1SSOA

Solution structure and dna-binding properties of a thermostable protein from the archaeon sulfolobus solfataricus
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
62
structure length
62
Chain Sequence
ATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and DNA-binding properties of a thermostable protein from the archaeon Sulfolobus solfataricus.
pubmed doi rcsb
molecule keywords SSO7D
molecule tags Dna binding protein
source organism Sulfolobus solfataricus
total genus 4
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1995-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ssoA00
3I3CA 1ZXTA 1WVLA 1G2SA 5EKIA 4XDXA 5EPLA 3DM1A 2FINB 1ESRA 2J7ZA 3Q6SA 1MI2A 3UI2A 1HUNA 1HRJA 2EE1A 1MGSA 4R9WA 3MTSA 1KNAA 1WD1A 1ILQA 2FMMA 4HSVA 4LMQD 1CM9A 2NWGA 5EPKA 4R8IA 1G2TA 1B50A 4MHEA 2DY7A 2B2YC 2L1BA 4IUPA 1EOTA 2K03A 2HDMA 1DZ1A 1F2LA 2B2TA 1PFNA 1WTRA 1PFBA 2JYOA 2MP1A 5CMDA 1X32A 4CJ0B 1AP0A 2RVLA 1B4OA 2L11A 3TZDA 2M2LA 3MWYW 4HCSA 2B2UC 5CORA 1IKMA 2FHTA 2KEDA 1X3PA 3I91A 1IKLA 1PDQA 2N55A 2NZ1D 3F2UA 5CBEE 1HUMA 1NR4A 3P7JA 1RHPA 2Q8TA 4HEDA 1JICA 1PFMA 2XIWA 3I8ZA 3HP3A 2RSNA 3I90A 2FJ2A 4IUTA 1BNZA 4RAUC 2L4NA 1ILPA 5DNFA 1J9OA 4UAIA 1M8AA 2MGSA 5E4XA 1AZQA 4X3SA 2DY8A 2FFKB 2EPBA 4OIKA 3KUPA 3QO2A 1LV9A 1SSOA 2D9UA 4QUFA 2B2VA 2BDNA 2KUMA 1WTOA 1RJTA 1B2TA 2K05A 1HHVA 2B2WC 2KOLA 1GUWA 1IL8A 2X6LA 2HCIA 4U68A 2KEEA 2RSOA 1EL0A 3GV6A 1WTWA 4X3TA 1QE6A 4IUUA 4ZAIA 1ML0D 3LWEA 1SAPA 5E4WC 2HDLA 1MSGA 1B53A 1VMPA 3G7LA 4X3UA 5JJZA 1WD0A 2K01A 1WTVA 4NW2A 1E0BA 5T1IA 1F9RA 4ZLTF 4OIJA 2KVMA 1QNKA 1CA6A 1DOMA 1O7YA 3R93A 1C8CA 3FDTA 1VMCA 2NYZD 1BF4A 2K04A 1HA6A 1Q3LA 1SDFA 2EOTA 1WTPA 1DONA 1BBXC 4ZKCB 1JE4A 3D6WA 2L12A 1XX8A 1EIHA 1BO0A 1O7ZA 1G6ZA 2X6GA 4O42A 2R3ZA 4ZKBB 1F9SA 1O80A 1CA5A 1TVXA 1EIGA 2MJ8A 1ICWA 2HUGA 1XYIA 1RTOA 2B2UA 2B2VC 1NAPA 1U4PA 2JP1A 1G91A 1PLFA 2IL8A 2K1BA 5D14A 1EQTA 1RODA 4RA8A 2B2TC 3FPUB 5T1GA 2HCCA 1WTQA 2SDFA 1F9PA 1AZPA 1F9QA 3IL8A 1B3AA 2N88A 1J8IA 1DOKA 2MPMA 1NR2A 1MSHA 3TN2A 4XT1B 5EQ0A 1U4MA 2L9HA 4IUVA 2VXWA 2X69A 4IURA 2CVRA 1U4LA 1HFGA 3DEOA 4MN3A 5AFWA 5EPJA 4X3KA 2B2YA 1RTNA 1DOLA 1KNEA 2B2WA 3GV3A 2H1EA 3KBXA 4QUCA 4RWSC 4CJ2C 5CBAE 3ONAB 1HFNA 5EJWA 5D65A 4ZK9B 1X3QA 2Q8RE 5COYA 3N52A 4XT3B 1NCVA 3H91A 1QG7A 1WTXA 4HAEA 2KECA 1A15A 1U4RA 3DEPA 4CJ1B 2RA4A 4DN4M 1S4ZA 2K28A 3IFDA 3SVMA 4IUQA
chains in the Genus database with same CATH superfamily
2E76C 1LT3D 1NY4A 3TDQA 2JEBI 4XDXA 1SYFA 1GO3E 4KD4A 1HRJA 1BR9A 2EE1A 1PTOF 3MTSA 5C4ZA 1Z47A 1TS5A 1G2TA 1GJXA 1AN8A 1SR3A 2DNCA 1Y1VG 3HOZB 3J7A5 5FJ8H 3BU2A 2HDMA 3CCRA 4LK1C 3UDIA 2CKZB 2VW9A 1B4OA 2K5NA 1C0AA 1JE5A 1GHJA 1OXUA 4B08A 1WI5A 2A19A 4DR2Q 4A93G 3TP8A 4GN5A 4LWCA 4DPGA 3PIO3 2YU9H 2E5LQ 1B44D 4B3RL 1HNWQ 4N9PA 1HR0Q 1B7YB 4B3ML 3HOVH 1T5EA 3STBD 3J81c 2QA4A 1HQMC 1TS4A 3CCMA 1VQMA 5FOBB 4PZ7A 2K05A 2DJFC 3U50C 3NUCA 4QJFA 5C6AA 5IP7G 5IYCG 4A3LG 1VQBA 2GN5A 1ML0D 2K5WA 2UXBL 1SAPA 4A3BG 1N34L 4A3MG 1KDAA 3MAQA 3G48A 2QEXA 3HOZH 4R4QA 3R93A 3CCQA 2R92B 1Q3LA 1SDFA 3OWEB 1DD2A 1SLJA 2V1CC 2Q2TA 4BY1G 5IT9E 3OSOA 2L15A 1G6ZA 2A6EC 2LS01 4DAPA 4NP5A 4GLXA 5M3FG 4DV5L 1YNND 2K1BA 1OXXK 4JC0A 3FMCA 3BDCA 5EKLA 2VQEL 2O5JC 4K5XA 5DEHA 5G3LF 4NXML 1RD9D 2WAQG 1SE2A 4HIDA 1GOZA 2E2JB 4A3DG 1VQGA 4LF5L 4APVA 4MZ9A 4MN3A 1BBWA 4KMUC 2AQ3B 2F0KA 2N49A 2KHSA 1PRTC 3KBXA 2H1EA 1SYCA 2R7ZB 5CV9A 5J39A 4JVZA 1N36L 1PH3A 2R92H 5GROA 3VDYA 1HNXL 5JJIA 1MHWC 5JJLA 1S5BD 1Y14B 4LF9L 2IW3A 3EIVA 2J7ZA 3UDGA 2UUCQ 3PIP3 1HH2P 3PSIA 4KKSA 4L8JA 4ZUIA 1Q90A 2FMMA 4IUNA 1Q82C 4RHSA 3D6CA 5JVH3 2L1BA 2PO4A 1Z7TA 2A1AA 3K0XA 1JR0D 1ET6A 4KY6A 1NE3A 2E2JH 3KF8B 2L11A 3TZDA 4ABNA 5K36G 4TKOB 1PH6A 4KJNA 2BH8A 1DXMA 3H09A 2Z6BA 2NZHA 3CQZB 3CCUA 3AU7A 1FVIA 2WB1E 1RHPA 3WOFA 2R7ZH 4FF1A 3I8ZA 1WYDA 1VQIA 1AE2A 3HKZG 1E2WA 1V9PA 4KV6A 5C4JB 2SNMA 1U5KA 1M8AA 4TQUS 4C3HG 4ZCKA 1AZQA 3KUPA 2PNRC 1ZYRC 3K5NA 3K58A 4IFDH 2K75A 5LMUQ 2XRQD 2QCPX 4K2LA 1C7YA 2JA5B 2E2IB 3ULPA 1B1ZA 5EAYA 5I4DA 3OHXC 4X3UA 1YI2A 1I94L 3OIPA 5IOCA 3CCVA 1Y8OB 1ENFA 3STBC 3TBIB 3A5UA 3FDTA 3BG3A 3S16B 1NSNS 1KDBA 4Z9CB 4DV6L 5IYDH 3E3XA 1DONA 2PQEA 4I7AA 2K5VA 4RCNA 4QB4A 1PYSB 5J3BA 1KQSA 1EZ6A 1ICWA 3CQZH 4K2KA 4CKCA 2K50A 4X62L 4O2DA 1OXVA 3NQTA 1S5FD 1V1OA 3ERSX 5C4JH 1XWEA 2TMPA 4OEMB 3H3VC 2F3VA 4R4CA 3QR8A 1NMFA 2OQKA 4DUYL 2JA5H 1I6VC 1LUZA 3PIOA 2G9DA 3EQLC 3V05A 3F2BA 1G8ZD 2E2IH 4YWLA 2RCNA 4A3KB 1HFNA 5JEAG 4GNXB 3MXPA 1ICFB 5M3MG 5C0XJ 1D7QA 5DM63 1Z6HA 3S16H 2Z4IA 3W3AA 4GLVB 5CV6A 4LW1A 4ILWA 3FVQA 3JC66 2K33A 3OIQA 4RKLA 2F0GA 1GD7A 3DM3A 4HSPA 1KRSA 4H02A 3TP6A 3AFQA 1J6QA 1EZ8A 1LTID 2AQ1B 4A4IA 4DR2L 4BY7B 3QJYA 4GN4B 2E5LL 4BA1I 5F2DA 1HNWL 5J1ZA 3OMCA 1E1TA 2JK8A 1FYCA 2IX3A 1HR0L 3PUXA 2SEBD 4HCEA 5CBEE 1R4PB 5HGQA 2VY3A 2NVYB 2JA8B 1STNA 3CU7A 4A3KH 1DGSA 2Q8TA 1A2UA 2FJ2A 1D5MC 2MFIA 4BWGB 1S40A 1I5FA 2MGSA 1M4VA 4C3JG 4KHPQ 5IODA 4C3IG 2HT1A 1W6KA 4DV7Q 2IWHA 3GTOB 2A73B 1SRUA 1K73C 3L7ZC 4LF6L 2EYJA 5GAGC 1JWSD 4DV2Q 2I0QA 3A8JE 4BY7H 4OO1I 1VMCA 3ICEA 1UAPA 1S5ED 2KQ3A 2IPKD 2CH4A 1QJOA 1IW7C 1JCKB 2ICEC 1UE5A 3K5MA 1BCPD 2WB1B 1TT2A 2OEOA 1N33Q 2JA7B 4RCOA 3NSWA 3CXCA 1RTOA 2NVYH 4XYQA 1A62A 2B2UA 4YY3L 2JA8H 1U4PA 4HMIA 3I4NG 2EYLA 2SOBA 5I6WA 4IPCA 4AYBG 2F0PA 2SDFA 4EQOA 3ITPA 4RHRA 4HR7B 2R93B 4KKTA 4A3IG 4KKUA 3NTHA 1K8MA 1JMCA 3PGZA 4DU9A 4DK0A 1EU4A 3GTOH 3UDFA 2B2WA 2LKVA 3NTKA 3DHQA 4H44C 4RWSC 4CJ2C 4HJ9A 2AWOA 5COYA 3M4YA 1SNCA 2K14A 3FHWA 4JW0A 3RMHA 4IUQA 2Y0SG 1I4RA 1JJGA 1EY7A 2ZT9C 2EZVA 4NDXA 2JA7H 1MI2A 1KD1C 1HUNA 2F0DA 1UWVA 2F3WA 1IBLQ 2K6AA 1SEBD 1WD1A 4FXKC 4L63B 3VR3A 5K5PA 3KDFA 4O0AA 4LF7Q 2NWGA 3NBHB 4JI8Q 3Q8DA 4X65Q 2R93H 2B2TA 5E3FA 2MP1A 4JCVE 4JI6Q 1STGA 3PO2G 3MWYW 1MJEA 3S2DB 1PDQA 3WOEA 2RBMA 4P74A 1Q8KA 4GN3B 5GAHC 1D6EC 5LMUL 1M90C 4DAYA 2VUMB 1ILPA 1J9OA 5ISRA 1V43A 3OW7A 4M8AA 3CPWA 5A2QE 2OTJA 1WTOA 1RJTA 1RKNA 4A3FG 2XSCA 3HRZC 4GKKQ 1PZID 4H0LC 4ZAIA 1D5ZC 1KHIA 2M9VA 4ZYSA 1MSGA 2RDGA 1UEAB 3CF5A 4IZ8A 2KCNA 3I4MB 1F9RA 5KEEA 3ER0A 5BN4A 1L0YB 1M1KC 1FR3A 5IT9L 3EVQA 1CKOA 2EOTA 4HIMA 1WTPA 2F03A 4POGA 3T13A 3VYSA 2C5CA 2BE5D 2EY6A 4HTHA 4DXGA 1X55A 3S2DH 4F8MA 1KC8C 4RGOS 4K0KL 2JA9A 3RD4A 3DUZA 3I4LA 3A55A 1VQCA 1IBMQ 2VUMH 2JXMB 2A68D 1KLGD 1D1KA 2D62A 1JC7A 1XMOQ 1SMYC 5I2XA 1EUJA 4A3CG 2ZTCA 4JOIA 2CVRA 1H9SB 3RUZA 5HY6A 1NUCA 4G4KA 3GV3A 1FNVA 4C1NK 3BYTB 3ONAB 3HOUG 1X3QA 3I4MH 4XT3B 5GADC 4RGNA 5IGDA 1XJVA 5IYBG 3K0YA 3P1HA 4EVOA 1K3BC 1VF5C 2M00A 1HPCA 2RA4A 2O4XA 1WVLA 1G51A 3J81i 1BOSA 5EPLA 3I7FA 2NVQB 5KRUA 3TSSA 3L0OA 2NVTB 1N9WA 3QOJA 3JAMc 4A93B 1ILQA 1GUGA 4QL5A 1GUOA 3A7LA 1YNJC 1PV4A 4JI2Q 2BCOA 4MTNA 1X32A 3F2DA 1FJGQ 3LGJA 1PTOB 4KHPL 1JQYD 4F7XA 4DV7L 3MA2B 1EIYB 1K0SA 1VQEA 3NK9A 1JT8A 1SYGA 3CCJA 4A3BB 3SE0A 4IUTA 4A3MB 1HZCA 2F0NA 3ND8A 4DV2L 1XMQQ 2KOLA 4BY1B 3T56B 2D5DA 4KI0A 2NB0A 4J15A 3Q22A 4DR3Q 3M4OB 2E2DC 2R61A 2OF1A 2SNSA 4XQQA 1WTWA 4FXDA 2MUYA 1I6HB 2NVTH 1EY5A 1EU3A 3FKIG 4A93H 2UXCQ 5M3FB 1WTVA 4QF4A 1E0BA 2R6GA 1TWAB 2PI2A 3J81E 1EWHA 1N33L 1O7YA 4HIKA 1VQ5A 4FYDA 2PZTA 1KTKA 1EOVA 1RIPA 3D6WA 4GNXC 4KN4C 2UUBL 1O7ZA 1QNUA 4A3DB 2PW5A 1PTOH 3GO5A 2VQFQ 4NMZA 5IYCH 1PMRA 1NAPA 4A3JG 4A3LH 2JP1A 3CMAA 1EY0A 4A3BH 1UE6A 2A6ED 4A3MH 1CI3M 1K9MC 1F9QA 3IL8A 4AH6A 5H1SE 1H95A 2A74C 1J8IA 2MPMA 3ZYYX 5JAVA 1UEBA 1I4XA 4YCWA 4DR7Q 4JYAQ 5ELEA 4BY1H 3G6EA 1UE7A 3M4OH 2QILA 2B2YA 4DA2A 5IGCA 1KNEA 1I6HH 2VL6A 1BXTA 4ZK9B 5M3FH 1TWAH 4HAEA 1PH2A 2UUAQ 4ID6A 1IBLL 3CAMA 3D31A 1PRTD 1QILA 1TY0A 1EY6A 1ZXTA 1HNZQ 1X3EA 1PYWD 1VS0A 1WOCA 2GA4B 4IALA 4A3GB 4JI8L 3T4AC 4DR1Q 4PG3A 4A3DH 4LFAQ 3L9AX 4X65L 1VQ7A 1RF2D 1MGSA 3K7AB 3MHBA 4JI6L 1A63A 1B50A 2EDGA 2LXJA 5M9OA 1GKHA 1VF7A 4IUPA 4IN3A 1YITA 3HKZB 1JWMD 2F0IA 1CK1A 1A2TA 2RKSA 3NP8A 3I56A 5KNBA 1QZGA 1OXTA 4C3HB 4BXXH 1FL0A 3S15B 2ALYB 3IKJA 4AIMA 3URYA 1LTSD 1TR5A 4PV1C 1GHKA 2PZUA 4N8X1 3NTIA 2DN8A 4GKKL 3SK5A 1QVGA 3I90A 1YJWA 1BNZA 2L4NA 2NBFA 1ZKOA 5LMNQ 3MEHA 1IYJB 1EYGA 3RLNA 1SSOA 2D9UA 2IY5B 3HOYB 3T16A 1BDOA 4QGUA 5C44G 2UU9Q 2IX1A 3F1ZA 3MXGA 4A3GH 2HCIA 4U68A 1HCZA 1I4HA 2KEEA 3RN2A 3S17B 3K7AH 4XYOA 3J7YW 2UXDQ 1ZYRD 2F0VA 4B3TQ 4MIUA 4R4OA 1DOMA 2B8FA 4FXGC 3NEMA 1C8CA 1HA6A 2F0MA 4C3HH 5C0XI 3S15H 1IBML 2EJMA 4OWTB 1CA5A 2WP8J 4DUZQ 1SXTA 4JG2A 3K59A 2BOSA 1XMOL 1KDCA 5D14A 3IRBA 4MNOA 3U9SA 3NELA 4CKBA 1VQAA 3KOJA 1STHA 5M3MB 3K81C 1RCVD 3M7NA 1CT1D 2Z9HA 2EY1A 