1HNW K;  1FXX A;  2X6S A;  2IVP A;  3QER A;  3JYT A;  1RBT A;  3D2F A;  3HRG A;  4FCY A;  4AIL C;  4FO0 A;  4FK4 A;  4IOX A;  4IJN A;  4OLB A;  4H5V A;  4MFB A;  4ILH A;  4BC3 A;  4E1J A;  4GMJ B;  1JLA A;  1Z05 A;  2D0C A;  2O4G A;  1WSG A;  5T7B A;  2DTU A;  4DTU A;  1ZBL A;  3DRP A;  2HHW A;  5KPT A;  3ULE B;  2BGG A;  4B3R K;  1IG8 A;  1UAX A;  2IC3 A;  4Z4G A;  3L2W A;  3TAQ A;  4DQS A;  2OPR A;  3RTV A;  4QCL A;  3GOI A;  4Q5V A;  2VWK A;  1VRT A;  2KW4 A;  4Z4C A;  2WUS A;  5JLH A;  5C2F A;  1U4B A;  4IFY A;  4DLE A;  4M7Y A;  3WEE B;  1ZBF A;  1JLG A;  3SUN A;  4BRO A;  3MN9 A;  5HRR A;  1FKO A;  4ILJ A;  3G0Z A;  4LF4 K;  2OCE A;  2HNY A;  3EKU A;  3QLH A;  3KKR A;  4RW6 A;  4ID5 A;  4BC4 A;  4OPK A;  3B8A X;  1IH7 A;  3DLE A;  3F2K A;  3QIP A;  1R59 O;  4LF5 K;  4KB0 A;  1B92 A;  5J1E A;  3ENB A;  1ESV A;  5HP1 A;  3D2F B;  5C42 A;  3LDS A;  4FJN A;  4O4G A;  4CFA A;  5AQK A;  1NGI A;  2NRZ A;  3VET A;  4FW1 A;  2RPI A;  3O3G A;  2IDO A;  4DV4 K;  4UY8 O;  3KD1 E;  1LCU A;  1S9E A;  4GNI A;  2DFF A;  1NJW A;  4FZZ A;  3V81 A;  4O5B A;  4JEP A;  3TAN A;  1BDG A;  1C6V A;  1N36 K;  4NO7 A;  3G25 A;  1C0U A;  1U04 A;  3E9P A;  4QS7 A;  2DPN A;  3PIO L;  4C1N I;  3CCL N;  4I6M A;  4CIG A;  4JLH A;  4DQI A;  1JLF A;  4DV5 K;  4B3S K;  4KI4 A;  3R6M A;  5JLF A;  3J7Y P;  3OYL A;  3ZET A;  5AQM A;  2I7P A;  4BR9 A;  1EXQ A;  3SBG A;  3AA5 X;  1Z26 A;  4PKI A;  3PV8 A;  1KAX A;  5AFU A;  3MXM A;  4FWN A;  2HNZ A;  4B9U A;  3CF5 L;  4EHT A;  2XO7 A;  3SAF A;  1JXB A;  1T8E A;  3KD5 E;  3HTV A;  1DLO A;  1ASV A;  4JI6 K;  2YJF A;  5AJ3 K;  1VK0 A;  4CF2 A;  4I7F A;  4JI3 K;  1XNQ K;  1NK9 A;  4KV8 A;  1UWB A;  2NRT A;  4BQL A;  2UUB K;  1O13 A;  5I42 A;  2HHQ A;  3SMP A;  1ZBI A;  2LSN A;  4AHS A;  4EP5 A;  4BR5 A;  2W41 A;  4K42 A;  1VSF A;  4BWM A;  4C8L A;  1SL2 A;  1Q18 A;  3CIP A;  5BN8 A;  2QM1 A;  4OKJ A;  5C12 A;  1T03 A;  3IUC A;  1Q82 O;  2HHX A;  3CG7 A;  4DKW A;  3FZH A;  1WB9 A;  3AVG A;  1HRH A;  1S1T