1SSLA

Solution structure of the psi domain from the met receptor
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
48
structure length
48
Chain Sequence
b'GSAMGCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQICL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor receptor
publication title Insights into function of PSI domains from structure of the Met receptor PSI domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 4
structure length 48
sequence length 48
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2004-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 1sslA00
1SHYB 4K3JB 4UM8B 4O3TB 4Z7NB 3T3MB 2UZYB 3VI4B 1YUKA 3AL9A 3ZDYB 2VDNB 3OL2A 3VI3B 4GZ8A 3NIGB 4WJKB 3T3PB 2P26A 3ZE1B 2VDLB 3FCUB 1U8CB 4Z7OB 3ZDZB 4Z7QB 4WK2B 3ZE0B 3AFCA 3NIDB 2VDPB 3AL8B 4UM9D 2VDKB 5HDBB 2VDOB 5E6RB 3ZE2B 3ZDXB 5E6UB 2VDQB 2VC2B 2P28A 3OL2B 4WK0B 2VDRB 3NIFB 3NVQA 1OLZA 5E6SB 1TYEB 2VDMB 3OKYB 3AL8A 4O3UB 4FWWA 4WK4B 4UM9B 1SSLA 3OKWA
chains in the Genus database with same CATH superfamily
1SHYB 4K3JB 4UM8B 2JWHA 4O3TB 4Z7NB 3T3MB 2UZYB 3VI4B 1YUKA 3AL9A 3ZDYB 2VDNB 3OL2A 3VI3B 4GZ8A 3NIGB 4WJKB 3T3PB 2P26A 3ZE1B 2VDLB 3FCUB 2JWGA 1U8CB 4Z7OB 3ZDZB 4Z7QB 4WK2B 3ZE0B 3AFCA 3NIDB 2VDPB 3AL8B 4UM9D 2VDKB 5HDBB 2VDOB 5E6RB 3ZE2B 3ZDXB 5E6UB 2VDQB 2VC2B 2P28A 3OL2B 4WK0B 2VDRB 3NIFB 3NVQA 1OLZA 5E6SB 1TYEB 2VDMB 3OKYB 3AL8A 4O3UB 4FWWA 4WK4B 4UM9B 1SSLA 3OKWA
chains in the Genus database with same CATH topology
1SHYB 4K3JB 4UM8B 2JWHA 4O3TB 4Z7NB 3T3MB 2UZYB 3VI4B 1YUKA 3AL9A 3ZDYB 2VDNB 3OL2A 3VI3B 4GZ8A 3NIGB 4WJKB 3T3PB 2P26A 3ZE1B 2VDLB 3FCUB 2JWGA 1U8CB 4Z7OB 3ZDZB 4Z7QB 4WK2B 3ZE0B 3AFCA 3NIDB 2VDPB 3AL8B 4UM9D 2VDKB 5HDBB 2VDOB 5E6RB 3ZE2B 3ZDXB 5E6UB 2VDQB 2VC2B 2P28A 3OL2B 4WK0B 2VDRB 3NIFB 3NVQA 1OLZA 5E6SB 1TYEB 2VDMB 3OKYB 3AL8A 4O3UB 4FWWA 4WK4B 4UM9B 1SSLA 3OKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SHY B;  4K3J B;  4UM8 B;  4O3T B;  4Z7N B;  3T3M B;  2UZY B;  3VI4 B;  1YUK A;  3AL9 A;  3ZDY B;  2VDN B;  3OL2 A;  3VI3 B;  4GZ8 A;  3NIG B;  4WJK B;  3T3P B;  2P26 A;  3ZE1 B;  2VDL B;  3FCU B;  1U8C B;  4Z7O B;  3ZDZ B;  4Z7Q B;  4WK2 B;  3ZE0 B;  3AFC A;  3NID B;  2VDP B;  3AL8 B;  4UM9 D;  2VDK B;  5HDB B;  2VDO B;  5E6R B;  3ZE2 B;  3ZDX B;  5E6U B;  2VDQ B;  2VC2 B;  2P28 A;  3OL2 B;  4WK0 B;  2VDR B;  3NIF B;  3NVQ A;  1OLZ A;  5E6S B;  1TYE B;  2VDM B;  3OKY B;  3AL8 A;  4O3U B;  4FWW A;  4WK4 B;  4UM9 B;  1SSL A;  3OKW A; 
#chains in the Genus database with same CATH topology
 1SHY B;  4K3J B;  4UM8 B;  2JWH A;  4O3T B;  4Z7N B;  3T3M B;  2UZY B;  3VI4 B;  1YUK A;  3AL9 A;  3ZDY B;  2VDN B;  3OL2 A;  3VI3 B;  4GZ8 A;  3NIG B;  4WJK B;  3T3P B;  2P26 A;  3ZE1 B;  2VDL B;  3FCU B;  2JWG A;  1U8C B;  4Z7O B;  3ZDZ B;  4Z7Q B;  4WK2 B;  3ZE0 B;  3AFC A;  3NID B;  2VDP B;  3AL8 B;  4UM9 D;  2VDK B;  5HDB B;  2VDO B;  5E6R B;  3ZE2 B;  3ZDX B;  5E6U B;  2VDQ B;  2VC2 B;  2P28 A;  3OL2 B;  4WK0 B;  2VDR B;  3NIF B;  3NVQ A;  1OLZ A;  5E6S B;  1TYE B;  2VDM B;  3OKY B;  3AL8 A;  4O3U B;  4FWW A;  4WK4 B;  4UM9 B;  1SSL A;  3OKW A; 
#chains in the Genus database with same CATH homology
 1SHY B;  4K3J B;  4UM8 B;  2JWH A;  4O3T B;  4Z7N B;  3T3M B;  2UZY B;  3VI4 B;  1YUK A;  3AL9 A;  3ZDY B;  2VDN B;  3OL2 A;  3VI3 B;  4GZ8 A;  3NIG B;  4WJK B;  3T3P B;  2P26 A;  3ZE1 B;  2VDL B;  3FCU B;  2JWG A;  1U8C B;  4Z7O B;  3ZDZ B;  4Z7Q B;  4WK2 B;  3ZE0 B;  3AFC A;  3NID B;  2VDP B;  3AL8 B;  4UM9 D;  2VDK B;  5HDB B;  2VDO B;  5E6R B;  3ZE2 B;  3ZDX B;  5E6U B;  2VDQ B;  2VC2 B;  2P28 A;  3OL2 B;  4WK0 B;  2VDR B;  3NIF B;  3NVQ A;  1OLZ A;  5E6S B;  1TYE B;  2VDM B;  3OKY B;  3AL8 A;  4O3U B;  4FWW A;  4WK4 B;  4UM9 B;  1SSL A;  3OKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...