3HOYH 4IUVA 5I9PA 1LM0A 1X3FA 3W1BA 2DJGC 1SBBB 3S17H 3AQQA 5CBAE 2ZXRA 1JOOA 1SNPA 3EJIA 3N52A 4LF4L 3H91A 2P5ZX 1QG7A 4UHVA 1I4QA 2RHQB 2PYKA 3GDEA 4DN4M 2VS1A 1V1PA 4OO1G 3CCSA 3I3CA 1CKMA 2EYMA 1QZHA 1S3OA 4ZRZA 1VQDA 4LFCQ 1PH9A 1ESRA 4R8NA 3RLOA 4JI2L 3NWTA 4IFDJ 4HSVA 2J4XA 1Q46A 2ASBA 2NN6I 3F2CA 1FJGL 2OQ0A 1K28A 5FKAC 5JEAH 3VA7A 3NENA 4IJHA 5M3MH 3I73A 3OPOA 1S5CD 3E6ZX 4WRDA 5C4XG 4C3JB 2A69C 4C3IB 2L55A 4BA2I 4K5WA 2CWPA 1FGBD 4RGTA 1HUMA 1PYBA 3CPFA 1EIFA 2GVAA 1FGUA 3P7JA 1XMQL 1L0WA 1XNRQ 4OGQC 3H0GG 1V1QA 5IWAQ 4DR3L 1SYBA 1EQVA 1D5XC 1QVCA 5LHY1 5JVG3 5A2QL 4WFN3 3TRZA 3FEWX 4GOPB 1VQFA 3EA6A 4J1MA 3CCLA 2UXCL 5GAEC 3U4VA 2BDNA 1K83B 1KRTA 3OWFA 4DK1A 1Q1EA 5IGBA 5E1FA 2HDLA 1VQ6A 4JI0Q 3I72A 1LT6D 3PUZA 1F2ZA 2J0TD 1JJ2A 3BVGA 2XWBB 3I4NB 1LT4D 1SE8A 1CA6A 1BVSA 1CHPD 2CQAA 4DR6Q 1MBYA 5I6YA 2HHHQ 4C3JH 5CV4A 2WKDA 4A3IB 4C3IH 1TQOA 4ZKBB 1KL9A 3CCEA 2EJGC 5LMNW 1PLFA 3BZDB 3OTOQ 4DR7L 1AW7A 4RA8A 3RZOB 1BUVT 4KD3A 2RHSB 1IW7D 1AH9A 4IPDA 1PFSA 4GOPA 3CKIB 3MEFA 1NR2A 4R4TA 3FPPA 1K83H 2EY5A 2JSOA 2Y0SB 3DEOA 2UUAL 1CQFA 3HOWB 2LFNA 4DV3Q 4QIWE 1VQ4A 1HNZL 4NXNL 4JI1Q 3S1RB 3BVZA 3NPPA 4DR1L 1PTOC 3I4NH 3C1FA 1Q1BA 4U673 3TEHB 4A3IH 4R1JA 1DM0B 3K8AA 5EKIA 3SK8A 1YJNA 1EFWA 1TS2A 5M5YB 3PO2B 1VQPA 3J7AV 3S14B 1KNAA 1KAAA 3A54A 2I5MX 4R8IA 3RZOH 1K8OA 2L5TA 1PZJD 2K5HA 2B2YC 5JOBA 5EKKA 2CWAA 4POFA 1OO9B 4OELB 1UNSA 2RF4A 3J7AF 1SFOB 4HCSA 2LMCB 3X3NA 3J80c 4A3FB 1X3PA 5LMNL 1STYA 4IOAA 3OMGA 2B8GA 3HOWH 4CDEC 4HIOA 1IBKQ 1PFMA 2JJQA 3S1RH 2UU9L 4Q5VA 1PZKD 2PW7A 2H5XA 2K7VA 4BBSG 4JBJA 2AQ2B 5GQOA 1LV9A 5IP9G 3OYYA 3KLSA 1VCIA 3MVVA 3PCOB 1VQLA 2I5HA 2IJ0A 5M5YH 3PO2H 3BZCA 1PH4A 2KHJA 4X3TA 3TMEA 2EXZA 3S14H 2B29A 3J81L 2ZTEA 4BBRB 3D4WA 1CSPA 1SE3A 4L5SA 1STEA 4KHVA 3CMEA 1U9RA 1SFOH 4FO2A 1EWIA 4DR4Q 4A3FH 4DK3C 1TVXA 1BCPF 3SDZA 3TS0A 3PF4A 2KCMA 4JPBW 2IL8A 4LF8Q 3JAMi 1EEID 1RDPD 3R2TA 2HCCA 2NZOA 1AZPA 2F0JA 4X6AH 1EQQA 3CP0A 1R4QB 3Q23A 4X64Q 5AFWA 3H3VI 2WKCA 5FLXc 1DOLA 2ICIA 3NXWA 2MQHA 3O13A 4DV4Q 4BBRH 4LFCL 1SMYD 3BZKA 3VYUA 3X3MA 3KDFB 2F0TA 2F0OA 4PQXA 3M7GA 2FMCA 1VQJA 1SJHD 3RZDB 3G4SA 3GTJB 4FP5D 2PI2E 2MO1A 1K8AC 2VNUD 3DM1A 4X66Q 1J5EQ 4A3CH 4YWKA 3BJUA 5KYLA 1UE1A 1ZEQX 5D3DA 2E8GA 3VR5A 1VQKA 4K14A 3HEJA 5IYBH 1F2LA 1PFNA 4OONA 4DAYB 4PZ8A 1X65A 2UUCL 5IWAL 3JAME 4WJ3M 4QIWB 3TZUA 4FVMA 1Y1WG 1SNDA 1YNJD 2IX0A 4CBVA 5DM73 1Y8PB 1F77A 1TY2A 1QUQA 3Q0AA 3HP3A 2PCFB 2RSNA 3CHBD 4XTCS 1XTDA 1YHAA 2DY8A 4JI0L 2EPBA 1SNOA 1N8RC 2CW0C 3QG1A 3TS2A 2B2VA 1B2TA 4IOCA 3RZDH 4HMJA 3GTJH 4QQBX 3GV6A 5C5MA 4C2MB 2YTVA 4IUUA 4DR6L 1NBWA 2HHHL 3M4QA 4DAMA 1YEZA 2WAQE 2F3IA 1Q86C 2CH4W 4YCUA 1JB7A 2B63G 1IL2A 1BQQT 3AYHB 5ELCA 3PUYA 3OTOL 4G7OC 2BH2A 3CRKC 1CZGA 1O80A 1ONLA 3PO3G 4N9TA 4RKBA 1EY4A 4DKAC 5CR3A 1TWFB 1S72A 2I07B 1I3QB 3FPUB 5CYUA 5KNDA 2EIFA 1EYDA 2CHBD 2AWNA 4L5RC 2V4DA 2AUKA 1CUKA 1DOKA 1NNXA 1HZ9A 1QCBD 4JI1L 4A3KG 2EXDA 3IAYA 2XNAC 2D0OA 1O78A 2NUCA 4UDUC 2KCTA 3QWNA 4X3KA 5M5WB 1S5DD 4C2MH 5LL6X 3QB3A 4KHZA 4P71A 4TSSA 4UP9A 1TIID 1GXDC 1G6PA 2ES2A 5C5LA 2F0QA 1N32Q 1JOKA 2QEJC 2K28A 4Y7NB 3E5SA 3Q24A 5JPMC 1GUNA 2C9OA 5C0XG 5KNCA 3U58A 4GOPC 2E2HB 3HKZE 4ULLA 1XXGA 3BDLA 5EPKA 1TWFH 1I3QH 5L37A 2KBNA 3T51B 1ET9A 4YCVA 5KIXA 1LABA 5I2YA 4DR5Q 1DZ1A 4EQ5A 1WTRA 4HJ8A 3PV0A 3AB9A 4K6LA 1FD7D 1Y1VB 3BYYB 3M85A 3TQYA 5C44B 1IKLA 2N55A 2NZ1D 5M5WH 1WJJA 3PQIA 3HZXA 3QIAA 2PQAA 2F0HA 4NB3A 3T1YQ 3CW2C 1PH7A 1EEFD 4Y7NH 4ODGA 2L0CA 3W2DA 2KUMA 1A3UA 1Z9FA 4DV1Q 4EQPA 2HIVA 2E2HH 1P16A 2Q2IA 4DNRB 4KLKA 4ZLTF 4DV5Q 1CKNA 3MXUA 4DR4L 1YBYA 2NN6G 2WB1G 2AMCB 5E7NA 2ZJQA 3D3RA 1PH5A 1L1OA 4LF8L 2B3GA 2CCZA 2X6GA 4FF2A 1Y1VH 1QOHA 5C44H 3LNNA 2R93G 3I2ZA 1ENCA 4N8FA 3H94A 4X64L 2G9HD 1SYEA 1XPOA 1LTTD 4IFDI 1AEXA 1W6JA 5FLMG 4DV4L 3L2PA 3ZJYC 5BR8Q 2VXWA 1I50B 2OWOA 4XQNA 4I7ZC 2WAQB 1RTNA 4LFBQ 4L5QA 1ASYA 2D2CC 4RG1A 1NCVA 4KJOA 4F87A 4X66L 4F88A 3DEPA 5IP7H 1J5EL 4RFBA 5C3EG 5HURA 5IE8A 2WINB 2YV5A 5IGEA 4G7HC 4LUVA 1PRTF 1XTCD 3S1NB 4PMBA 2FINB 1YJ9A 1PXUA 3R3OA 3HFZB 1X6OA 4LMQD 4UP7A 2AUJD 4XIGS 4MHEA 3HOXG 3H0GB 5FK9C 3C46A 5FO8B 1VQNA 3H15A 4OO1H 1ESFA 1I50H 2B2UC 3BDOA 4DAVA 4Y52H 2KEDA 5IGFA 2VUMG 3KLWA 1B70B 4LF7L 2JA6G 4GZYC 2AHOB 4A3EG 2YTYA 3D0FA 2K32A 3M4PA 1HA5A 3QOLA 2G5DA 2A69D 1JICA 1STBA 2JN4A 4HEDA 4C56C 2O5IC 1HTPA 3MXNA 1B9MA 2MO0A 2Q2HA 3NE5B 2WV6D 3WWVA 4OIKA 1EYCA 3QO2A 2YTXA 2ATWA 2B2WC 3S1NH 1CSQA 3DWQA 4OWWB 1QE6A 3P75A 4AYBE 3IFTA 1A8VA 5JJZA 1EFID 1E7ZA 4NW2A 2F1MA 2KVMA 4JI3Q 1SMXA 1BKBA 5AJ3Q 3H0GH 3WDNA 1LYLA 4ME5A 1BBXC 4JBMA 1Q7YC 2F4VQ 3A7AB 3NQIA 4O42A 4B3SQ 4YIJA 3K57A 1A6XA 1F9SA 1B8AA 2KHIA 1KLUD 2B2VC 2PMZE 3KJPA 1EQRA 2B2TC 3GQBA 5K36H 4HJ5A 2Y0SE 1LLRD 1WCMG 1B3AA 4TRDA 3M3YB 4P2CB 5KYIA 2WFWA 2F0WA 1VQ8A 1DJRD 2L9HA 2OXPA 4OWXB 4IURA 5JEAJ 5C3WA 1N32L 2EQSA 1HFGA 1X56A 2DGYA 1V1PB 4P72A 4JI4Q 5EPJA 1AFPA 1LACA 3J80i 3E0JA 2VZAA 2Q8RE 3S24A 4DFAA 1A15A 1U4RA 1Q81C 1LTGD 3J7ZC 4KTAA 5CGKA 1XPRA 4YHHQ 2QKIC 4B9XA 4K8IA 2F52A 1GM5A 4WORA 1VQOA 1PTOD 2ZXOA 4NKLA 4AQYQ 4DR5L 4UPAA 2MNAA 2O2LD 1B9NA 1HTLD 2JQOA 2RDHA 1T5XD 2K03A 1V8QA 1SE4A 3M3YH 2ZTDA 5C4HA 3JAML 4BBSB 2RVLA 4KK7A 1GVPA 3K5OA 4CHTB 3T1YL 1I4PA 4I65A 3KBGA 1NR4A 4MTKA 1X54A 3G6JB 2C35B 5ELNA 3PMFA 4DV1L 4LF6Q 3S1MB 4J8QA 3R8BA 3CD6A 1E2VA 3DXJC 4JOIC 4R4IA 3J80E 1C9OA 4FNFA 2PPBC 3A8IE 3K6OA 2K5DA 5A35A 4XQJA 4LUOA 2IHFA 3W1GA 3NWSA 2RSOA 1QVFA 4B9WA 1C4QA 1WTHA 3KK7A 1B53A 3CC7A 2ID0A 1KIXA 3TREA 3ULJA 4DK6C 2JEAI 4YY3Q 1GUTA 4OIJA 3VYRA 1LO5D 1QNKA 1YHQA 5ELOA 1T9HA 1LTAD 3KJOA 4K8JA 1SNMA 2E74C 4BBSH 1BO0A 4DV0Q 5IP9H 1SN8A 2R3ZA 3J81j 2A6HC 3GTGB 4CDFC 3TP5A 3D4DA 1ASZA 1L2FA 3K7UC 5TSSA 3ULLA 5BR8L 5HGTA 4BXXG 1EQTA 5G3LD 4OX9Q 2BA0A 3S1MH 3SR1A 4WJWA 2B39A 3MZ5A 4LFBL 1E22A 5ELDA 1MSHA 4XT1B 2EJFC 4P73A 2Q8IB 3W5OA 2LXKA 3T1HQ 1A3VA 4AYBB 2VQFL 1BCPB 3SXHA 5DLQE 1L1OC 4J6HA 5FJ8G 4A3GG 1O7LA 4QMGA 4CDDC 2WIIB 5KGUA 1C48A 3BVMA 4IPHA 5IIFA 3S9WA 4JYAL 1VQ9A 4FF3A 1H9KA 1LTRD 5FLXE 2I46A 4CGYB 2PMZB 3GTGH 1II3A 2HQLA 3MFYA 2XVSA 1KXLA 1TXYA 4KY5A 1Y1WB 1FNWA 3RR5A 3HOVG 4JK1C 2DY7A 2VB3X 4RH6A 5JPNC 2N78A 3I4OA 3ND9A 1PFBA 4IQZA 4K5VA 3FP9A 4CJ0B 4LFAL 4CDCC 1YHBA 2IT1A 3SK4A 1W2BA 3I91A 2PZWA 3PUWA 2XN9C 2F4IA 3HOZG 2XIWA 3HOYG 3KF8A 3UDXA 4RAUC 1E24A 5D3IB 2F0LA 5DNFA 2B63B 5E4XA 1TS3A 4X3SA 2ZJRA 4H7BA 4Q0FA 1LT5D 4L6TB 1HR0W 2I5LX 4JI3L 1GUWA 1IL8A 5AJ3L 5EBDA 5IT9c 1EL0A 4JI7Q 3V2TA 1FNUA 3LWEA 4DNTB 2MHVA 5E4WC 3G7LA 1WD0A 3PO3B 3L3OC 1I4GA 1Y1WH 2F4VL 2CW0D 4K0KQ 4B3SL 2HQEA 4EGVA 1O7IA 1QWYA 2NYZD 1YNNC 1VQHA 4DF7A 1SJED 5EBCA 1NMGA 2XWJB 4BS9A 4E6IA 1MIUA 3UE1A 2K5QA 4LJZC 3HKSA 2UXDL 3GTKB 1XYIA 2PNHA 1JOQA 1DYQA 2EY2A 4B3TL 5M5XB 3P20A 1RODA 2ZM6Q 2R92G 3DWPA 1W3SA 4JI4L 1F9PA 3EN2A 4IPGA 5EGTA 4P75A 1XNQQ 1Y69U 2B63H 1OXSC 3TN2A 1XPUA 4PNYA 5EQ0A 4DUZL 4FF4A 1U4LA 1YIJA 5FO7B 4YHHL 1SNQA 1VDZA 2F0SA 3PO3H 5EJWA 3GTQB 1TWGB 1WTXA 2VB2X 2KECA 1H9MA 4LNQA 2OCEA 4AQYL 4HJAA 4CJ1B 1S4ZA 3SVMA 5I9OA 1NTGA 3HOUB 1HZAA 1G2SA 3C1EA 1TWCB 1CHQD 5JJKA 2NTSA 3SHLA 4GNXA 3GTKH 2R7ZG 2K52A 2HD3A 4M1UB 4R9WA 4L5TA 5M5XH 1NJIC 3AMUA 1EOTA 2A5HA 1QUQB 1OTCA 4IFDG 2Q2UA 4KN7C 1AP0A 1YVCA 2KCCA 3AFPA 3ERQA 1DCZA 3F2UA 4OL7A 3MFGA 3RLFA 5C0XH 1IYVA 5BN3A 2TSSA 3U9OA 1L0XB 3GTQH 1TWGH 2EYOA 3A74A 5IYDG 1A0IA 4UAIA 3PIPA 2FFKB 1EY9A 3HOUH 2NTTA 1HHVA 1EYAA 1K3RA 4V190 1TWCH 2OT2A 2H4OA 3VA5A 2X6LA 4JI5Q 4ME3A 3OOCA 2UUBQ 1XNRL 4YWMA 1QB5D 3A5ZB 4DV0L 2Z6KA 1Y8NB 2YYZA 1AE3A 4GLAC 1B3QA 3FKIB 2WACA 3A0JA 4ZKCB 1JE4A 4JV5Q 2JA5G 2L12A 3I70A 4OX9L 3DMUA 3U4ZA 4G7ZC 3DLLA 3T1HL 5T1GA 3I55A 3GTLB 3VYTA 2NN6H 3K5LA 4A3JB 3HOWG 5C3EB 2XTIA 3RNUA 3HGBA 1PHJA 1IZ6A 1JB3A 3LWUA 3PUVA 5ELFA 2BDOA 1EY8A 3D4RA 4UY8C 4QCLA 2QDBA 3TP7A 4PMWA 3M9BA 2RQXA 4GKJQ 1LTBD 3HOXB 3N6RA 1PA6A 3FKIH 5DAUA 4A75A 1PH8A 3GTMB 5FLMH 2QF7A 1K0RA 4DV3L 3MC0B 3C3LA 2JE6I 3Q6SA 3UI2A 3E9IA 4OHJA 3EROA 3A8KE 2JA6B 4A3EB 3C2PA 3GTLH 1H9JA 3KFUA 3G71A 4C1NI 4A3JH 1YZ6A 2JYOA 1PRTB 2PQAB 5CMDA 1STAA 5C3EH 2GVBA 1WFQA 3E0EA 2M2LA 5CORA 1CZWA 2DUDA 1LTLA 3F8TA 1IKMA 3NBHA 4ZUJA 3E9HA 4WJ4A 1IHZA 2ZXPA 1A3TA 2NVXB 3KF6B 2EYPA 4BY7G 3S2HB 2CFMA 1U0LA 3J80L 4JI7L 3HOXH 4IJLA 1CKNB 2BA1A 4NPSA 4B3RQ 3AEVA 4BBRG 3GTMH 1JJCB 3GTPB 1IBKL 2JA8G 3PF5A 1L1OB 4DXFA 4B3MQ 1H9RA 4OXPA 4EQNA 1KAWA 2JA6H 2K01A 4A3EH 3KLSX 3HG9A 2R7DA 2ZJPA 1BCPC 3D8GA 1BF4A 2R7FA 1F2MA 1Q8IA 2UXBQ 1WCMB 4RMFA 4A76A 1IYUA 2EVBA 