A;  3VN5 A;  4NYF A;  3CJB A;  3VQ7 A;  1YI2 N;  3O1B A;  4NLC A;  4Z4H A;  2Y1J A;  2Q2R A;  3VGL A;  3H1V X;  4IO9 L;  4DUY K;  1T05 A;  4I6M B;  4MO4 A;  2KZZ A;  4CJP A;  5BRD A;  4PHT X;  4DFP A;  3FZF A;  1HKC A;  1RT2 A;  1DKG D;  4LH4 A;  3BP8 A;  2NRR A;  4BGA A;  1Q9Y A;  5LJW A;  1WSI A;  1RDA A;  4LH5 A;  4FWK A;  4BDY A;  5E41 A;  3SAG A;  4ZTF A;  1NOY A;  1IKX A;  5LJV A;  3SAH A;  1HUX A;  3WQU A;  4CEC A;  1JXE A;  3LP1 A;  5GIP A;  2HB5 A;  3OYD A;  4DV7 K;  4CGI A;  3K5L A;  4CJ5 A;  2QA4 N;  3NF8 A;  3E1Y A;  3TAB A;  5AQT A;  1S1U A;  4W5O A;  3NFA A;  5HRP A;  1S9G A;  3GE1 A;  4CJF A;  4PY5 A;  3R9P A;  4F8R A;  3QB0 A;  1XNR K;  4XH1 A;  4CZE A;  4V19 S;  4KAZ A;  1HNI A;  4IJA A;  3DLL L;  4WFN L;  3CC2 N;  3V1Q A;  3H08 A;  4A2A A;  2IS3 A;  3PY8 A;  1J9A A;  3A0I X;  3A5L C;  4OGC A;  1TK0 A;  2P9S A;  3CFO A;  2WTU A;  2E8A A;  2P9U A;  2ZD1 A;  3C6U A;  3MEC A;  4ISE A;  4Q0B A;  1REV A;  2HBK A;  5KGW A;  5AFU H;  4KRF A;  3I8B A;  1TAU A;  1YUW A;  1KFS A;  3DLR A;  4H0O A;  1L3S A;  4EZ9 A;  2JGU A;  4KTQ A;  1RTI A;  3L0Q A;  4JNE A;  3TTC A;  4X62 K;  1E3M A;  1FJG K;  4E7J A;  1XMO K;  4CHN A;  2X6N A;  1WAF A;  2ETJ A;  2P9N B;  4B1U B;  4B8A B;  2GX9 A;  2ITG A;  3AVA A;  3ZEU B;  3K5O A;  2Q31 A;  4GVE A;  2P9L B;  4EHU A;  4CK3 A;  3QFU A;  4KH4 A;  1TKT A;  4A5B A;  5CYQ A;  1ZXO A;  2E2Q A;  3KZB A;  3DLB A;  3WNH A;  2HMP A;  4N56 A;  3JAM O;  2AA4 A;  4EFH A;  1EWQ A;  3PSF A;  4B9V A;  1XC3 A;  3I8D A;  4DCH A;  4CD3 A;  4BRK A;  1BL3 A;  4DTO A;  1K73 O;  1YTU A;  4BGB A;  1A5V A;  4FPA A;  4XH5 A;  1FK9 A;  4X64 K;  5AQS A;  4CIF A;  2BDP A;  2A3Z A;  2FBV A;  1DT9 A;  3K5M A;  3D7E O;  1NU0 A;  3UIQ A;  1H1V A;  1N33 K;  1WSJ A;  1NOZ A;  1DGK N;  3ZSR A;  2VQE K;  3DAW A;  2A5X A;  3SV3 A;  4M7X A;  3P83 D;  3J7A P;  3MAQ A;  1BIS A;  5J2P A;  1NK5 A;  2P9U B;  3HST B;  4N41 A;  3CCV N;  1WSF A;  3MN7 A;  3RMC A;  3VF4 A;  3O4N A;  4FWS A;  5BPM A;  4JHD A;  2F96 A;  1S22 A;  3TTF A;  3PO5 A;  3J8A A;  4E3S A;  1D9D A;  3VEN A;  1X9S A;  2OTJ N;  4FZX C;  5GAE P;  3MED A;  2F8T A;  3V9W A;  5C2D A;  3SI6 A;  4IZ9 A;  4C8M A;  3NH1 A;  4YOU A;  1HR0 K;  1BIU A;  3EZ5 A;  3SCX A;  3NH0 A;  3ZT3 A;  4GVM A;  1VQK N;  1J5E K;  3VGK A;  1HNX K;  4DR6 K;  3VEW A;  4CI6 A;  4CE9 A;  4RWT A;  5EU7 A;  1LW2 A;  1BOT O;  2VG6 A;  2Q97 A;  3W0L A;  2PBD A;  3AVH A;  2BAN A;  3DXM A;  4IBN A;  4LF8 K;  4B1Y B;  4ICL A;  3VQB A;  3LAN A;  3H45 C;  1BO5 O;  4GV9 A;  3NVM A;  3OYH A;  1U48 A;  1W7A A;  2NRH A;  4OO1 J;  1SKR A;  3H6E A;  2NNW A;  1BA1 A;  1RT3 A;  2YHX A;  4B08 A;  4NXM K;  3M1F A;  3DLK A;  5M1O A;  4FWM A;  1SZ2 A;  3CCQ N;  3GBT A;  3WNE A;  1EQY A;  3UKR B;  4Z94 A;  3O1W A;  1S1X A;  1J54 A;  5AQL A;  3QML A;  2DFH A;  2HOE A;  4MDB A;  5BRE A;  4JHD B;  3O5B A;  4KHY A;  5J2Q A;  3AAR A;  1S1V A;  2IVO A;  1K8K A;  3ATU A;  3OJS A;  3G10 A;  3ZSZ A;  4CES A;  2NUB A;  3NCI A;  4WQ5 A;  4KTW A;  4IKF A;  1BCM A;  3B6P A;  3CQ8 A;  3GL1 A;  3KKS A;  2DFE A;  4DQ8 A;  3THY A;  4CGJ A;  1XHZ A;  4CER A;  3ZCM A;  3KLF A;  3ENH A;  4LFB K;  1TVR A;  1Q7Y O;  3A2F A;  3U6F A;  4DWI A;  4Y0W A;  1XUP O;  1U49 A;  3VA3 A;  1V4S A;  3SPY A;  2PAV A;  5F0X A;  2FSK A;  2VWJ A;  2OAN A;  1SKW A;  1EO1 A;  3DXM B;  2E88 A;  4DB3 A;  1WNS A;  2QWR A;  3EN9 A;  3I0R A;  3L6Q A;  3LDP A;  4CGG A;  3WNF A;  4UQG A;  1Q9X A;  4ILG B;  4CEB A;  2ASM A;  3I33 A;  4CZH A;  4BR2 A;  3AAP A;  2QKB A;  3V6D A;  4BAC A;  3AGR A;  5AQQ A;  1N34 K;  1EWR A;  2Q0U A;  4F3T A;  4GKK K;  3T1A A;  3WXM B;  1BUP A;  3CME N;  2F8S A;  4DFJ A;  1OH6 A;  1X9J A;  3V4I A;  4AM6 A;  3CCM N;  5BRH A;  1XQS C;  1TAQ A;  4CF9 A;  3AO2 A;  3HBT A;  3CCR N;  3A5O C;  3L3U A;  1I3A A;  4HTU A;  5BPN A;  1HNV A;  4IEI A;  3F5T A;  1F21 A;  3Q7C A;  3IG1 A;  5AQG A;  2D1K A;  1GLA G;  5LMU K;  3E66 A;  1C0M A;  3VQC A;  2BH1 A;  3THY B;  5DM7 L;  3AA3 A;  1ATS A;  4U67 L;  3T19 A;  2P1J A;  4I2Q A;  4PQU A;  