4RGMA 1N34Q 2RDFA 1XX8A 1CQVA 2ZM6L 1TKWB 4V0BA 3R2IA 5J22A 1XNQL 2FXQA 3VR2A 3EBEA 1K8GA 2KJXA 2NVXH 3K80C 3KF6A 2QW7A 3S2HH 1WTQA 4QY7A 2F0EA 5CV8A 4LF4Q 3H6MA 4HJ7A 2F0FA 1HXYD 1U4MA 2JA7G 2X69A 3KLRA 1G291 3GTPH 2VQEQ 4XXEA 4DNIA 4NXMQ 1MD2D 3RN5A 2IHEA 4LF5Q 2N3SA 1GUSA 1JORA 2A8VA 5ELBA 1H9SA 2Z4HA 5FLXL 3IFDA 1WCMH 1MJCA 1D2BA 1N36Q 1PVOA 1SYDA 1RL2A 2XGTA 1UUPA 5LL6S 1CFMA 1ENAA 1HNXQ 4O1NA 1CM9A 3BS1A 1SROA 4K6DA 2Z8LA 4LF9Q 1E1OA 5BN5A 2EYFA 3CRLC 2NVQH 5NUCA 3MXNB 2EYHA 2F0UA 4CKEA 1TU2B 4ZQ3A 1D8LA 2FHTA 2ENBA 1X3GA 4DGZA 4ALPA 3T53B 5C4XB 4KY7A 1E2ZA 4GS3A 5FO9B 4IO9A 4JI5L 4EX5A 3VR6A 3KYHC 2KENA 3UE0A 4QUFA 3OW2A 1JWUD 3SEBA 3NBIA 1E3PA 2XRSD 1TWHB 1Q12A 1VMPA 3DWAA 5IGGA 1CTMA 2BE5C 3SK6A 3S1QB 4JV5L 5T1IA 3H3VH 5IY0A 4PZ6A 2HIXA 3SGIA 4LUZA 1R9TB 2K04A 4S3SA 2AKWB 1HJPA 3FRPB 3LX0A 1I94Q 1EIHA 1YNXA 4PMCA 2DNEA 4HN7A 1X9NA 2A68C 1KABA 4H13C 4LAAA 1EIGA 2MJ8A 3V96A 2LSSA 2HUGA 3I4MG 4DV6Q 5C4XH 2QGQA 4JBKA 4G57A 1G91A 3EFXD 2OTLA 2CQOA 1EWCA 4UP8A 3HS0C 3A56A 5CV7A 4NXNQ 2A6HD 2N88A 1D1IA 3CC2A 2K4KA 2KA7A 5CV5A 3NHHA 2RCFA 1PH1A 1BBUA 2Z6KC 3GP7A 4JBWA 4TVAB 5CC4A 2QDLA 3VR4A 1HQRD 2D0PA 4X62Q 4GKJL 5C3XA 3CC4A 1IXRA 1TWHH 4QUCA 2YU9B 2N8NA 5D65A 3S1QH 2Z0SA 4FDBA 1P8LA 2E75C 3GD7A 4DUYQ 3B6YA 2LY7A 3HOVB 1R9TH 1HZBA 1F2YA 1MKHA 2Z1CA
chains in the Genus database with same CATH topology
2E76C 1LT3D 3TDQA 2JEBI 4XDXA 1SYFA 4KD4A 1HRJA 1BR9A 2EE1A 1PTOF 3MTSA 5C4ZA 1Z47A 1TS5A 1G2TA 1GJXA 1AN8A 2DNCA 3HOZB 2HDMA 4LK1C 1B4OA 1GHJA 1OXUA 4B08A 3TP8A 3PIO3 1B44D 4N9PA 1T5EA 1HQMC 1TS4A 5FOBB 2K05A 3NUCA 5C6AA 1ML0D 2K5WA 1SAPA 1KDAA 3MAQA 3R93A 2R92B 1Q3LA 1SDFA 3OWEB 1DD2A 5IT9E 3OSOA 1G6ZA 2A6EC 2LS01 4DAPA 4NP5A 1YNND 2K1BA 1OXXK 3FMCA 3BDCA 5EKLA 2O5JC 4K5XA 5DEHA 5G3LF 1RD9D 1SE2A 1GOZA 2E2JB 4MN3A 4KMUC 2AQ3B 2F0KA 2KHSA 1PRTC 3KBXA 2H1EA 1SYCA 2R7ZB 5CV9A 5J39A 1S5BD 2IW3A 2J7ZA 3PIP3 4KKSA 4L8JA 4ZUIA 1Q90A 2FMMA 4IUNA 4RHSA 3D6CA 5JVH3 2L1BA 2PO4A 1Z7TA 1JR0D 1ET6A 4KY6A 2L11A 3TZDA 4ABNA 5K36G 4TKOB 4KJNA 1DXMA 3H09A 3CQZB 3AU7A 1RHPA 3WOFA 4FF1A 3I8ZA 1E2WA 4KV6A 5C4JB 2SNMA 1M8AA 4TQUS 4C3HG 1AZQA 3KUPA 2PNRC 1ZYRC 3K5NA 3K58A 4IFDH 2JA5B 2XRQD 2QCPX 4K2LA 2E2IB 1B1ZA 5I4DA 3OHXC 4X3UA 3OIPA 5IOCA 1Y8OB 1ENFA 3TBIB 3FDTA 3BG3A 3S16B 1NSNS 1KDBA 4Z9CB 1DONA 2PQEA 4RCNA 4QB4A 1EZ6A 1ICWA 4K2KA 4CKCA 1OXVA 3NQTA 1S5FD 1V1OA 1XWEA 2TMPA 3H3VC 2F3VA 1I6VC 2G9DA 3EQLC 3V05A 1G8ZD 4A3KB 1HFNA 5JEAG 3MXPA 5C0XJ 5DM63 1Z6HA 2Z4IA 3W3AA 5CV6A 4ILWA 3FVQA 2K33A 3OIQA 4RKLA 2F0GA 4HSPA 3TP6A 1EZ8A 1LTID 2AQ1B 4BY7B 3QJYA 4BA1I 5F2DA 5J1ZA 3OMCA 1FYCA 2IX3A 3PUXA 2SEBD 4HCEA 5CBEE 1R4PB 2NVYB 2JA8B 1STNA 3CU7A 2Q8TA 1A2UA 2FJ2A 1D5MC 4BWGB 2MGSA 1M4VA 4C3JG 5IODA 4C3IG 1W6KA 2IWHA 3GTOB 2A73B 3L7ZC 2EYJA 1JWSD 3A8JE 4OO1I 1VMCA 1UAPA 1S5ED 2KQ3A 2IPKD 1QJOA 1IW7C 1JCKB 2ICEC 3K5MA 1BCPD 2WB1B 1TT2A 2OEOA 2JA7B 4RCOA 3NSWA 1RTOA 4XYQA 2B2UA 1U4PA 4HMIA 2EYLA 2SOBA 5I6WA 2F0PA 2SDFA 4EQOA 3ITPA 4RHRA 4HR7B 2R93B 4KKTA 4KKUA 3NTHA 1K8MA 4DU9A 4DK0A 1EU4A 2B2WA 2LKVA 3NTKA 3DHQA 4H44C 4RWSC 4CJ2C 2AWOA 5COYA 3M4YA 1SNCA 3RMHA 4IUQA 1I4RA 1EY7A 2ZT9C 2EZVA 4NDXA 1MI2A 1HUNA 2F0DA 2F3WA 2K6AA 1SEBD 1WD1A 4FXKC 4L63B 3VR3A 5K5PA 2NWGA 2B2TA 5E3FA 2MP1A 1STGA 3MWYW 3S2DB 1PDQA 3WOEA 2RBMA 1D6EC 4DAYA 2VUMB 1ILPA 1J9OA 5ISRA 1V43A 3OW7A 4M8AA 5A2QE 1WTOA 1RJTA 1RKNA 2XSCA 3HRZC 1PZID 4H0LC 4ZAIA 1D5ZC 2M9VA 4ZYSA 1MSGA 2RDGA 1UEAB 4IZ8A 2KCNA 3I4MB 1F9RA 5KEEA 5BN4A 1L0YB 1FR3A 5IT9L 3EVQA 1WTPA 2EOTA 2F03A 3T13A 3VYSA 2C5CA 2BE5D 2EY6A 4HTHA 4DXGA 4F8MA 4RGOS 3RD4A 3DUZA 3I4LA 3A55A 2JXMB 2A68D 1KLGD 1D1KA 2D62A 1JC7A 1SMYC 5I2XA 2CVRA 1H9SB 3RUZA 1NUCA 4G4KA 3GV3A 1FNVA 4C1NK 3BYTB 3ONAB 1X3QA 4XT3B 4RGNA 5IGDA 3K0YA 3P1HA 4EVOA 1VF5C 2M00A 1HPCA 2RA4A 2O4XA 1WVLA 1BOSA 5EPLA 2NVQB 5KRUA 3TSSA 2NVTB 3QOJA 4A93B 1ILQA 1GUGA 1GUOA 3A7LA 1YNJC 2BCOA 1X32A 1PTOB 1JQYD 4F7XA 3MA2B 3NK9A 1SYGA 4A3BB 3SE0A 4IUTA 4A3MB 2F0NA 3ND8A 2KOLA 4BY1B 3T56B 2D5DA 4KI0A 2NB0A 3Q22A 3M4OB 4FXDA 2E2DC 2R61A 2OF1A 2SNSA 4XQQA 1WTWA 2MUYA 1I6HB 1EY5A 1EU3A 5M3FB 1WTVA 4QF4A 1E0BA 2R6GA 1TWAB 3J81E 1EWHA 1O7YA 4FYDA 2PZTA 1KTKA 3D6WA 4KN4C 1O7ZA 1QNUA 4A3DB 2PW5A 1PTOH 3GO5A 4NMZA 1PMRA 1NAPA 2JP1A 1EY0A 2A6ED 1CI3M 1F9QA 3IL8A 2A74C 1J8IA 2MPMA 3ZYYX 5JAVA 1I4XA 5ELEA 2QILA 2B2YA 4DA2A 5IGCA 1KNEA 1BXTA 4ZK9B 4HAEA 4ID6A 3D31A 1PRTD 1QILA 1TY0A 1EY6A 1ZXTA 1PYWD 2GA4B 4IALA 4A3GB 3T4AC 3L9AX 1RF2D 1MGSA 3K7AB 3MHBA 1B50A 2EDGA 5M9OA 1VF7A 4IUPA 4IN3A 3HKZB 1JWMD 2F0IA 1CK1A 1A2TA 2RKSA 3NP8A 5KNBA 1OXTA 4C3HB 3S15B 3IKJA 3URYA 1LTSD 1TR5A 4PV1C 1GHKA 2PZUA 3NTIA 2DN8A 3SK5A 3I90A 1BNZA 2L4NA 2NBFA 1ZKOA 3MEHA 1SSOA 2D9UA 3HOYB 3T16A 1BDOA 2IX1A 3MXGA 2HCIA 4U68A 1HCZA 1I4HA 2KEEA 3S17B 4XYOA 3J7YW 1ZYRD 2F0VA 4MIUA 1DOMA 2B8FA 4FXGC 1C8CA 1HA6A 2F0MA 5C0XI 2EJMA 1CA5A 2WP8J 1SXTA 3K59A 2BOSA 1KDCA 5D14A 3U9SA 4CKBA 1STHA 5M3MB 3M7NA 1RCVD 1CT1D 2EY1A 4IUVA 5I9PA 1SBBB 5CBAE 2ZXRA 1JOOA 1SNPA 3EJIA 3N52A 3H91A 1QG7A 1I4QA 2PYKA 4DN4M 1V1PA 4OO1G 3I3CA 2EYMA 4ZRZA 1ESRA 4R8NA 3NWTA 4IFDJ 4HSVA 2J4XA 2NN6I 5FKAC 5JEAH 3VA7A 3I73A 3OPOA 1S5CD 3E6ZX 4WRDA 4C3JB 2A69C 4C3IB 2L55A 4BA2I 4K5WA 1FGBD 4RGTA 1HUMA 3P7JA 4OGQC 1SYBA 1EQVA 1D5XC 5JVG3 5LHY1 5A2QL 4WFN3 3FEWX 3EA6A 4J1MA 2BDNA 1K83B 4DK1A 3OWFA 1Q1EA 5IGBA 5E1FA 2HDLA 3I72A 1LT6D 3PUZA 1F2ZA 2J0TD 3BVGA 2XWBB 3I4NB 1LT4D 1CA6A 1CHPD 2CQAA 1MBYA 5I6YA 5CV4A 2WKDA 4A3IB 1TQOA 4ZKBB 2EJGC 1PLFA 3BZDB 1AW7A 4RA8A 3RZOB 1BUVT 4KD3A 1IW7D 3CKIB 1NR2A 3FPPA 2EY5A 2JSOA 2Y0SB 3DEOA 1CQFA 3HOWB 2LFNA 3S1RB 3BVZA 3NPPA 1PTOC 3C1FA 1Q1BA 4U673 1DM0B 5EKIA 3SK8A 1TS2A 5M5YB 3PO2B 3J7AV 3S14B 1KNAA 1KAAA 3A54A 4R8IA 1K8OA 2L5TA 1PZJD 2B2YC 5JOBA 5EKKA 1OO9B 1UNSA 3J7AF 1SFOB 4HCSA 2LMCB 3X3NA 4A3FB 1X3PA 1STYA 3OMGA 2B8GA 1PFMA 4Q5VA 1PZKD 2PW7A 2K7VA 2AQ2B 1LV9A 3KLSA 1VCIA 3MVVA 2IJ0A 4X3TA 3TMEA 2EXZA 3J81L 4BBRB 3D4WA 1SE3A 1STEA 4KHVA 1U9RA 4FO2A 1TVXA 1BCPF 3SDZA 2IL8A 1EEID 1RDPD 3R2TA 2HCCA 1AZPA 2F0JA 1R4QB 3Q23A 5AFWA 2WKCA 1DOLA 2ICIA 3NXWA 3O13A 1SMYD 3VYUA 3X3MA 2F0TA 2F0OA 4PQXA 3M7GA 2FMCA 1SJHD 3RZDB 3GTJB 4FP5D 2VNUD 3DM1A 5KYLA 1ZEQX 5D3DA 3VR5A 4K14A 3HEJA 1F2LA 1PFNA 3JAME 4QIWB 3TZUA 4FVMA 1SNDA 1YNJD 2IX0A 4CBVA 5DM73 1Y8PB 1F77A 1TY2A 3Q0AA 3HP3A 2PCFB 2RSNA 3CHBD 4XTCS 2DY8A 2EPBA 1SNOA 2CW0C 3QG1A 2B2VA 1B2TA 4HMJA 3GV6A 5C5MA 4C2MB 4IUUA 1BQQT 5ELCA 3PUYA 4G7OC 3CRKC 1CZGA 1O80A 1ONLA 4N9TA 4RKBA 1EY4A 5CR3A 1TWFB 2I07B 1I3QB 3FPUB 5CYUA 5KNDA 1EYDA 2CHBD 2AWNA 2V4DA 2AUKA 1DOKA 1QCBD 3IAYA 2XNAC 1O78A 2NUCA 4UDUC 3QWNA 4X3KA 5M5WB 1S5DD 5LL6X 3QB3A 4KHZA 4TSSA 1TIID 1GXDC 5C5LA 2F0QA 1JOKA 2QEJC 2K28A 4Y7NB 3E5SA 3Q24A 5JPMC 1GUNA 2C9OA 5C0XG 5KNCA 2E2HB 4ULLA 1XXGA 3BDLA 5EPKA 3T51B 1ET9A 5KIXA 1LABA 5I2YA 1DZ1A 1WTRA 3PV0A 3AB9A 4K6LA 1FD7D 1Y1VB 3BYYB 3M85A 5C44B 1IKLA 2N55A 2NZ1D 3HZXA 3QIAA 2F0HA 1EEFD 4ODGA 2L0CA 3W2DA 2KUMA 1A3UA 4EQPA 4DNRB 4ZLTF 3MXUA 2NN6G 3D3RA 2X6GA 4FF2A 1QOHA 3LNNA 1ENCA 3H94A 2G9HD 1SYEA 1LTTD 4IFDI 1AEXA 1W6JA 2VXWA 1I50B 4XQNA 4I7ZC 2WAQB 1RTNA 2D2CC 1NCVA 4KJOA 4F87A 4F88A 3DEPA 4RFBA 5HURA 2WINB 5IGEA 4G7HC 1PRTF 1XTCD 3S1NB 4PMBA 2FINB 1PXUA 3R3OA 4LMQD 2AUJD 4XIGS 4MHEA 3H0GB 5FK9C 3C46A 5FO8B 4OO1H 1ESFA 2B2UC 3BDOA 4DAVA 2KEDA 5IGFA 4GZYC 2K32A 1HA5A 3QOLA 2A69D 1JICA 1STBA 4HEDA 4C56C 2O5IC 1HTPA 3MXNA 1B9MA 3NE5B 2WV6D 4OIKA 1EYCA 3QO2A 2B2WC 3DWQA 1QE6A 3P75A 3IFTA 5JJZA 1EFID 4NW2A 2F1MA 2KVMA 3WDNA 4ME5A 1BBXC 3A7AB 3NQIA 4O42A 4YIJA 3K57A 1A6XA 1F9SA 1KLUD 2B2VC 2B2TC 3GQBA 5K36H 1LLRD 1B3AA 4TRDA 3M3YB 4P2CB 5KYIA 2F0WA 1DJRD 2L9HA 5C3WA 2OXPA 4IURA 5JEAJ 1HFGA 1V1PB 5EPJA 1AFPA 1LACA 3E0JA 2Q8RE 4DFAA 1A15A 1U4RA 1LTGD 4KTAA 5CGKA 2QKIC 4B9XA 4K8IA 4WORA 1PTOD 2ZXOA 4NKLA 2O2LD 1B9NA 1HTLD 2RDHA 1T5XD 2K03A 1V8QA 1SE4A 5C4HA 3JAML 4BBSB 2RVLA 4KK7A 3K5OA 4CHTB 1I4PA 4I65A 3KBGA 1NR4A 3G6JB 3PMFA 3S1MB 4J8QA 3R8BA 1E2VA 3DXJC 3J80E 4FNFA 2PPBC 3A8IE 3K6OA 2K5DA 5A35A 4XQJA 3NWSA 2RSOA 4B9WA 1C4QA 1B53A 3KK7A 2ID0A 2JEAI 1GUTA 4OIJA 3VYRA 1LO5D 1QNKA 1LTAD 4K8JA 1SNMA 2E74C 1BO0A 2R3ZA 2A6HC 3GTGB 3TP5A 3D4DA 5TSSA 5HGTA 1EQTA 5G3LD 2BA0A 3SR1A 4WJWA 2B39A 3MZ5A 5ELDA 1MSHA 4XT1B 2EJFC 2Q8IB 1A3VA 4AYBB 1BCPB 3SXHA 4J6HA 1O7LA 4QMGA 2WIIB 5KGUA 1C48A 3BVMA 3S9WA 5IIFA 4FF3A 1H9KA 1LTRD 5FLXE 2I46A 4CGYB 2PMZB 1II3A 3MFYA 2XVSA 4KY5A 1Y1WB 1FNWA 4JK1C 2DY7A 2VB3X 4RH6A 5JPNC 3ND9A 1PFBA 4IQZA 4K5VA 4CJ0B 2IT1A 3SK4A 3I91A 2PZWA 3PUWA 2XN9C 2F4IA 2XIWA 3KF8A 4RAUC 5D3IB 2F0LA 5DNFA 2B63B 5E4XA 1TS3A 4X3SA 4H7BA 4Q0FA 1LT5D 4L6TB 1GUWA 1IL8A 5EBDA 1EL0A 3V2TA 1FNUA 3LWEA 4DNTB 2MHVA 5E4WC 3G7LA 1WD0A 3PO3B 3L3OC 1I4GA 2CW0D 2HQEA 4EGVA 1QWYA 2NYZD 1YNNC 4DF7A 1SJED 5EBCA 2XWJB 4BS9A 4E6IA 2K5QA 4LJZC 3GTKB 1XYIA 1JOQA 1DYQA 2EY2A 5M5XB 3P20A 1RODA 3DWPA 1F9PA 5EGTA 1Y69U 1OXSC 3TN2A 4PNYA 5EQ0A 4FF4A 1U4LA 5FO7B 1SNQA 1VDZA 2F0SA 5EJWA 3GTQB 1TWGB 1WTXA 2VB2X 2KECA 1H9MA 4CJ1B 1S4ZA 3SVMA 5I9OA 3HOUB 1G2SA 3C1EA 1TWCB 1CHQD 2NTSA 3SHLA 4R9WA 4M1UB 3AMUA 1EOTA 2A5HA 4IFDG 4KN7C 1AP0A 2KCCA 3ERQA 1DCZA 3F2UA 4OL7A 3MFGA 3RLFA 5C0XH 1IYVA 5BN3A 2TSSA 3U9OA 1L0XB 2EYOA 4UAIA 2FFKB 1EY9A 2NTTA 1HHVA 1EYAA 4V190 2OT2A 3VA5A 2H4OA 2X6LA 3OOCA 1QB5D 1Y8NB 2YYZA 3FKIB 2WACA 4ZKCB 1JE4A 2L12A 3I70A 3DMUA 4G7ZC 5T1GA 3GTLB 3VYTA 2NN6H 3K5LA 4A3JB 5C3EB 3HGBA 1JB3A 3LWUA 3PUVA 5ELFA 2BDOA 1EY8A 3D4RA 4QCLA 2QDBA 3TP7A 4PMWA 2RQXA 1LTBD 3HOXB 3N6RA 5DAUA 3GTMB 2QF7A 3MC0B 3C3LA 2JE6I 3Q6SA 3UI2A 4OHJA 3EROA 3A8KE 2JA6B 4A3EB 3C2PA 1H9JA 4C1NI 2JYOA 1PRTB 5CMDA 1STAA 2M2LA 5CORA 1CZWA 1IKMA 3NBHA 4ZUJA 1IHZA 2ZXPA 1A3TA 2NVXB 2EYPA 3S2HB 3J80L 2BA1A 3GTPB 4DXFA 1H9RA 4EQNA 2K01A 3KLSX 3HG9A 1BCPC 3D8GA 1BF4A 1F2MA 1Q8IA 1WCMB 1IYUA 2EVBA 4RGMA 2RDFA 1XX8A 1CQVA 1TKWB 4V0BA 3R2IA 5J22A 3VR2A 2KJXA 1WTQA 2F0EA 5CV8A 3H6MA 2F0FA 1HXYD 1U4MA 2X69A 3KLRA 1G291 4XXEA 1MD2D 1GUSA 1JORA 5ELBA 1H9SA 2Z4HA 5FLXL 3IFDA 1D2BA 1SYDA 1UUPA 5LL6S 1CFMA 1ENAA 4O1NA 1CM9A 3BS1A 4K6DA 2Z8LA 5BN5A 2EYFA 3CRLC 5NUCA 2EYHA 2F0UA 4CKEA 1TU2B 4ZQ3A 2FHTA 2ENBA 4DGZA 3T53B 5C4XB 4KY7A 1E2ZA 5FO9B 3VR6A 4QUFA 1JWUD 3SEBA 3NBIA 2XRSD 1TWHB 1Q12A 1VMPA 5IGGA 3DWAA 1CTMA 2BE5C 3SK6A 3S1QB 5T1IA 1R9TB 2K04A 4S3SA 3FRPB 3LX0A 1EIHA 4PMCA 2DNEA 4HN7A 2A68C 1KABA 4H13C 4LAAA 1EIGA 2MJ8A 3V96A 2HUGA 4G57A 1G91A 3EFXD 1EWCA 3HS0C 3A56A 5CV7A 2A6HD 2N88A 1D1IA 2KA7A 5CV5A 3NHHA 3GP7A 4JBWA 5CC4A 3VR4A 1HQRD 5C3XA 4QUCA 2YU9B 5D65A 2E75C 3GD7A 2LY7A 3HOVB 1F2YA 2Z1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3C A;  1ZXT A;  1WVL A;  1G2S A;  5EKI A;  4XDX A;  5EPL A;  3DM1 A;  2FIN B;  1ESR A;  2J7Z A;  3Q6S A;  1MI2 A;  3UI2 A;  1HUN A;  1HRJ A;  2EE1 A;  1MGS A;  4R9W A;  3MTS A;  1KNA A;  1WD1 A;  1ILQ A;  2FMM A;  4HSV A;  4LMQ D;  1CM9 A;  2NWG A;  5EPK A;  4R8I A;  1G2T A;  1B50 A;  4MHE A;  2DY7 A;  2B2Y C;  2L1B A;  4IUP A;  1EOT A;  2K03 A;  2HDM A;  1DZ1 A;  1F2L A;  2B2T A;  1PFN A;  1WTR A;  1PFB A;  2JYO A;  2MP1 A;  5CMD A;  1X32 A;  4CJ0 B;  1AP0 A;  2RVL A;  1B4O A;  2L11 A;  3TZD A;  2M2L A;  3MWY W;  4HCS A;  2B2U C;  5COR A;  1IKM A;  2FHT A;  2KED A;  1X3P A;  3I91 A;  1IKL A;  1PDQ A;  2N55 A;  2NZ1 D;  3F2U A;  5CBE E;  1HUM A;  1NR4 A;  3P7J A;  1RHP A;  2Q8T A;  4HED A;  1JIC A;  1PFM A;  2XIW A;  3I8Z A;  3HP3 A;  2RSN A;  3I90 A;  2FJ2 A;  4IUT A;  1BNZ A;  4RAU C;  2L4N A;  1ILP A;  5DNF A;  1J9O A;  4UAI A;  1M8A A;  2MGS A;  5E4X A;  1AZQ A;  4X3S A;  2DY8 A;  2FFK B;  2EPB A;  4OIK A;  3KUP A;  3QO2 A;  1LV9 A;  1SSO A;  2D9U A;  4QUF A;  2B2V A;  2BDN A;  2KUM A;  1WTO A;  1RJT A;  1B2T A;  2K05 A;  1HHV A;  2B2W C;  2KOL A;  1GUW A;  1IL8 A;  2X6L A;  2HCI A;  4U68 A;  2KEE A;  2RSO A;  1EL0 A;  3GV6 A;  1WTW A;  4X3T A;  1QE6 A;  4IUU A;  4ZAI A;  1ML0 D;  3LWE A;  1SAP A;  5E4W C;  2HDL A;  1MSG A;  1B53 A;  1VMP A;  3G7L A;  4X3U A;  5JJZ A;  1WD0 A;  2K01 A;  1WTV A;  4NW2 A;  1E0B A;  5T1I A;  1F9R A;  4ZLT F;  4OIJ A;  2KVM A;  1QNK A;  1CA6 A;  1DOM A;  1O7Y A;  3R93 A;  1C8C A;  3FDT A;  1VMC A;  2NYZ D;  1BF4 A;  2K04 A;  1HA6 A;  1Q3L A;  1SDF A;  2EOT A;  1WTP A;  1DON A;  1BBX C;  4ZKC B;  1JE4 A;  3D6W A;  2L12 A;  1XX8 A;  1EIH A;  1BO0 A;  1O7Z A;  1G6Z A;  2X6G A;  4O42 A;  2R3Z A;  4ZKB B;  1F9S A;  1O80 A;  1CA5 A;  1TVX A;  1EIG A;  2MJ8 A;  1ICW A;  2HUG A;  1XYI A;  1RTO A;  2B2U A;  2B2V C;  1NAP A;  1U4P A;  2JP1 A;  1G91 A;  1PLF A;  2IL8 A;  2K1B A;  5D14 A;  1EQT A;  1ROD A;  4RA8 A;  2B2T C;  3FPU B;  5T1G A;  2HCC A;  1WTQ A;  2SDF A;  1F9P A;  1AZP A;  1F9Q A;  3IL8 A;  1B3A A;  2N88 A;  1J8I A;  1DOK A;  2MPM A;  1NR2 A;  1MSH A;  3TN2 A;  4XT1 B;  5EQ0 A;  1U4M A;  2L9H A;  4IUV A;  2VXW A;  2X69 A;  4IUR A;  2CVR A;  1U4L A;  1HFG A;  3DEO A;  4MN3 A;  5AFW A;  5EPJ A;  4X3K A;  2B2Y A;  1RTN A;  1DOL A;  1KNE A;  2B2W A;  3GV3 A;  2H1E A;  3KBX A;  4QUC A;  4RWS C;  4CJ2 C;  5CBA E;  3ONA B;  1HFN A;  5EJW A;  5D65 A;  4ZK9 B;  1X3Q A;  2Q8R E;  5COY A;  3N52 A;  4XT3 B;  1NCV A;  3H91 A;  1QG7 A;  1WTX A;  4HAE A;  2KEC A;  1A15 A;  1U4R A;  3DEP A;  4CJ1 B;  2RA4 A;  4DN4 M;  1S4Z A;  2K28 A;  3IFD A;  3SVM A;  4IUQ A; 
#chains in the Genus database with same CATH topology
 2E76 C;  1LT3 D;  1NY4 A;  3TDQ A;  2JEB I;  4XDX A;  1SYF A;  1GO3 E;  4KD4 A;  1HRJ A;  1BR9 A;  2EE1 A;  1PTO F;  3MTS A;  5C4Z A;  1Z47 A;  1TS5 A;  1G2T A;  1GJX A;  1AN8 A;  1SR3 A;  2DNC A;  1Y1V G;  3HOZ B;  3J7A 5;  5FJ8 H;  3BU2 A;  2HDM A;  3CCR A;  4LK1 C;  3UDI A;  2CKZ B;  2VW9 A;  1B4O A;  2K5N A;  1C0A A;  1JE5 A;  1GHJ A;  1OXU A;  4B08 A;  1WI5 A;  2A19 A;  4DR2 Q;  4A93 G;  3TP8 A;  4GN5 A;  4LWC A;  4DPG A;  3PIO 3;  2YU9 H;  2E5L Q;  1B44 D;  4B3R L;  1HNW Q;  4N9P A;  1HR0 Q;  1B7Y B;  4B3M L;  3HOV H;  1T5E A;  3STB D;  3J81 c;  2QA4 A;  1HQM C;  1TS4 A;  3CCM A;  1VQM A;  5FOB B;  4PZ7 A;  2K05 A;  2DJF C;  3U50 C;  3NUC A;  4QJF A;  5C6A A;  5IP7 G;  5IYC G;  4A3L G;  1VQB A;  2GN5 A;  1ML0 D;  2K5W A;  2UXB L;  1SAP A;  4A3B G;  1N34 L;  4A3M G;  1KDA A;  3MAQ A;  3G48 A;  2QEX A;  3HOZ H;  4R4Q A;  3R93 A;  3CCQ A;  2R92 B;  1Q3L A;  1SDF A;  3OWE B;  1DD2 A;  1SLJ A;  2V1C C;  2Q2T A;  4BY1 G;  5IT9 E;  3OSO A;  2L15 A;  1G6Z A;  2A6E C;  2LS0 1;  4DAP A;  4NP5 A;  4GLX A;  5M3F G;  4DV5 L;  1YNN D;  2K1B A;  1OXX K;  4JC0 A;  3FMC A;  3BDC A;  5EKL A;  2VQE L;  2O5J C;  4K5X A;  5DEH A;  5G3L F;  4NXM L;  1RD9 D;  2WAQ G;  1SE2 A;  4HID A;  1GOZ A;  2E2J B;  4A3D G;  1VQG A;  4LF5 L;  4APV A;  4MZ9 A;  4MN3 A;  1BBW A;  4KMU C;  2AQ3 B;  2F0K A;  2N49 A;  2KHS A;  1PRT C;  3KBX A;  2H1E A;  1SYC A;  2R7Z B;  5CV9 A;  5J39 A;  4JVZ A;  1N36 L;  1PH3 A;  2R92 H;  5GRO A;  3VDY A;  1HNX L;  5JJI A;  1MHW C;  5JJL A;  1S5B D;  1Y14 B;  4LF9 L;  2IW3 A;  3EIV A;  2J7Z A;  3UDG A;  2UUC Q;  3PIP 3;  1HH2 P;  3PSI A;  4KKS A;  4L8J A;  4ZUI A;  1Q90 A;  2FMM A;  4IUN A;  1Q82 C;  4RHS A;  3D6C A;  5JVH 3;  2L1B A;  2PO4 A;  1Z7T A;  2A1A A;  3K0X A;  1JR0 D;  1ET6 A;  4KY6 A;  1NE3 A;  2E2J H;  3KF8 B;  2L11 A;  3TZD A;  4ABN A;  5K36 G;  4TKO B;  1PH6 A;  4KJN A;  2BH8 A;  1DXM A;  3H09 A;  2Z6B A;  2NZH A;  3CQZ B;  3CCU A;  3AU7 A;  1FVI A;  2WB1 E;  1RHP A;  3WOF A;  2R7Z H;  4FF1 A;  3I8Z A;  1WYD A;  1VQI A;  1AE2 A;  3HKZ G;  1E2W A;  1V9P A;  4KV6 A;  5C4J B;  2SNM A;  1U5K A;  1M8A A;  4TQU S;  4C3H G;  4ZCK A;  1AZQ A;  3KUP A;  2PNR C;  1ZYR C;  3K5N A;  3K58 A;  4IFD H;  2K75 A;  5LMU Q;  2XRQ D;  2QCP X;  4K2L A;  1C7Y A;  2JA5 B;  2E2I B;  3ULP A;  1B1Z A;  5EAY A;  5I4D A;  3OHX C;  4X3U A;  1YI2 A;  1I94 L;  3OIP A;  5IOC A;  3CCV A;  1Y8O B;  1ENF A;  3STB C;  3TBI B;  3A5U A;  3FDT A;  3BG3 A;  3S16 B;  1NSN S;  1KDB A;  4Z9C B;  4DV6 L;  5IYD H;  3E3X A;  1DON A;  2PQE A;  4I7A A;  2K5V A;  4RCN A;  4QB4 A;  1PYS B;  5J3B A;  1KQS A;  1EZ6 A;  1ICW A;  3CQZ H;  4K2K A;  4CKC A;  2K50 A;  4X62 L;  4O2D A;  1OXV A;  3NQT A;  1S5F D;  1V1O A;  3ERS X;  5C4J H;  1XWE A;  2TMP A;  4OEM B;  3H3V C;  2F3V A;  4R4C A;  3QR8 A;  1NMF A;  2OQK A;  4DUY L;  2JA5 H;  1I6V C;  1LUZ A;  3PIO A;  2G9D A;  3EQL C;  3V05 A;  3F2B A;  1G8Z D;  2E2I H;  4YWL A;  2RCN A;  4A3K B;  1HFN A;  5JEA G;  4GNX B;  3MXP A;  1ICF B;  5M3M G;  5C0X J;  1D7Q A;  5DM6 3;  1Z6H A;  3S16 H;  2Z4I A;  3W3A A;  4GLV B;  5CV6 A;  4LW1 A;  4ILW A;  3FVQ A;  3JC6 6;  2K33 A;  3OIQ A;  4RKL A;  2F0G A;  1GD7 A;  3DM3 A;  4HSP A;  1KRS A;  4H02 A;  3TP6 A;  3AFQ A;  1J6Q A;  1EZ8 A;  1LTI D;  2AQ1 B;  4A4I A;  4DR2 L;  4BY7 B;  3QJY A;  4GN4 B;  2E5L L;  4BA1 I;  5F2D A;  1HNW L;  5J1Z A;  3OMC A;  1E1T A;  2JK8 A;  1FYC A;  2IX3 A;  1HR0 L;  3PUX A;  2SEB D;  4HCE A;  5CBE E;  1R4P B;  5HGQ A;  2VY3 A;  2NVY B;  2JA8 B;  1STN A;  3CU7 A;  4A3K H;  1DGS A;  2Q8T A;  1A2U A;  2FJ2 A;  1D5M C;  