1ASU A;  1P8Z A;  3LPT A;  3AVB A;  4C23 A;  4DTR A;  3AO5 A;  3KVG A;  2UYT A;  4HUF A;  2ZGZ A;  4E7K A;  2RE2 A;  3U9D A;  3UKU A;  4R79 A;  1T6C A;  5BN9 A;  4M42 A;  4CFC A;  4CIE A;  5AQR A;  2YHB A;  2HW3 A;  3NF6 A;  3ID8 A;  4CJ4 A;  1KVA A;  1L3T A;  2O8C A;  3SJJ A;  1NK8 A;  1BU6 O;  3SUP A;  4K41 A;  4M63 C;  4G1Q A;  3HVR A;  4OPA A;  4H0V B;  5KRS A;  2E5L K;  3LDN A;  3OYC A;  3PX4 A;  4FLW A;  1D9F A;  3AVF A;  3AVK A;  3LAL A;  1RT1 A;  4J2B A;  2E6M A;  3NAE A;  3WXI A;  1ATN A;  1Z25 A;  4EIA A;  1KFD A;  3CCJ N;  4MQ3 A;  2KTQ A;  4FVU A;  1SUQ A;  1S5J A;  4DFK A;  2P5O A;  2VWB A;  1G15 A;  3MX5 A;  3G6E N;  4FJJ A;  1LWC A;  5C25 A;  3K9K A;  4FW2 A;  1BCO A;  3LP0 A;  4MDA A;  1GLL O;  3PO4 A;  4FJK A;  1QQN A;  4HWI A;  3OHR A;  3KHY A;  5J2M A;  4O0J A;  1E4G T;  1ASW A;  4BG9 A;  4CGH A;  2QEX N;  2FBY A;  4PUO A;  3EE9 A;  1K8A O;  5C24 A;  3WT0 A;  1VSH A;  4KI6 A;  3IMX A;  3AA4 A; 
#chains in the Genus database with same CATH homology
 2YJF A;  2A42 A;  4H0P A;  1VQ4 N;  1T3V A;  2PFU A;  1JCE A;  3UKU B;  5KQ8 A;  1HPM A;  1QZ5 A;  2QTD A;  3AY9 A;  4H5T A;  2NRT A;  4H5N A;  4BQL A;  4BRD A;  3RSE B;  2H3G X;  1O13 A;  3IDH A;  5JVH L;  3SMP A;  3CI5 A;  1YIJ N;  5M1Q A;  1C0G A;  2E1Y A;  2FF6 A;  4H5R A;  4BVO A;  4BR5 A;  2W41 A;  2KHO A;  4KBO A;  1KD1 O;  1NBW A;  4K42 A;  1YAG A;  1YJ9 N;  1VQN N;  3MN5 A;  1Q18 A;  3CIP A;  2HF4 A;  3O80 A;  2QM1 A;  5BN8 A;  3J7Z O;  5C12 A;  3IUC A;  5AQU A;  1Q82 O;  5AQI A;  3FZK A;  2HBM A;  3D2E A;  3SK3 A;  4DKW A;  5ELZ A;  3FZH A;  2RHK A;  3ID6 A;  3FZM A;  1NMD A;  3O9R A;  4O5F A;  4FWR A;  3CJB A;  4MLH A;  1YI2 N;  3EZW A;  3O1B A;  3R3L A;  4NLC A;  2NRV A;  1QQM A;  3C6H A;  1VQL N;  4BR4 A;  4BR7 A;  4PL7 A;  2Q2R A;  3W3D A;  3VGL A;  3H1V X;  2D0O A;  2BTF A;  3VF2 A;  4IO9 L;  2P9S B;  4I6M B;  4BRN A;  1NGJ A;  4MO4 A;  4YOV A;  3AGK A;  3OBW A;  5BRD A;  4PHT X;  1ZC6 A;  3FZF A;  1HKC A;  1NLV A;  1VQ5 N;  1DKG D;  1GLC G;  4MO5 A;  1G99 A;  2V51 B;  3OW2 M;  3BP8 A;  1TUY A;  3SBT A;  3BF3 A;  2NRR A;  4BGA A;  3S41 A;  1NJI O;  5CE3 A;  5LJW A;  3CXC M;  1JCF A;  4C1N K;  3KWI A;  2HST A;  4FWK A;  5AZJ B;  3SAG A;  2GUP A;  2GTD A;  2E2N A;  2E2O A;  3ZX2 A;  3G4S N;  4A2B A;  5LJV A;  3MWT A;  3CHW A;  4BRP A;  1HUX A;  3SAH A;  3CER A;  1Q86 O;  1VQO N;  4YDU A;  4ISF A;  3U9Z A;  3WQU A;  5AQP A;  3VPZ A;  2D4W A;  4JK9 A;  5AZI B;  3JXU A;  5AQX A;  5GIP A;  4JKF A;  2P9K A;  3RVC A;  1K9M O;  4EAH D;  4A59 A;  2QA4 N;  1P90 A;  3E9L A;  4FWP A;  3TTD A;  3CPW M;  3BEX A;  1MWK A;  2ZJR L;  1N8R O;  3E1Y A;  5CR4 A;  2NZT A;  5KQD A;  5AQT A;  1W2B M;  3GE1 A;  3GDQ A;  3O08 A;  1VQM N;  4CZI A;  3R9P A;  5M1K A;  3QB0 A;  3AAQ A;  3R8E A;  3WXJ A;  4XH1 A;  3SJH A;  4CZE A;  4JAX A;  3CJA A;  4IJA A;  3DLL L;  3HOT A;  2QI2 A;  1QVG M;  2WBN A;  4WFN L;  3GG4 A;  3CC2 N;  4CBW A;  2CGK A;  3D2E B;  3F9M A;  3ZYY X;  3PIP L;  4BRQ A;  2QW9 A;  5ADX H;  3H46 O;  4CZG A;  3CCU N;  3ZX0 A;  1S72 N;  4A2A A;  2QWQ A;  3VOV A;  3A0I X;  2FLO A;  3A5L C;  5TKY A;  3P39 A;  3FFK B;  1X3M A;  2P9S A;  3Q7B A;  5HOO A;  1YIT N;  1QVF M;  1QZ6 A;  2E8A A;  2P9U A;  2Q36 A;  2OTL N;  4ISE A;  5LY3 A;  1M1K O;  2HBK A;  4BR0 A;  4FWL A;  3U4L A;  1NWK A;  2ZGY A;  3NVK A;  5AFU H;  4CBX A;  3I8B A;  5H1S Q;  3P31 A;  4H5W A;  3WXL A;  4YOT A;  1ATR A;  1SS6 A;  1YUW A;  1YVN A;  3DWL A;  4FOE A;  1JCG A;  4H0O A;  5AZJ A;  1WUA A;  1BG3 A;  2V52 B;  4FL9 A;  4WQ5 C;  1DEJ A;  1VQ6 N;  3L0Q A;  4JNE A;  3TTC A;  2FF3 B;  3CCE N;  2YCH A;  3QBW A;  4FOI A;  4WQ4 C;  3A5M C;  4IO8 A;  3O9Q A;  2P9N B;  3VTH A;  4B1U B;  5BPL A;  2ZF5 O;  2GX9 A;  2Q0R A;  4XEI A;  4IXC A;  2E1Z A;  2F9W A;  3ZEU B;  2A40 A;  2Q31 A;  3LM9 A;  2YX6 A;  4GVE A;  2P9L B;  5AZI A;  5C0Y A;  4EHU A;  2F9T A;  2P9K B;  3QFU A;  3EL2 A;  4KH4 A;  4A5B A;  2IVN A;  2QWM A;  1ZXO A;  3O8M A;  4JKE A;  5EY4 A;  3HOS A;  3C6A A;  2E2Q A;  3KZB A;  2HMP A;  4PL8 