2MFI A;  4BWG B;  1S40 A;  1I5F A;  2MGS A;  1M4V A;  4C3J G;  4KHP Q;  5IOD A;  4C3I G;  2HT1 A;  1W6K A;  4DV7 Q;  2IWH A;  3GTO B;  2A73 B;  1SRU A;  1K73 C;  3L7Z C;  4LF6 L;  2EYJ A;  5GAG C;  1JWS D;  4DV2 Q;  2I0Q A;  3A8J E;  4BY7 H;  4OO1 I;  1VMC A;  3ICE A;  1UAP A;  1S5E D;  2KQ3 A;  2IPK D;  2CH4 A;  1QJO A;  1IW7 C;  1JCK B;  2ICE C;  1UE5 A;  3K5M A;  1BCP D;  2WB1 B;  1TT2 A;  2OEO A;  1N33 Q;  2JA7 B;  4RCO A;  3NSW A;  3CXC A;  1RTO A;  2NVY H;  4XYQ A;  1A62 A;  2B2U A;  4YY3 L;  2JA8 H;  1U4P A;  4HMI A;  3I4N G;  2EYL A;  2SOB A;  5I6W A;  4IPC A;  4AYB G;  2F0P A;  2SDF A;  4EQO A;  3ITP A;  4RHR A;  4HR7 B;  2R93 B;  4KKT A;  4A3I G;  4KKU A;  3NTH A;  1K8M A;  1JMC A;  3PGZ A;  4DU9 A;  4DK0 A;  1EU4 A;  3GTO H;  3UDF A;  2B2W A;  2LKV A;  3NTK A;  3DHQ A;  4H44 C;  4RWS C;  4CJ2 C;  4HJ9 A;  2AWO A;  5COY A;  3M4Y A;  1SNC A;  2K14 A;  3FHW A;  4JW0 A;  3RMH A;  4IUQ A;  2Y0S G;  1I4R A;  1JJG A;  1EY7 A;  2ZT9 C;  2EZV A;  4NDX A;  2JA7 H;  1MI2 A;  1KD1 C;  1HUN A;  2F0D A;  1UWV A;  2F3W A;  1IBL Q;  2K6A A;  1SEB D;  1WD1 A;  4FXK C;  4L63 B;  3VR3 A;  5K5P A;  3KDF A;  4O0A A;  4LF7 Q;  2NWG A;  3NBH B;  4JI8 Q;  3Q8D A;  4X65 Q;  2R93 H;  2B2T A;  5E3F A;  2MP1 A;  4JCV E;  4JI6 Q;  1STG A;  3PO2 G;  3MWY W;  1MJE A;  3S2D B;  1PDQ A;  3WOE A;  2RBM A;  4P74 A;  1Q8K A;  4GN3 B;  5GAH C;  1D6E C;  5LMU L;  1M90 C;  4DAY A;  2VUM B;  1ILP A;  1J9O A;  5ISR A;  1V43 A;  3OW7 A;  4M8A A;  3CPW A;  5A2Q E;  2OTJ A;  1WTO A;  1RJT A;  1RKN A;  4A3F G;  2XSC A;  3HRZ C;  4GKK Q;  1PZI D;  4H0L C;  4ZAI A;  1D5Z C;  1KHI A;  2M9V A;  4ZYS A;  1MSG A;  2RDG A;  1UEA B;  3CF5 A;  4IZ8 A;  2KCN A;  3I4M B;  1F9R A;  5KEE A;  3ER0 A;  5BN4 A;  1L0Y B;  1M1K C;  1FR3 A;  5IT9 L;  3EVQ A;  1CKO A;  2EOT A;  4HIM A;  1WTP A;  2F03 A;  4POG A;  3T13 A;  3VYS A;  2C5C A;  2BE5 D;  2EY6 A;  4HTH A;  4DXG A;  1X55 A;  3S2D H;  4F8M A;  1KC8 C;  4RGO S;  4K0K L;  2JA9 A;  3RD4 A;  3DUZ A;  3I4L A;  3A55 A;  1VQC A;  1IBM Q;  2VUM H;  2JXM B;  2A68 D;  1KLG D;  1D1K A;  2D62 A;  1JC7 A;  1XMO Q;  1SMY C;  5I2X A;  1EUJ A;  4A3C G;  2ZTC A;  4JOI A;  2CVR A;  1H9S B;  3RUZ A;  5HY6 A;  1NUC A;  4G4K A;  3GV3 A;  1FNV A;  4C1N K;  3BYT B;  3ONA B;  3HOU G;  1X3Q A;  3I4M H;  4XT3 B;  5GAD C;  4RGN A;  5IGD A;  1XJV A;  5IYB G;  3K0Y A;  3P1H A;  4EVO A;  1K3B C;  1VF5 C;  2M00 A;  1HPC A;  2RA4 A;  2O4X A;  1WVL A;  1G51 A;  3J81 i;  1BOS A;  5EPL A;  3I7F A;  2NVQ B;  5KRU A;  3TSS A;  3L0O A;  2NVT B;  1N9W A;  3QOJ A;  3JAM c;  4A93 B;  1ILQ A;  1GUG A;  4QL5 A;  1GUO A;  3A7L A;  1YNJ C;  1PV4 A;  4JI2 Q;  2BCO A;  4MTN A;  1X32 A;  3F2D A;  1FJG Q;  3LGJ A;  1PTO B;  4KHP L;  1JQY D;  4F7X A;  4DV7 L;  3MA2 B;  1EIY B;  1K0S A;  1VQE A;  3NK9 A;  1JT8 A;  1SYG A;  3CCJ A;  4A3B B;  3SE0 A;  4IUT A;  4A3M B;  1HZC A;  2F0N A;  3ND8 A;  4DV2 L;  1XMQ Q;  2KOL A;  4BY1 B;  3T56 B;  2D5D A;  4KI0 A;  2NB0 A;  4J15 A;  3Q22 A;  4DR3 Q;  3M4O B;  2E2D C;  2R61 A;  2OF1 A;  2SNS A;  4XQQ A;  1WTW A;  4FXD A;  2MUY A;  1I6H B;  2NVT H;  1EY5 A;  1EU3 A;  3FKI G;  4A93 H;  2UXC Q;  5M3F B;  1WTV A;  4QF4 A;  1E0B A;  2R6G A;  1TWA B;  2PI2 A;  3J81 E;  1EWH A;  1N33 L;  1O7Y A;  4HIK A;  1VQ5 A;  4FYD A;  2PZT A;  1KTK A;  1EOV A;  1RIP A;  3D6W A;  4GNX C;  4KN4 C;  2UUB L;  1O7Z A;  1QNU A;  4A3D B;  2PW5 A;  1PTO H;  3GO5 A;  2VQF Q;  4NMZ A;  5IYC H;  1PMR A;  1NAP A;  4A3J G;  4A3L H;  2JP1 A;  3CMA A;  1EY0 A;  4A3B H;  1UE6 A;  2A6E D;  4A3M H;  1CI3 M;  1K9M C;  1F9Q A;  3IL8 A;  4AH6 A;  5H1S E;  1H95 A;  2A74 C;  1J8I A;  2MPM A;  3ZYY X;  5JAV A;  1UEB A;  1I4X A;  4YCW A;  4DR7 Q;  4JYA Q;  5ELE A;  4BY1 H;  3G6E A;  1UE7 A;  3M4O H;  2QIL A;  2B2Y A;  4DA2 A;  5IGC A;  1KNE A;  1I6H H;  2VL6 A;  1BXT A;  4ZK9 B;  5M3F H;  1TWA H;  4HAE A;  1PH2 A;  2UUA Q;  4ID6 A;  1IBL L;  3CAM A;  3D31 A;  1PRT D;  1QIL A;  1TY0 A;  1EY6 A;  1ZXT A;  1HNZ Q;  1X3E A;  1PYW D;  1VS0 A;  1WOC A;  2GA4 B;  4IAL A;  4A3G B;  4JI8 L;  3T4A C;  4DR1 Q;  4PG3 A;  4A3D H;  4LFA Q;  3L9A X;  4X65 L;  1VQ7 A;  1RF2 D;  1MGS A;  3K7A B;  3MHB A;  4JI6 L;  1A63 A;  1B50 A;  2EDG A;  2LXJ A;  5M9O A;  1GKH A;  1VF7 A;  4IUP A;  4IN3 A;  1YIT A;  3HKZ B;  1JWM D;  2F0I A;  1CK1 A;  1A2T A;  2RKS A;  3NP8 A;  3I56 A;  5KNB A;  1QZG A;  1OXT A;  4C3H B;  4BXX H;  1FL0 A;  3S15 B;  2ALY B;  3IKJ A;  4AIM A;  3URY A;  1LTS D;  1TR5 A;  4PV1 C;  1GHK A;  2PZU A;  4N8X 1;  3NTI A;  2DN8 A;  4GKK L;  3SK5 A;  1QVG A;  3I90 A;  1YJW A;  1BNZ A;  2L4N A;  2NBF A;  1ZKO A;  5LMN Q;  3MEH A;  1IYJ B;  1EYG A;  3RLN A;  1SSO A;  2D9U A;  2IY5 B;  3HOY B;  3T16 A;  1BDO A;  4QGU A;  5C44 G;  2UU9 Q;  2IX1 A;  3F1Z A;  3MXG A;  4A3G H;  2HCI A;  4U68 A;  1HCZ A;  1I4H A;  2KEE A;  3RN2 A;  3S17 B;  3K7A H;  4XYO A;  3J7Y W;  2UXD Q;  1ZYR D;  2F0V A;  4B3T Q;  4MIU A;  4R4O A;  1DOM A;  2B8F A;  4FXG C;  3NEM A;  1C8C A;  1HA6 A;  2F0M A;  4C3H H;  5C0X I;  3S15 H;  1IBM L;  2EJM A;  4OWT B;  1CA5 A;  2WP8 J;  4DUZ Q;  1SXT A;  4JG2 A;  3K59 A;  2BOS A;  1XMO L;  1KDC A;  5D14 A;  3IRB A;  4MNO A;  3U9S A;  3NEL A;  4CKB A;  1VQA A;  3KOJ A;  1STH A;  5M3M B;  3K81 C;  1RCV D;  3M7N A;  1CT1 D;  2Z9H A;  2EY1 A;  3HOY H;  4IUV A;  5I9P A;  1LM0 A;  1X3F A;  3W1B A;  2DJG C;  1SBB B;  3S17 H;  3AQQ A;  5CBA E;  2ZXR A;  1JOO A;  1SNP A;  3EJI A;  3N52 A;  4LF4 L;  3H91 A;  2P5Z X;  1QG7 A;  4UHV A;  1I4Q A;  2RHQ B;  2PYK A;  3GDE A;  4DN4 M;  2VS1 A;  1V1P A;  4OO1 G;  3CCS A;  3I3C A;  1CKM A;  2EYM A;  1QZH A;  1S3O A;  4ZRZ A;  1VQD A;  4LFC Q;  1PH9 A;  1ESR A;  4R8N A;  3RLO A;  4JI2 L;  3NWT A;  4IFD J;  4HSV A;  2J4X A;  1Q46 A;  2ASB A;  2NN6 I;  3F2C A;  1FJG L;  2OQ0 A;  1K28 A;  5FKA C;  5JEA H;  3VA7 A;  3NEN A;  4IJH A;  5M3M H;  3I73 A;  3OPO A;  1S5C D;  3E6Z X;  4WRD A;  5C4X G;  4C3J B;  2A69 C;  4C3I B;  2L55 A;  4BA2 I;  4K5W A;  2CWP A;  1FGB D;  4RGT A;  1HUM A;  1PYB A;  3CPF A;  1EIF A;  2GVA A;  1FGU A;  3P7J A;  1XMQ L;  1L0W A;  1XNR Q;  4OGQ C;  3H0G G;  1V1Q A;  5IWA Q;  4DR3 L;  1SYB A;  1EQV A;  1D5X C;  1QVC A;  5LHY 1;  5JVG 3;  5A2Q L;  4WFN 3;  3TRZ A;  3FEW X;  4GOP B;  1VQF A;  3EA6 A;  4J1M A;  3CCL A;  2UXC L;  5GAE C;  3U4V A;  2BDN A;  1K83 B;  1KRT A;  3OWF A;  4DK1 A;  1Q1E A;  5IGB A;  5E1F A;  2HDL A;  1VQ6 A;  4JI0 Q;  3I72 A;  1LT6 D;  3PUZ A;  1F2Z A;  2J0T D;  1JJ2 A;  3BVG A;  2XWB B;  3I4N B;  1LT4 D;  1SE8 A;  1CA6 A;  1BVS A;  1CHP D;  2CQA A;  4DR6 Q;  1MBY A;  5I6Y A;  2HHH Q;  4C3J H;  5CV4 A;  2WKD A;  4A3I B;  4C3I H;  1TQO A;  4ZKB B;  1KL9 A;  3CCE A;  2EJG C;  5LMN W;  1PLF A;  3BZD B;  3OTO Q;  4DR7 L;  1AW7 A;  4RA8 A;  3RZO B;  1BUV T;  4KD3 A;  2RHS B;  1IW7 D;  1AH9 A;  4IPD A;  1PFS A;  4GOP A;  3CKI B;  3MEF A;  1NR2 A;  4R4T A;  3FPP A;  1K83 H;  2EY5 A;  2JSO A;  2Y0S B;  3DEO A;  2UUA L;  1CQF A;  3HOW B;  2LFN A;  4DV3 Q;  4QIW E;  1VQ4 A;  1HNZ L;  4NXN L;  4JI1 Q;  3S1R B;  3BVZ A;  3NPP A;  4DR1 L;  1PTO C;  3I4N H;  3C1F A;  1Q1B A;  4U67 3;  3TEH B;  4A3I H;  4R1J A;  1DM0 B;  3K8A A;  5EKI A;  3SK8 A;  1YJN A;  1EFW A;  1TS2 A;  5M5Y B;  3PO2 B;  1VQP A;  3J7A V;  3S14 B;  1KNA A;  1KAA A;  3A54 A;  2I5M X;  4R8I A;  3RZO H;  1K8O A;  2L5T A;  1PZJ D;  2K5H A;  2B2Y C;  5JOB A;  5EKK A;  2CWA A;  4POF A;  1OO9 B;  4OEL B;  1UNS A;  2RF4 A;  3J7A F;  1SFO B;  4HCS A;  2LMC B;  3X3N A;  3J80 c;  4A3F B;  1X3P A;  5LMN L;  1STY A;  4IOA A;  3OMG A;  2B8G A;  3HOW H;  4CDE C;  4HIO A;  1IBK Q;  1PFM A;  2JJQ A;  3S1R H;  2UU9 L;  4Q5V A;  1PZK D;  2PW7 A;  2H5X A;  2K7V A;  4BBS G;  4JBJ A;  2AQ2 B;  5GQO A;  1LV9 A;  5IP9 G;  3OYY A;  3KLS A;  1VCI A;  3MVV A;  3PCO B;  1VQL A;  2I5H A;  2IJ0 A;  5M5Y H;  3PO2 H;  3BZC A;  1PH4 A;  2KHJ A;  4X3T A;  3TME A;  2EXZ A;  3S14 H;  2B29 A;  3J81 L;  2ZTE A;  4BBR B;  3D4W A;  1CSP A;  1SE3 A;  4L5S A;  1STE A;  4KHV A;  3CME A;  1U9R A;  1SFO H;  4FO2 A;  1EWI A;  4DR4 Q;  4A3F H;  4DK3 C;  1TVX A;  1BCP F;  3SDZ A;  3TS0 A;  3PF4 A;  2KCM A;  4JPB W;  2IL8 A;  4LF8 Q;  3JAM i;  1EEI D;  1RDP D;  3R2T A;  2HCC A;  2NZO A;  1AZP A;  2F0J A;  4X6A H;  1EQQ A;  3CP0 A;  1R4Q B;  3Q23 A;  4X64 Q;  5AFW A;  3H3V I;  2WKC A;  5FLX c;  1DOL A;  2ICI A;  3NXW A;  2MQH A;  3O13 A;  4DV4 Q;  4BBR H;  4LFC