A;  2AA4 A;  3LM2 A;  3L4I A;  4FPB A;  2YHY A;  4JK8 A;  4O8U A;  4CZM A;  4EFH A;  1VQ8 N;  2GEM A;  4FWQ A;  5KPZ A;  4DCH A;  2ASP A;  3C0B A;  2QWL A;  4PKG A;  5AQY A;  3G71 N;  4JKC A;  4CD3 A;  5GAG P;  4BRK A;  3H1Q A;  1S3X A;  4NLB A;  3TU5 A;  4AM7 A;  1K73 O;  3MCA B;  3M6G A;  4H0Y B;  1QQO A;  4YOR A;  1RDW X;  3T69 A;  3OA9 A;  3TSQ A;  3QBX A;  4BGB A;  4FPA A;  4XH5 A;  5AQS A;  3U8X A;  1W97 L;  4JKB A;  1BA0 A;  2A3Z A;  3VEO A;  1DT9 A;  1HKB A;  3D7E O;  2BUP A;  3FR0 A;  1H1V A;  4WCE L;  5AQV A;  1DGK N;  5EVZ A;  2JWK A;  3DAW A;  1YF5 L;  5AQW A;  4B1Z A;  2A5X A;  2F7T A;  1TUU A;  4M7X A;  3FGU A;  4B1W B;  2YHW A;  2D0P A;  2WFB A;  5FPN A;  5CHI A;  2P9U B;  2HBJ A;  4B1X B;  4A61 A;  4AF1 A;  2ZJQ L;  4ISG A;  4KH5 A;  3VTI A;  3CCV N;  1Q81 O;  3CET A;  4QS8 A;  3WUH A;  3MN7 A;  2HF3 A;  2KKZ A;  1SAZ A;  3VF4 A;  5GAD P;  4FWS A;  1WOQ A;  5BPM A;  1KAY A;  1BWF O;  4JHD A;  3CJ9 A;  2AP1 A;  3O9U A;  3TTF A;  1S22 A;  2CH6 A;  4BRI A;  4WFA L;  3O9S A;  4XH4 A;  3J8A A;  5GIO A;  3VEN A;  4FWO A;  2P9N A;  3WXK A;  3LDQ A;  4K25 A;  2OTJ N;  1K8K B;  3D6R A;  3DJC A;  3ZX3 A;  5GAE P;  3ZEU A;  4MLE A;  1U2V B;  1T44 A;  3VEY A;  2P9L A;  5C2D A;  4IZ9 A;  4A62 A;  4YOU A;  4CZF A;  5JVG L;  5AQO A;  1T6D A;  5EX5 A;  3CD6 N;  3LL3 A;  4BC2 A;  1VQ9 N;  1KC8 O;  1TYQ A;  2P9P A;  1YJW N;  1VQK N;  3VGK A;  5F1X A;  5B8H A;  3VF6 A;  3A8Y A;  3HI0 A;  1NGD A;  5F2R A;  3VEW A;  4DHY A;  1YJN N;  1HLU A;  4CI6 A;  4RWT A;  3A5N C;  2VGN A;  3QFP A;  3WQT A;  1BOT O;  3UB5 A;  2Q97 A;  4OPH A;  3SMS A;  1NGH A;  3EKS A;  3W0L A;  4CZK A;  2PBD A;  5GAH P;  3VEX A;  3MMV A;  4JD2 A;  4CD1 A;  1LOT B;  3DXM A;  4IFE A;  3M3Z A;  1GLE G;  2QWN A;  4B1Y B;  3I56 N;  2V7Z A;  2FSN A;  5KPR A;  3IKM A;  4J8F A;  3SLC A;  3CQY A;  3C7N B;  3H45 C;  1BO5 O;  4GV9 A;  3N4Q A;  4JKH A;  3NVM A;  4JN4 A;  4JKD A;  2CGL A;  2YJE A;  3LDO A;  1YXQ A;  4H0T B;  5C10 A;  1YHQ N;  2NRH A;  3KWG A;  1MDU B;  3VER A;  4OO1 J;  3H6E A;  2NNW A;  5FPM A;  1MWM A;  1BA1 A;  2YHX A;  4QS9 A;  4CZJ A;  4WFB L;  1HKG A;  4CZL A;  3C65 A;  3CJ1 A;  3M1F A;  2JWL A;  4GY2 B;  2E2P A;  5M1O A;  1RDU A;  4FWM A;  1SZ2 A;  3CCQ N;  2EWS A;  3GBT A;  4B9Q A;  1EQY A;  3UKR B;  3L4Q A;  4Z94 A;  3O1W A;  1JJ2 M;  1RFQ A;  5AQN A;  4HTL A;  5AQL A;  3MX2 A;  4L3Q A;  3QML A;  3ULE A;  2HOE A;  3E9O A;  4MDB A;  5BRE A;  4JHD B;  5I9E B;  3O5B A;  5GIN A;  3OBY A;  2FXU A;  5AQF A;  1E4F T;  5BR9 A;  3HZ6 A;  3AAR A;  2I7N A;  1NM1 A;  3O6W A;  2GWK A;  2IVO A;  3DXK B;  3CJC A;  3EE8 A;  3MN6 A;  5FPD A;  1K8K A;  3ATU A;  3LDL A;  4JK7 A;  1U2V A;  4YOY A;  4WQ5 A;  4F9O A;  1GLD G;  3WEE A;  4WQ4 A;  3GL1 A;  2NLX A;  4DQ8 A;  3K9J A;  4B1V A;  3ENH A;  4WF9 L;  3PLA A;  4RTF D;  1OVY A;  2CH5 A;  1TYQ B;  2P9P B;  1Q7Y O;  1C0F A;  3FE1 A;  2WC9 A;  3QIC A;  4YOW A;  4BVP A;  2QXL A;  4Y0W A;  1XUP O;  3N4P A;  4A57 A;  3I55 N;  1D4X A;  4LC9 B;  3CCS N;  1V4S A;  3TPQ A;  4BRM A;  3O4W A;  2PAV A;  3HM8 A;  5F0X A;  2FSK A;  1GLJ O;  4WYB A;  4U7B A;  2VGM A;  2OAN A;  2YI1 A;  3VEV A;  4BRE A;  3MK6 A;  5AQZ A;  4JD2 B;  4KH6 A;  1EO1 A;  3DXM B;  2E88 A;  4DB3 A;  5JMV A;  2QWR A;  1M90 O;  2IVP A;  3EN9 A;  3MCP A;  3L6Q A;  3LDP A;  3D2F A;  1VQ7 N;  3HRG A;  3ATV A;  3TSP A;  3C7N A;  3IFR A;  4FO0 A;  4BRL A;  2ZWH A;  4ILG B;  2ASM A;  3I33 A;  3O9T A;  4IOX A;  4BRA A;  4BR2 A;  4CZH A;  4IJN A;  2NRX A;  3AAP A;  5M1N A;  4H5V A;  4BQZ A;  2V7Y A;  4IOA L;  4ILH A;  3AGR A;  5AQQ A;  1U6Z A;  2Q0U A;  2ITM A;  4BC3 A;  4BRH A;  3BF1 A;  2CGJ A;  4E1J A;  4GV3 A;  5E84 A;  3WXM B;  1BUP A;  3CME N;  1Z05 A;  4BRF A;  1X9J A;  3FLC O;  3M5R A;  3UE5 A;  4AM6 A;  1HJO A;  3VEZ A;  1IJJ A;  3VMF B;  1KAZ A;  3JS6 A;  1XQS C;  3UKR A;  5BRH A;  3CCM N;  1Z6R A;  3HBT A;  3CCR N;  5KPT A;  4BG8 A;  5AQJ A;  3ULE B;  2HBL A;  3A5O C;  4K43 A;  1J6Z A;  5BPN A;  1IG8 A;  5AQH A;  3P38 A;  4IEI A;  3F5T A;  5TKW A;  