L;  1SMY D;  3BZK A;  3VYU A;  3X3M A;  3KDF B;  2F0T A;  2F0O A;  4PQX A;  3M7G A;  2FMC A;  1VQJ A;  1SJH D;  3RZD B;  3G4S A;  3GTJ B;  4FP5 D;  2PI2 E;  2MO1 A;  1K8A C;  2VNU D;  3DM1 A;  4X66 Q;  1J5E Q;  4A3C H;  4YWK A;  3BJU A;  5KYL A;  1UE1 A;  1ZEQ X;  5D3D A;  2E8G A;  3VR5 A;  1VQK A;  4K14 A;  3HEJ A;  5IYB H;  1F2L A;  1PFN A;  4OON A;  4DAY B;  4PZ8 A;  1X65 A;  2UUC L;  5IWA L;  3JAM E;  4WJ3 M;  4QIW B;  3TZU A;  4FVM A;  1Y1W G;  1SND A;  1YNJ D;  2IX0 A;  4CBV A;  5DM7 3;  1Y8P B;  1F77 A;  1TY2 A;  1QUQ A;  3Q0A A;  3HP3 A;  2PCF B;  2RSN A;  3CHB D;  4XTC S;  1XTD A;  1YHA A;  2DY8 A;  4JI0 L;  2EPB A;  1SNO A;  1N8R C;  2CW0 C;  3QG1 A;  3TS2 A;  2B2V A;  1B2T A;  4IOC A;  3RZD H;  4HMJ A;  3GTJ H;  4QQB X;  3GV6 A;  5C5M A;  4C2M B;  2YTV A;  4IUU A;  4DR6 L;  1NBW A;  2HHH L;  3M4Q A;  4DAM A;  1YEZ A;  2WAQ E;  2F3I A;  1Q86 C;  2CH4 W;  4YCU A;  1JB7 A;  2B63 G;  1IL2 A;  1BQQ T;  3AYH B;  5ELC A;  3PUY A;  3OTO L;  4G7O C;  2BH2 A;  3CRK C;  1CZG A;  1O80 A;  1ONL A;  3PO3 G;  4N9T A;  4RKB A;  1EY4 A;  4DKA C;  5CR3 A;  1TWF B;  1S72 A;  2I07 B;  1I3Q B;  3FPU B;  5CYU A;  5KND A;  2EIF A;  1EYD A;  2CHB D;  2AWN A;  4L5R C;  2V4D A;  2AUK A;  1CUK A;  1DOK A;  1NNX A;  1HZ9 A;  1QCB D;  4JI1 L;  4A3K G;  2EXD A;  3IAY A;  2XNA C;  2D0O A;  1O78 A;  2NUC A;  4UDU C;  2KCT A;  3QWN A;  4X3K A;  5M5W B;  1S5D D;  4C2M H;  5LL6 X;  3QB3 A;  4KHZ A;  4P71 A;  4TSS A;  4UP9 A;  1TII D;  1GXD C;  1G6P A;  2ES2 A;  5C5L A;  2F0Q A;  1N32 Q;  1JOK A;  2QEJ C;  2K28 A;  4Y7N B;  3E5S A;  3Q24 A;  5JPM C;  1GUN A;  2C9O A;  5C0X G;  5KNC A;  3U58 A;  4GOP C;  2E2H B;  3HKZ E;  4ULL A;  1XXG A;  3BDL A;  5EPK A;  1TWF H;  1I3Q H;  5L37 A;  2KBN A;  3T51 B;  1ET9 A;  4YCV A;  5KIX A;  1LAB A;  5I2Y A;  4DR5 Q;  1DZ1 A;  4EQ5 A;  1WTR A;  4HJ8 A;  3PV0 A;  3AB9 A;  4K6L A;  1FD7 D;  1Y1V B;  3BYY B;  3M85 A;  3TQY A;  5C44 B;  1IKL A;  2N55 A;  2NZ1 D;  5M5W H;  1WJJ A;  3PQI A;  3HZX A;  3QIA A;  2PQA A;  2F0H A;  4NB3 A;  3T1Y Q;  3CW2 C;  1PH7 A;  1EEF D;  4Y7N H;  4ODG A;  2L0C A;  3W2D A;  2KUM A;  1A3U A;  1Z9F A;  4DV1 Q;  4EQP A;  2HIV A;  2E2H H;  1P16 A;  2Q2I A;  4DNR B;  4KLK A;  4ZLT F;  4DV5 Q;  1CKN A;  3MXU A;  4DR4 L;  1YBY A;  2NN6 G;  2WB1 G;  2AMC B;  5E7N A;  2ZJQ A;  3D3R A;  1PH5 A;  1L1O A;  4LF8 L;  2B3G A;  2CCZ A;  2X6G A;  4FF2 A;  1Y1V H;  1QOH A;  5C44 H;  3LNN A;  2R93 G;  3I2Z A;  1ENC A;  4N8F A;  3H94 A;  4X64 L;  2G9H D;  1SYE A;  1XPO A;  1LTT D;  4IFD I;  1AEX A;  1W6J A;  5FLM G;  4DV4 L;  3L2P A;  3ZJY C;  5BR8 Q;  2VXW A;  1I50 B;  2OWO A;  4XQN A;  4I7Z C;  2WAQ B;  1RTN A;  4LFB Q;  4L5Q A;  1ASY A;  2D2C C;  4RG1 A;  1NCV A;  4KJO A;  4F87 A;  4X66 L;  4F88 A;  3DEP A;  5IP7 H;  1J5E L;  4RFB A;  5C3E G;  5HUR A;  5IE8 A;  2WIN B;  2YV5 A;  5IGE A;  4G7H C;  4LUV A;  1PRT F;  1XTC D;  3S1N B;  4PMB A;  2FIN B;  1YJ9 A;  1PXU A;  3R3O A;  3HFZ B;  1X6O A;  4LMQ D;  4UP7 A;  2AUJ D;  4XIG S;  4MHE A;  3HOX G;  3H0G B;  5FK9 C;  3C46 A;  5FO8 B;  1VQN A;  3H15 A;  4OO1 H;  1ESF A;  1I50 H;  2B2U C;  3BDO A;  4DAV A;  4Y52 H;  2KED A;  5IGF A;  2VUM G;  3KLW A;  1B70 B;  4LF7 L;  2JA6 G;  4GZY C;  2AHO B;  4A3E G;  2YTY A;  3D0F A;  2K32 A;  3M4P A;  1HA5 A;  3QOL A;  2G5D A;  2A69 D;  1JIC A;  1STB A;  2JN4 A;  4HED A;  4C56 C;  2O5I C;  1HTP A;  3MXN A;  1B9M A;  2MO0 A;  2Q2H A;  3NE5 B;  2WV6 D;  3WWV A;  4OIK A;  1EYC A;  3QO2 A;  2YTX A;  2ATW A;  2B2W C;  3S1N H;  1CSQ A;  3DWQ A;  4OWW B;  1QE6 A;  3P75 A;  4AYB E;  3IFT A;  1A8V A;  5JJZ A;  1EFI D;  1E7Z A;  4NW2 A;  2F1M A;  2KVM A;  4JI3 Q;  1SMX A;  1BKB A;  5AJ3 Q;  3H0G H;  3WDN A;  1LYL A;  4ME5 A;  1BBX C;  4JBM A;  1Q7Y C;  2F4V Q;  3A7A B;  3NQI A;  4O42 A;  4B3S Q;  4YIJ A;  3K57 A;  1A6X A;  1F9S A;  1B8A A;  2KHI A;  1KLU D;  2B2V C;  2PMZ E;  3KJP A;  1EQR A;  2B2T C;  3GQB A;  5K36 H;  4HJ5 A;  2Y0S E;  1LLR D;  1WCM G;  1B3A A;  4TRD A;  3M3Y B;  4P2C B;  5KYI A;  2WFW A;  2F0W A;  1VQ8 A;  1DJR D;  2L9H A;  2OXP A;  4OWX B;  4IUR A;  5JEA J;  5C3W A;  1N32 L;  2EQS A;  1HFG A;  1X56 A;  2DGY A;  1V1P B;  4P72 A;  4JI4 Q;  5EPJ A;  1AFP A;  1LAC A;  3J80 i;  3E0J A;  2VZA A;  2Q8R E;  3S24 A;  4DFA A;  1A15 A;  1U4R A;  1Q81 C;  1LTG D;  3J7Z C;  4KTA A;  5CGK A;  1XPR A;  4YHH Q;  2QKI C;  4B9X A;  4K8I A;  2F52 A;  1GM5 A;  4WOR A;  1VQO A;  1PTO D;  2ZXO A;  4NKL A;  4AQY Q;  4DR5 L;  4UPA A;  2MNA A;  2O2L D;  1B9N A;  1HTL D;  2JQO A;  2RDH A;  1T5X D;  2K03 A;  1V8Q A;  1SE4 A;  3M3Y H;  2ZTD A;  5C4H A;  3JAM L;  4BBS B;  2RVL A;  4KK7 A;  1GVP A;  3K5O A;  4CHT B;  3T1Y L;  1I4P A;  4I65 A;  3KBG A;  1NR4 A;  4MTK A;  1X54 A;  3G6J B;  2C35 B;  5ELN A;  3PMF A;  4DV1 L;  4LF6 Q;  3S1M B;  4J8Q A;  3R8B A;  3CD6 A;  1E2V A;  3DXJ C;  4JOI C;  4R4I A;  3J80 E;  1C9O A;  4FNF A;  2PPB C;  3A8I E;  3K6O A;  2K5D A;  5A35 A;  4XQJ A;  4LUO A;  2IHF A;  3W1G A;  3NWS A;  2RSO A;  1QVF A;  4B9W A;  1C4Q A;  1WTH A;  3KK7 A;  1B53 A;  3CC7 A;  2ID0 A;  1KIX A;  3TRE A;  3ULJ A;  4DK6 C;  2JEA I;  4YY3 Q;  1GUT A;  4OIJ A;  3VYR A;  1LO5 D;  1QNK A;  1YHQ A;  5ELO A;  1T9H A;  1LTA D;  3KJO A;  4K8J A;  1SNM A;  2E74 C;  4BBS H;  1BO0 A;  4DV0 Q;  5IP9 H;  1SN8 A;  2R3Z A;  3J81 j;  2A6H C;  3GTG B;  4CDF C;  3TP5 A;  3D4D A;  1ASZ A;  1L2F A;  3K7U C;  5TSS A;  3ULL A;  5BR8 L;  5HGT A;  4BXX G;  1EQT A;  5G3L D;  4OX9 Q;  2BA0 A;  3S1M H;  3SR1 A;  4WJW A;  2B39 A;  3MZ5 A;  4LFB L;  1E22 A;  5ELD A;  1MSH A;  4XT1 B;  2EJF C;  4P73 A;  2Q8I B;  3W5O A;  2LXK A;  3T1H Q;  1A3V A;  4AYB B;  2VQF L;  1BCP B;  3SXH A;  5DLQ E;  1L1O C;  4J6H A;  5FJ8 G;  4A3G G;  1O7L A;  4QMG A;  4CDD C;  2WII B;  5KGU A;  1C48 A;  3BVM A;  4IPH A;  5IIF A;  3S9W A;  4JYA L;  1VQ9 A;  4FF3 A;  1H9K A;  1LTR D;  5FLX E;  2I46 A;  4CGY B;  2PMZ B;  3GTG H;  1II3 A;  2HQL A;  3MFY A;  2XVS A;  1KXL A;  1TXY A;  4KY5 A;  1Y1W B;  1FNW A;  3RR5 A;  3HOV G;  4JK1 C;  2DY7 A;  2VB3 X;  4RH6 A;  5JPN C;  2N78 A;  3I4O A;  3ND9 A;  1PFB A;  4IQZ A;  4K5V A;  3FP9 A;  4CJ0 B;  4LFA L;  4CDC C;  1YHB A;  2IT1 A;  3SK4 A;  1W2B A;  3I91 A;  2PZW A;  3PUW A;  2XN9 C;  2F4I A;  3HOZ G;  2XIW A;  3HOY G;  3KF8 A;  3UDX A;  4RAU C;  1E24 A;  5D3I B;  2F0L A;  5DNF A;  2B63 B;  5E4X A;  1TS3 A;  4X3S A;  2ZJR A;  4H7B A;  4Q0F A;  1LT5 D;  4L6T B;  1HR0 W;  2I5L X;  4JI3 L;  1GUW A;  1IL8 A;  5AJ3 L;  5EBD A;  5IT9 c;  1EL0 A;  4JI7 Q;  3V2T A;  1FNU A;  3LWE A;  4DNT B;  2MHV A;  5E4W C;  3G7L A;  1WD0 A;  3PO3 B;  3L3O C;  1I4G A;  1Y1W H;  2F4V L;  2CW0 D;  4K0K Q;  4B3S L;  2HQE A;  4EGV A;  1O7I A;  1QWY A;  2NYZ D;  1YNN C;  1VQH A;  4DF7 A;  1SJE D;  5EBC A;  1NMG A;  2XWJ B;  4BS9 A;  4E6I A;  1MIU A;  3UE1 A;  2K5Q A;  4LJZ C;  3HKS A;  2UXD L;  3GTK B;  1XYI A;  2PNH A;  1JOQ A;  1DYQ A;  2EY2 A;  4B3T L;  5M5X B;  3P20 A;  1ROD A;  2ZM6 Q;  2R92 G;  3DWP A;  1W3S A;  4JI4 L;  1F9P A;  3EN2 A;  4IPG A;  5EGT A;  4P75 A;  1XNQ Q;  1Y69 U;  2B63 H;  1OXS C;  3TN2 A;  1XPU A;  4PNY A;  5EQ0 A;  4DUZ L;  4FF4 A;  1U4L A;  1YIJ A;  5FO7 B;  4YHH L;  1SNQ A;  1VDZ A;  2F0S A;  3PO3 H;  5EJW A;  3GTQ B;  1TWG B;  1WTX A;  2VB2 X;  2KEC A;  1H9M A;  4LNQ A;  2OCE A;  4AQY L;  4HJA A;  4CJ1 B;  1S4Z A;  3SVM A;  5I9O A;  1NTG A;  3HOU B;  1HZA A;  1G2S A;  3C1E A;  1TWC B;  1CHQ D;  5JJK A;  2NTS A;  3SHL A;  4GNX A;  3GTK H;  2R7Z G;  2K52 A;  2HD3 A;  4M1U B;  4R9W A;  4L5T A;  5M5X H;  1NJI C;  3AMU A;  1EOT A;  2A5H A;  1QUQ B;  1OTC A;  4IFD G;  2Q2U A;  4KN7 C;  1AP0 A;  1YVC A;  2KCC A;  3AFP A;  3ERQ A;  1DCZ A;  3F2U A;  4OL7 A;  3MFG A;  3RLF A;  5C0X H;  1IYV A;  5BN3 A;  2TSS A;  3U9O A;  1L0X B;  3GTQ H;  1TWG H;  2EYO A;  3A74 A;  5IYD G;  1A0I A;  4UAI A;  3PIP A;  2FFK B;  1EY9 A;  3HOU H;  2NTT A;  1HHV A;  1EYA A;  1K3R A;  4V19 0;  1TWC H;  2OT2 A;  2H4O A;  3VA5 A;  2X6L A;  4JI5 Q;  4ME3 A;  3OOC A;  2UUB Q;  1XNR L;  4YWM A;  1QB5 D;  3A5Z B;  4DV0 L;  2Z6K A;  1Y8N B;  2YYZ A;  1AE3 A;  4GLA C;  1B3Q A;  3FKI B;  2WAC A;  3A0J A;  4ZKC B;  1JE4 A;  4JV5 Q;  2JA5 G;  2L12 A;  3I70 A;  4OX9 L;  3DMU A;  3U4Z A;  4G7Z C;  3DLL A;  3T1H L;  5T1G A;  3I55 A;  3GTL B;  3VYT A;  2NN6 H;  3K5L A;  4A3J B;  3HOW G;  5C3E B;  2XTI A;  3RNU A;  3HGB A;  1PHJ A;  1IZ6 A;  1JB3 A;  