3VES A;  3Q7C A;  5AQG A;  4JKG A;  2QWP A;  2D1K A;  2VCP A;  3DXK A;  3GOI A;  4RCH A;  1NGG A;  3VGM A;  5DM6 L;  4CBU A;  2NRW A;  1GLA G;  3CQX A;  5JLH A;  2WUS A;  3MWP A;  5C2F A;  3CMA N;  4NB4 A;  5C15 A;  3E66 A;  2A6A A;  4IWV A;  4M7Y A;  2FSJ A;  2J4R A;  3WEE B;  3ZET B;  4IDH A;  4YDU C;  2BH1 A;  3CPE A;  4BRC A;  5DM7 L;  1ATS A;  4BRO A;  4U67 L;  3MN9 A;  4ILJ A;  1KQS M;  5AR0 A;  3BUZ B;  4BRG A;  3EKU A;  1P8Z A;  4A5A A;  4C23 A;  4YOX A;  4GV6 A;  4BC4 A;  3KVG A;  3B8A X;  2A41 A;  2P9I A;  3P4I A;  5FPE A;  2UYT A;  5M1F A;  4IEE A;  3F2K A;  5BRF A;  1R59 O;  4IOC L;  2ZGZ A;  3FZL A;  2GWJ A;  3IMX A;  3HSC A;  2RE2 A;  3U9D A;  3UKU A;  1HX1 A;  4R79 A;  2W40 A;  1T6C A;  5BN9 A;  3NMU A;  1VQP N;  5EXW A;  4H03 B;  3ENB A;  1ESV A;  3QDK A;  5AQR A;  3D2F B;  3RSE A;  3CC7 N;  3ID8 A;  5AQK A;  1NGI A;  2NRZ A;  5M1P A;  3VET A;  1ZBS A;  3T7Z A;  4UY8 O;  1LCU A;  1QHA A;  4GNI A;  4JKA A;  4O8K A;  1Y64 A;  1BU6 O;  1ILY A;  3R1X A;  3H3N O;  4K41 A;  4M63 C;  1CZA N;  3KK7 A;  4G9Z A;  4FSV A;  4JEP A;  1KXP A;  1NGE A;  3EO3 A;  4OPA A;  4H0V B;  2ZJP L;  3LDN A;  2KLA A;  5HL7 L;  3CC4 N;  1BDG A;  1NGF A;  1NGB A;  1SQK A;  1V4T A;  4NO7 A;  3G25 A;  5JIC A;  4H0X B;  3WXI A;  1GLB G;  1ATN A;  2IIR A;  5E26 A;  3E9P A;  4QS7 A;  4EIA A;  5ADX A;  2DPN A;  3CCJ N;  1GLF O;  1X3N A;  3PIO L;  1NGA A;  4C1N I;  4JKG B;  3CCL N;  4I6M A;  4FVU A;  3ENO A;  2VWB A;  1OKJ A;  1VAZ A;  3MX5 A;  3G6E N;  2E20 A;  1NGC A;  4CJ7 A;  3K9K A;  2GEL A;  2Q1N A;  3H3O B;  3R6M A;  5JLF A;  4MDA A;  1GLL O;  3ZET A;  5AQM A;  4BY9 C;  2I7P A;  1QQN A;  5EOY A;  4BR9 A;  4HWI A;  3OHR A;  3SBG A;  3KHY A;  1RGI A;  3CJ7 A;  4PKI A;  1E4G T;  1KAX A;  2QWO A;  4BG9 A;  5AFU A;  2ASO A;  4PKH A;  2QEX N;  4FWN A;  5MLC Q;  3EE9 A;  3CF5 L;  3TSU A;  4EHT A;  1K8A O;  4BC5 A;  3SAF A;  3MDQ A;  3WT0 A;  2VYP A;  1MA9 B;  1XC3 A;  2P9I B;  3HTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...