3LWU A;  3PUV A;  5ELF A;  2BDO A;  1EY8 A;  3D4R A;  4UY8 C;  4QCL A;  2QDB A;  3TP7 A;  4PMW A;  3M9B A;  2RQX A;  4GKJ Q;  1LTB D;  3HOX B;  3N6R A;  1PA6 A;  3FKI H;  5DAU A;  4A75 A;  1PH8 A;  3GTM B;  5FLM H;  2QF7 A;  1K0R A;  4DV3 L;  3MC0 B;  3C3L A;  2JE6 I;  3Q6S A;  3UI2 A;  3E9I A;  4OHJ A;  3ERO A;  3A8K E;  2JA6 B;  4A3E B;  3C2P A;  3GTL H;  1H9J A;  3KFU A;  3G71 A;  4C1N I;  4A3J H;  1YZ6 A;  2JYO A;  1PRT B;  2PQA B;  5CMD A;  1STA A;  5C3E H;  2GVB A;  1WFQ A;  3E0E A;  2M2L A;  5COR A;  1CZW A;  2DUD A;  1LTL A;  3F8T A;  1IKM A;  3NBH A;  4ZUJ A;  3E9H A;  4WJ4 A;  1IHZ A;  2ZXP A;  1A3T A;  2NVX B;  3KF6 B;  2EYP A;  4BY7 G;  3S2H B;  2CFM A;  1U0L A;  3J80 L;  4JI7 L;  3HOX H;  4IJL A;  1CKN B;  2BA1 A;  4NPS A;  4B3R Q;  3AEV A;  4BBR G;  3GTM H;  1JJC B;  3GTP B;  1IBK L;  2JA8 G;  3PF5 A;  1L1O B;  4DXF A;  4B3M Q;  1H9R A;  4OXP A;  4EQN A;  1KAW A;  2JA6 H;  2K01 A;  4A3E H;  3KLS X;  3HG9 A;  2R7D A;  2ZJP A;  1BCP C;  3D8G A;  1BF4 A;  2R7F A;  1F2M A;  1Q8I A;  2UXB Q;  1WCM B;  4RMF A;  4A76 A;  1IYU A;  2EVB A;  4RGM A;  1N34 Q;  2RDF A;  1XX8 A;  1CQV A;  2ZM6 L;  1TKW B;  4V0B A;  3R2I A;  5J22 A;  1XNQ L;  2FXQ A;  3VR2 A;  3EBE A;  1K8G A;  2KJX A;  2NVX H;  3K80 C;  3KF6 A;  2QW7 A;  3S2H H;  1WTQ A;  4QY7 A;  2F0E A;  5CV8 A;  4LF4 Q;  3H6M A;  4HJ7 A;  2F0F A;  1HXY D;  1U4M A;  2JA7 G;  2X69 A;  3KLR A;  1G29 1;  3GTP H;  2VQE Q;  4XXE A;  4DNI A;  4NXM Q;  1MD2 D;  3RN5 A;  2IHE A;  4LF5 Q;  2N3S A;  1GUS A;  1JOR A;  2A8V A;  5ELB A;  1H9S A;  2Z4H A;  5FLX L;  3IFD A;  1WCM H;  1MJC A;  1D2B A;  1N36 Q;  1PVO A;  1SYD A;  1RL2 A;  2XGT A;  1UUP A;  5LL6 S;  1CFM A;  1ENA A;  1HNX Q;  4O1N A;  1CM9 A;  3BS1 A;  1SRO A;  4K6D A;  2Z8L A;  4LF9 Q;  1E1O A;  5BN5 A;  2EYF A;  3CRL C;  2NVQ H;  5NUC A;  3MXN B;  2EYH A;  2F0U A;  4CKE A;  1TU2 B;  4ZQ3 A;  1D8L A;  2FHT A;  2ENB A;  1X3G A;  4DGZ A;  4ALP A;  3T53 B;  5C4X B;  4KY7 A;  1E2Z A;  4GS3 A;  5FO9 B;  4IO9 A;  4JI5 L;  4EX5 A;  3VR6 A;  3KYH C;  2KEN A;  3UE0 A;  4QUF A;  3OW2 A;  1JWU D;  3SEB A;  3NBI A;  1E3P A;  2XRS D;  1TWH B;  1Q12 A;  1VMP A;  3DWA A;  5IGG A;  1CTM A;  2BE5 C;  3SK6 A;  3S1Q B;  4JV5 L;  5T1I A;  3H3V H;  5IY0 A;  4PZ6 A;  2HIX A;  3SGI A;  4LUZ A;  1R9T B;  2K04 A;  4S3S A;  2AKW B;  1HJP A;  3FRP B;  3LX0 A;  1I94 Q;  1EIH A;  1YNX A;  4PMC A;  2DNE A;  4HN7 A;  1X9N A;  2A68 C;  1KAB A;  4H13 C;  4LAA A;  1EIG A;  2MJ8 A;  3V96 A;  2LSS A;  2HUG A;  3I4M G;  4DV6 Q;  5C4X H;  2QGQ A;  4JBK A;  4G57 A;  1G91 A;  3EFX D;  2OTL A;  2CQO A;  1EWC A;  4UP8 A;  3HS0 C;  3A56 A;  5CV7 A;  4NXN Q;  2A6H D;  2N88 A;  1D1I A;  3CC2 A;  2K4K A;  2KA7 A;  5CV5 A;  3NHH A;  2RCF A;  1PH1 A;  1BBU A;  2Z6K C;  3GP7 A;  4JBW A;  4TVA B;  5CC4 A;  2QDL A;  3VR4 A;  1HQR D;  2D0P A;  4X62 Q;  4GKJ L;  5C3X A;  3CC4 A;  1IXR A;  1TWH H;  4QUC A;  2YU9 B;  2N8N A;  5D65 A;  3S1Q H;  2Z0S A;  4FDB A;  1P8L A;  2E75 C;  3GD7 A;  4DUY Q;  3B6Y A;  2LY7 A;  3HOV B;  1R9T H;  1HZB A;  1F2Y A;  1MKH A;  2Z1C A; 
#chains in the Genus database with same CATH homology
 2E76 C;  1LT3 D;  3TDQ A;  2JEB I;  4XDX A;  1SYF A;  4KD4 A;  1HRJ A;  1BR9 A;  2EE1 A;  1PTO F;  3MTS A;  5C4Z A;  1Z47 A;  1TS5 A;  1G2T A;  1GJX A;  1AN8 A;  2DNC A;  3HOZ B;  2HDM A;  4LK1 C;  1B4O A;  1GHJ A;  1OXU A;  4B08 A;  3TP8 A;  3PIO 3;  1B44 D;  4N9P A;  1T5E A;  1HQM C;  1TS4 A;  5FOB B;  2K05 A;  3NUC A;  5C6A A;  1ML0 D;  2K5W A;  1SAP A;  1KDA A;  3MAQ A;  3R93 A;  2R92 B;  1Q3L A;  1SDF A;  3OWE B;  1DD2 A;  5IT9 E;  3OSO A;  1G6Z A;  2A6E C;  2LS0 1;  4DAP A;  4NP5 A;  1YNN D;  2K1B A;  1OXX K;  3FMC A;  3BDC A;  5EKL A;  2O5J C;  4K5X A;  5DEH A;  5G3L F;  1RD9 D;  1SE2 A;  1GOZ A;  2E2J B;  4MN3 A;  4KMU C;  2AQ3 B;  2F0K A;  2KHS A;  1PRT C;  3KBX A;  2H1E A;  1SYC A;  2R7Z B;  5CV9 A;  5J39 A;  1S5B D;  2IW3 A;  2J7Z A;  3PIP 3;  4KKS A;  4L8J A;  4ZUI A;  1Q90 A;  2FMM A;  4IUN A;  4RHS A;  3D6C A;  5JVH 3;  2L1B A;  2PO4 A;  1Z7T A;  1JR0 D;  1ET6 A;  4KY6 A;  2L11 A;  3TZD A;  4ABN A;  5K36 G;  4TKO B;  4KJN A;  1DXM A;  3H09 A;  3CQZ B;  3AU7 A;  1RHP A;  3WOF A;  4FF1 A;  3I8Z A;  1E2W A;  4KV6 A;  5C4J B;  2SNM A;  1M8A A;  4TQU S;  4C3H G;  1AZQ A;  3KUP A;  2PNR C;  1ZYR C;  3K5N A;  3K58 A;  4IFD H;  2JA5 B;  2XRQ D;  2QCP X;  4K2L A;  2E2I B;  1B1Z A;  5I4D A;  3OHX C;  4X3U A;  3OIP A;  5IOC A;  1Y8O B;  1ENF A;  3TBI B;  3FDT A;  3BG3 A;  3S16 B;  1NSN S;  1KDB A;  4Z9C B;  1DON A;  2PQE A;  4RCN A;  4QB4 A;  1EZ6 A;  1ICW A;  4K2K A;  4CKC A;  1OXV A;  3NQT A;  1S5F D;  1V1O A;  1XWE A;  2TMP A;  3H3V C;  2F3V A;  1I6V C;  2G9D A;  3EQL C;  3V05 A;  1G8Z D;  4A3K B;  1HFN A;  5JEA G;  3MXP A;  5C0X J;  5DM6 3;  1Z6H A;  2Z4I A;  3W3A A;  5CV6 A;  4ILW A;  3FVQ A;  2K33 A;  3OIQ A;  4RKL A;  2F0G A;  4HSP A;  3TP6 A;  1EZ8 A;  1LTI D;  2AQ1 B;  4BY7 B;  3QJY A;  4BA1 I;  5F2D A;  5J1Z A;  3OMC A;  1FYC A;  2IX3 A;  3PUX A;  2SEB D;  4HCE A;  5CBE E;  1R4P B;  2NVY B;  2JA8 B;  1STN A;  3CU7 A;  2Q8T A;  1A2U A;  2FJ2 A;  1D5M C;  4BWG B;  2MGS A;  1M4V A;  4C3J G;  5IOD A;  4C3I G;  1W6K A;  2IWH A;  3GTO B;  2A73 B;  3L7Z C;  2EYJ A;  1JWS D;  3A8J E;  4OO1 I;  1VMC A;  1UAP A;  1S5E D;  2KQ3 A;  2IPK D;  1QJO A;  1IW7 C;  1JCK B;  2ICE C;  3K5M A;  1BCP D;  2WB1 B;  1TT2 A;  2OEO A;  2JA7 B;  4RCO A;  3NSW A;  1RTO A;  4XYQ A;  2B2U A;  1U4P A;  4HMI A;  2EYL A;  2SOB A;  5I6W A;  2F0P A;  2SDF A;  4EQO A;  3ITP A;  4RHR A;  4HR7 B;  2R93 B;  4KKT A;  4KKU A;  3NTH A;  1K8M A;  4DU9 A;  4DK0 A;  1EU4 A;  2B2W A;  2LKV A;  3NTK A;  3DHQ A;  4H44 C;  4RWS C;  4CJ2 C;  2AWO A;  5COY A;  3M4Y A;  1SNC A;  3RMH A;  4IUQ A;  1I4R A;  1EY7 A;  2ZT9 C;  2EZV A;  4NDX A;  1MI2 A;  1HUN A;  2F0D A;  2F3W A;  2K6A A;  1SEB D;  1WD1 A;  4FXK C;  4L63 B;  3VR3 A;  5K5P A;  2NWG A;  2B2T A;  5E3F A;  2MP1 A;  1STG A;  3MWY W;  3S2D B;  1PDQ A;  3WOE A;  2RBM A;  1D6E C;  4DAY A;  2VUM B;  1ILP A;  1J9O A;  5ISR A;  1V43 A;  3OW7 A;  4M8A A;  5A2Q E;  1WTO A;  1RJT A;  1RKN A;  2XSC A;  3HRZ C;  1PZI D;  4H0L C;  4ZAI A;  1D5Z C;  2M9V A;  4ZYS A;  1MSG A;  2RDG A;  1UEA B;  4IZ8 A;  2KCN A;  3I4M B;  1F9R A;  5KEE A;  5BN4 A;  1L0Y B;  1FR3 A;  5IT9 L;  3EVQ A;  1WTP A;  2EOT A;  2F03 A;  3T13 A;  3VYS A;  2C5C A;  2BE5 D;  2EY6 A;  4HTH A;  4DXG A;  4F8M A;  4RGO S;  3RD4 A;  3DUZ A;  3I4L A;  3A55 A;  2JXM B;  2A68 D;  1KLG D;  1D1K A;  2D62 A;  1JC7 A;  1SMY C;  5I2X A;  2CVR A;  1H9S B;  3RUZ A;  1NUC A;  4G4K A;  3GV3 A;  1FNV A;  4C1N K;  3BYT B;  3ONA B;  1X3Q A;  4XT3 B;  4RGN A;  5IGD A;  3K0Y A;  3P1H A;  4EVO A;  1VF5 C;  2M00 A;  1HPC A;  2RA4 A;  2O4X A;  1WVL A;  1BOS A;  5EPL A;  2NVQ B;  5KRU A;  3TSS A;  2NVT B;  3QOJ A;  4A93 B;  1ILQ A;  1GUG A;  1GUO A;  3A7L A;  1YNJ C;  2BCO A;  1X32 A;  1PTO B;  1JQY D;  4F7X A;  3MA2 B;  3NK9 A;  1SYG A;  4A3B B;  3SE0 A;  4IUT A;  4A3M B;  2F0N A;  3ND8 A;  2KOL A;  4BY1 B;  3T56 B;  2D5D A;  4KI0 A;  2NB0 A;  3Q22 A;  3M4O B;  4FXD A;  2E2D C;  2R61 A;  2OF1 A;  2SNS A;  4XQQ A;  1WTW A;  2MUY A;  1I6H B;  1EY5 A;  1EU3 A;  5M3F B;  1WTV A;  4QF4 A;  1E0B A;  2R6G A;  1TWA B;  3J81 E;  1EWH A;  1O7Y A;  4FYD A;  2PZT A;  1KTK A;  3D6W A;  4KN4 C;  1O7Z A;  1QNU A;  4A3D B;  2PW5 A;  1PTO H;  3GO5 A;  4NMZ A;  1PMR A;  1NAP A;  2JP1 A;  1EY0 A;  2A6E D;  1CI3 M;  1F9Q A;  3IL8 A;  2A74 C;  1J8I A;  2MPM A;  3ZYY X;  5JAV A;  1I4X A;  5ELE A;  2QIL A;  2B2Y A;  4DA2 A;  5IGC A;  1KNE A;  1BXT A;  4ZK9 B;  4HAE A;  4ID6 A;  3D31 A;  1PRT D;  1QIL A;  1TY0 A;  1EY6 A;  1ZXT A;  1PYW D;  2GA4 B;  4IAL A;  4A3G B;  3T4A C;  3L9A X;  1RF2 D;  1MGS A;  3K7A B;  3MHB A;  1B50 A;  2EDG A;  5M9O A;  1VF7 A;  4IUP A;  4IN3 A;  3HKZ B;  1JWM D;  2F0I A;  1CK1 A;  1A2T A;  2RKS A;  3NP8 A;  5KNB A;  1OXT A;  4C3H B;  3S15 B;  3IKJ A;  3URY A;  1LTS D;  1TR5 A;  4PV1 C;  1GHK A;  2PZU A;  3NTI A;  2DN8 A;  3SK5 A;  3I90 A;  1BNZ A;  2L4N A;  2NBF A;  1ZKO A;  3MEH A;  1SSO A;  2D9U A;  3HOY B;  3T16 A;  1BDO A;  2IX1 A;  3MXG A;  2HCI A;  4U68 A;  1HCZ A;  1I4H A;  2KEE A;  3S17 B;  4XYO A;  3J7Y W;  1ZYR D;  2F0V A;  4MIU A;  1DOM A;  2B8F A;  4FXG C;  1C8C A;  1HA6 A;  2F0M A;  5C0X I;  2EJM A;  1CA5 A;  2WP8 J;  1SXT A;  3K59 A;  2BOS A;  1KDC A;  5D14 A;  3U9S A;  4CKB A;  1STH A;  5M3M B;  3M7N A;  1RCV D;  1CT1 D;  2EY1 A;  4IUV A;  5I9P A;  1SBB B;  5CBA E;  2ZXR A;  1JOO A;  1SNP A;  3EJI A;  3N52 A;  3H91 A;  1QG7 A;  1I4Q A;  2PYK A;  4DN4 M;  1V1P A;  4OO1 G;  3I3C A;  2EYM A;  4ZRZ A;  1ESR A;  4R8N A;  3NWT A;  4IFD J;  4HSV A;  2J4X A;  2NN6 I;  5FKA C;  5JEA H;  3VA7 A;  3I73 A;  3OPO A;  1S5C D;  3E6Z X;  4WRD A;  4C3J B;  2A69 C;  4C3I B;  2L55 A;  4BA2 I;  4K5W A;  1FGB D;  4RGT A;  1HUM A;  3P7J A;  4OGQ C;  1SYB A;  1EQV A;  1D5X C;  5JVG 3;  5LHY 1;  5A2Q L;  4WFN 3;  3FEW X;  3EA6 A;  4J1M A;  2BDN A;  1K83 B;  4DK1 A;  3OWF A;  1Q1E A;  5IGB A;  5E1F A;  2HDL A;  3I72 A;  1LT6 D;  3PUZ A;  1F2Z A;  2J0T D;  3BVG A;  2XWB B;  3I4N B;  1LT4 D;  1CA6 A;  1CHP D;  2CQA A;  1MBY A;  5I6Y A;  5CV4 A;  2WKD A;  4A3I B;  1TQO A;  4ZKB B;  2EJG C;  1PLF A;  3BZD B;  1AW7 A;  4RA8 A;  3RZO B;  1BUV T;  4KD3 A;  1IW7 D;  3CKI B;  1NR2 A;  3FPP A;  2EY5 A;  2JSO A;  2Y0S B;  3DEO A;  1CQF A;  3HOW B;  2LFN A;  3S1R B;  3BVZ A;  3NPP A;  1PTO C;  3C1F A;  1Q1B A;  4U67 3;  1DM0 B;  5EKI A;  3SK8 A;  1TS2 A;  5M5Y B;  3PO2 B;  3J7A V;  3S14 B;  1KNA A;  1KAA A;  3A54 A;  4R8I A;  1K8O A;  2L5T A;  1PZJ D;  2B2Y C;  5JOB A;  5EKK A;  1OO9 B;  1UNS A;  3J7A F;  1SFO B;  4HCS A;  2LMC B;  3X3N A;  4A3F B;  1X3P A;  1STY A;  3OMG A;  2B8G A;  1PFM A;  4Q5V A;  1PZK D;  2PW7 A;  2K7V A;  2AQ2 B;  1LV9 A;  3KLS A;  1VCI A;  3MVV A;  2IJ0 A;  4X3T A;  3TME A;  2EXZ A;  3J81 L;  4BBR B;  3D4W A;  1SE3 A;  1STE A;  4KHV A;  1U9R A;  4FO2 A;  1TVX A;  1BCP F;  3SDZ A;  2IL8 A;  1EEI D;  1RDP D;  3R2T A;  2HCC A;  1AZP A;  2F0J A;  1R4Q B;  3Q23 A;  5AFW A;  2WKC A;  1DOL A;  2ICI A;  3NXW A;  3O13 A;  1SMY D;  3VYU A;  3X3M A;  2F0T A;  2F0O A;  4PQX A;  3M7G A;  2FMC A;  1SJH D;  3RZD B;  3GTJ B;  4FP5 D;  2VNU D;  3DM1 A;  5KYL A;  1ZEQ X;  5D3D A;  3VR5 A;  4K14 A;  3HEJ A;  1F2L A;  1PFN A;  3JAM E;  4QIW B;  3TZU A;  4FVM A;  1SND A;  1YNJ D;  2IX0 A;  4CBV A;  5DM7 3;  1Y8P B;  1F77 A;  1TY2 A;  3Q0A A;  3HP3 A;  2PCF B;  2RSN A;  3CHB D;  4XTC S;  2DY8 A;  2EPB A;  1SNO A;  2CW0 C;  3QG1 A;  2B2V A;  1B2T A;  4HMJ A;  3GV6 A;  5C5M A;  4C2M B;  4IUU A;  1BQQ T;  5ELC A;  3PUY A;  4G7O C;  3CRK C;  1CZG A;  1O80 A;  1ONL A;  4N9T A;  4RKB A;  1EY4 A;  5CR3 A;  1TWF B;  2I07 B;  1I3Q B;  3FPU B;  5CYU A;  5KND A;  1EYD A;  2CHB D;  2AWN A;  2V4D A;  2AUK A;  1DOK A;  1QCB D;  3IAY A;  2XNA C;  1O78 A;  2NUC A;  4UDU C;  3QWN A;  4X3K A;  5M5W B;  1S5D D;  5LL6 X;  3QB3 A;  4KHZ A;  4TSS A;  1TII D;  1GXD C;  5C5L A;  2F0Q A;  1JOK A;  2QEJ C;  2K28 A;  4Y7N B;  3E5S A;  3Q24 A;  5JPM C;  1GUN A;  2C9O A;  5C0X G;  5KNC A;  2E2H B;  4ULL A;  1XXG A;  3BDL A;  5EPK A;  3T51 B;  1ET9 A;  5KIX A;  1LAB A;  5I2Y A;  1DZ1 A;  1WTR A;  3PV0 A;  3AB9 A;  4K6L A;  1FD7 D;  1Y1V B;  3BYY B;  3M85 A;  5C44 B;  1IKL A;  2N55 A;  2NZ1 D;  3HZX A;  3QIA A;  2F0H A;  1EEF D;  4ODG A;  2L0C A;  3W2D A;  2KUM A;  1A3U A;  4EQP A;  4DNR B;  4ZLT F;  3MXU A;  2NN6 G;  3D3R A;  2X6G A;  4FF2 A;  1QOH A;  3LNN A;  1ENC A;  3H94 A;  2G9H D;  1SYE A;  1LTT D;  4IFD I;  1AEX A;  1W6J A;  2VXW A;  1I50 B;  4XQN A;  4I7Z C;  2WAQ B;  1RTN A;  2D2C C;  1NCV A;  4KJO A;  4F87 A;  4F88 A;  3DEP A;  4RFB A;  5HUR A;  2WIN B;  5IGE A;  4G7H C;  1PRT F;  1XTC D;  3S1N B;  4PMB A;  2FIN B;  1PXU A;  3R3O A;  4LMQ D;  2AUJ D;  4XIG S;  4MHE A;  3H0G B;  5FK9 C;  3C46 A;  5FO8 B;  4OO1 H;  1ESF A;  2B2U C;  3BDO A;  4DAV A;  2KED A;  5IGF A;  4GZY C;  2K32 A;  1HA5 A;  3QOL A;  2A69 D;  1JIC A;  1STB A;  4HED A;  4C56 C;  2O5I C;  1HTP A;  3MXN A;  1B9M A;  3NE5 B;  2WV6 D;  4OIK A;  1EYC A;  3QO2 A;  2B2W C;  3DWQ A;  1QE6 A;  3P75 A;  3IFT A;  5JJZ A;  1EFI D;  4NW2 A;  2F1M A;  2KVM A;  3WDN A;  4ME5 A;  1BBX C;  3A7A B;  3NQI A;  4O42 A;  4YIJ A;  3K57 A;  1A6X A;  1F9S A;  1KLU D;  2B2V C;  2B2T C;  3GQB A;  5K36 H;  1LLR D;  1B3A A;  4TRD A;  3M3Y B;  4P2C B;  5KYI A;  2F0W A;  1DJR D;  2L9H A;  5C3W A;  2OXP A;  4IUR A;  5JEA J;  1HFG A;  1V1P B;  5EPJ A;  1AFP A;  1LAC A;  3E0J A;  2Q8R E;  4DFA A;  1A15 A;  1U4R A;  1LTG D;  4KTA A;  5CGK A;  2QKI C;  4B9X A;  4K8I A;  4WOR A;  1PTO D;  2ZXO A;  4NKL A;  2O2L D;  1B9N A;  1HTL D;  2RDH A;  1T5X D;  2K03 A;  1V8Q A;  1SE4 A;  5C4H A;  3JAM L;  4BBS B;  2RVL A;  4KK7 A;  3K5O A;  4CHT B;  1I4P A;  4I65 A;  3KBG A;  1NR4 A;  3G6J B;  3PMF A;  3S1M B;  4J8Q A;  3R8B A;  1E2V A;  3DXJ C;  3J80 E;  4FNF A;  2PPB C;  3A8I E;  3K6O A;  2K5D A;  5A35 A;  4XQJ A;  3NWS A;  2RSO A;  4B9W A;  1C4Q A;  1B53 A;  3KK7 A;  2ID0 A;  2JEA I;  1GUT A;  4OIJ A;  3VYR A;  1LO5 D;  1QNK A;  1LTA D;  4K8J A;  1SNM A;  2E74 C;  1BO0 A;  2R3Z A;  2A6H C;  3GTG B;  3TP5 A;  3D4D A;  5TSS A;  5HGT A;  1EQT A;  5G3L D;  2BA0 A;  3SR1 A;  4WJW A;  2B39 A;  3MZ5 A;  5ELD A;  1MSH A;  4XT1 B;  2EJF C;  2Q8I B;  1A3V A;  4AYB B;  1BCP B;  3SXH A;  4J6H A;  1O7L A;  4QMG A;  2WII B;  5KGU A;  1C48 A;  3BVM A;  3S9W A;  5IIF A;  4FF3 A;  1H9K A;  1LTR D;  5FLX E;  2I46 A;  4CGY B;  2PMZ B;  1II3 A;  3MFY A;  2XVS A;  4KY5 A;  1Y1W B;  1FNW A;  4JK1 C;  2DY7 A;  2VB3 X;  4RH6 A;  5JPN C;  3ND9 A;  1PFB A;  4IQZ A;  4K5V A;  4CJ0 B;  2IT1 A;  3SK4 A;  3I91 A;  2PZW A;  3PUW A;  2XN9 C;  2F4I A;  2XIW A;  3KF8 A;  4RAU C;  5D3I B;  2F0L A;  5DNF A;  2B63 B;  5E4X A;  1TS3 A;  4X3S A;  4H7B A;  4Q0F A;  1LT5 D;  4L6T B;  1GUW A;  1IL8 A;  5EBD A;  1EL0 A;  3V2T A;  1FNU A;  3LWE A;  4DNT B;  2MHV A;  5E4W C;  3G7L A;  1WD0 A;  3PO3 B;  3L3O C;  1I4G A;  2CW0 D;  2HQE A;  4EGV A;  1QWY A;  2NYZ D;  1YNN C;  4DF7 A;  1SJE D;  5EBC A;  2XWJ B;  4BS9 A;  4E6I A;  2K5Q A;  4LJZ C;  3GTK B;  1XYI A;  1JOQ A;  1DYQ A;  2EY2 A;  5M5X B;  3P20 A;  1ROD A;  3DWP A;  1F9P A;  5EGT A;  1Y69 U;  1OXS C;  3TN2 A;  4PNY A;  5EQ0 A;  4FF4 A;  1U4L A;  5FO7 B;  1SNQ A;  1VDZ A;  2F0S A;  5EJW A;  3GTQ B;  1TWG B;  1WTX A;  2VB2 X;  2KEC A;  1H9M A;  4CJ1 B;  1S4Z A;  3SVM A;  5I9O A;  3HOU B;  1G2S A;  3C1E A;  1TWC B;  1CHQ D;  2NTS A;  3SHL A;  4R9W A;  4M1U B;  3AMU A;  1EOT A;  2A5H A;  4IFD G;  4KN7 C;  1AP0 A;  2KCC A;  3ERQ A;  1DCZ A;  3F2U A;  4OL7 A;  3MFG A;  3RLF A;  5C0X H;  1IYV A;  5BN3 A;  2TSS A;  3U9O A;  1L0X B;  2EYO A;  4UAI A;  2FFK B;  1EY9 A;  2NTT A;  1HHV A;  1EYA A;  4V19 0;  2OT2 A;  3VA5 A;  2H4O A;  2X6L A;  3OOC A;  1QB5 D;  1Y8N B;  2YYZ A;  3FKI B;  2WAC A;  4ZKC B;  1JE4 A;  2L12 A;  3I70 A;  3DMU A;  4G7Z C;  5T1G A;  3GTL B;  3VYT A;  2NN6 H;  3K5L A;  4A3J B;  5C3E B;  3HGB A;  1JB3 A;  3LWU A;  3PUV A;  5ELF A;  2BDO A;  1EY8 A;  3D4R A;  4QCL A;  2QDB A;  3TP7 A;  4PMW A;  2RQX A;  1LTB D;  3HOX B;  3N6R A;  5DAU A;  3GTM B;  2QF7 A;  3MC0 B;  3C3L A;  2JE6 I;  3Q6S A;  3UI2 A;  4OHJ A;  3ERO A;  3A8K E;  2JA6 B;  4A3E B;  3C2P A;  1H9J A;  4C1N I;  2JYO A;  1PRT B;  5CMD A;  1STA A;  2M2L A;  5COR A;  1CZW A;  1IKM A;  3NBH A;  4ZUJ A;  1IHZ A;  2ZXP A;  1A3T A;  2NVX B;  2EYP A;  3S2H B;  3J80 L;  2BA1 A;  3GTP B;  4DXF A;  1H9R A;  4EQN A;  2K01 A;  3KLS X;  3HG9 A;  1BCP C;  3D8G A;  1BF4 A;  1F2M A;  1Q8I A;  1WCM B;  1IYU A;  2EVB A;  4RGM A;  2RDF A;  1XX8 A;  1CQV A;  1TKW B;  4V0B A;  3R2I A;  5J22 A;  3VR2 A;  2KJX A;  1WTQ A;  2F0E A;  5CV8 A;  3H6M A;  2F0F A;  1HXY D;  1U4M A;  2X69 A;  3KLR A;  1G29 1;  4XXE A;  1MD2 D;  1GUS A;  1JOR A;  5ELB A;  1H9S A;  2Z4H A;  5FLX L;  3IFD A;  1D2B A;  1SYD A;  1UUP A;  5LL6 S;  1CFM A;  1ENA A;  4O1N A;  1CM9 A;  3BS1 A;  4K6D A;  2Z8L A;  5BN5 A;  2EYF A;  3CRL C;  5NUC A;  2EYH A;  2F0U A;  4CKE A;  1TU2 B;  4ZQ3 A;  2FHT A;  2ENB A;  4DGZ A;  3T53 B;  5C4X B;  4KY7 A;  1E2Z A;  5FO9 B;  3VR6 A;  4QUF A;  1JWU D;  3SEB A;  3NBI A;  2XRS D;  1TWH B;  1Q12 A;  1VMP A;  5IGG A;  3DWA A;  1CTM A;  2BE5 C;  3SK6 A;  3S1Q B;  5T1I A;  1R9T B;  2K04 A;  4S3S A;  3FRP B;  3LX0 A;  1EIH A;  4PMC A;  2DNE A;  4HN7 A;  2A68 C;  1KAB A;  4H13 C;  4LAA A;  1EIG A;  2MJ8 A;  3V96 A;  2HUG A;  4G57 A;  1G91 A;  3EFX D;  1EWC A;  3HS0 C;  3A56 A;  5CV7 A;  2A6H D;  2N88 A;  1D1I A;  2KA7 A;  5CV5 A;  3NHH A;  3GP7 A;  4JBW A;  5CC4 A;  3VR4 A;  1HQR D;  5C3X A;  4QUC A;  2YU9 B;  5D65 A;  2E75 C;  3GD7 A;  2LY7 A;  3HOV B;  1F2Y A;  2Z1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...