1SSOA

Solution structure and dna-binding properties of a thermostable protein from the archaeon sulfolobus solfataricus
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
62
structure length
62
Chain Sequence
ATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SSO7D
publication title Solution structure and DNA-binding properties of a thermostable protein from the archaeon Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein
total genus 4
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1995-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ssoA00
1U4RA 2KUMA 4DN4M 1B4OA 2X6LA 4IUPA 1ICWA 5EPJA 1WTPA 4RAUC 3TN2A 2B2TC 1ILPA 3Q6SA 2L11A 1NAPA 5CBEE 1SSOA 1WD0A 3I3CA 2RVLA 4HSVA 1ILQA 2RSNA 1JE4A 1G91A 1WTXA 1X3PA 2B2VA 2RA4A 1VMCA 2EOTA 4LMQD 5COYA 1AZPA 4NW2A 2N55A 1B50A 1E0BA 3I8ZA 1A15A 1M8AA 1KNEA 2K05A 2K28A 3DM1A 3I91A 3QO2A 4ZK9B 1JICA 4O42A 2MPMA 1VMPA 1DOLA 4X3UA 5AFWA 2D9UA 2EE1A 3DEPA 4QUFA 1RJTA 4X3TA 1ZXTA 1EQTA 2XIWA 2L9HA 2L12A 4OIKA 1PDQA 5EQ0A 3UI2A 3HP3A 1F2LA 1O7YA 4XT3B 4ZAIA 1B53A 1RODA 1PLFA 4XDXA 3MTSA 5D14A 1MGSA 2BDNA 2HDLA 1RTNA 4U68A 2KEDA 5D65A 4ZKCB 3DEOA 4ZLTF 4CJ2C 2EPBA 1TVXA 4OIJA 3F2UA 2MJ8A 1DOMA 4MN3A 2FINB 1DONA 1F9QA 3H91A 1MSHA 1G2SA 1J9OA 2VXWA 1CA5A 1HUNA 1LV9A 1WVLA 2R3ZA 1X32A 1IL8A 2KOLA 1WTWA 2HCIA 3ONAB 4ZKBB 2Q8TA 1G6ZA 1RTOA 4X3SA 3N52A 2B2TA 4R8IA 1WTVA 1BBXC 1PFMA 1QE6A 1HRJA 1S4ZA 2MP1A 1F9SA 2B2WC 4RWSC 1IKLA 3D6WA 1DOKA 3G7LA 2CVRA 1EL0A 1MSGA 1B2TA 1F9RA 4IUVA 1F9PA 4QUCA 1CM9A 5CMDA 1HFNA 5EJWA 1EIGA 5CORA 5EPLA 5T1IA 1HA6A 1U4MA 2B2WA 1RHPA 2J7ZA 1BNZA 5CBAE 1GUWA 5E4XA 1PFNA 2HUGA 5E4WC 1WD1A 3LWEA 1WTOA 1MI2A 4CJ1B 1O80A 1QNKA 1X3QA 3SVMA 2L1BA 1WTQA 5JJZA 1J8IA 3KBXA 1Q3LA 3TZDA 5EKIA 2NYZD 2HCCA 3P7JA 2FHTA 1DZ1A 2K04A 1C8CA 2NWGA 2FFKB 3R93A 2B2YC 2B2UC 3GV6A 1XYIA 1U4LA 4HAEA 2Q8RE 2KEEA 1NCVA 2KECA 2JP1A 2KVMA 1O7ZA 2K01A 1IKMA 1NR2A 1B3AA 1BO0A 3FPUB 4HEDA 4MHEA 3IL8A 2B2UA 2B2YA 4HCSA 4IUQA 2RSOA 4X3KA 4IURA 4IUUA 3I90A 1NR4A 1ESRA 1U4PA 2FJ2A 5EPKA 2HDMA 1PFBA 1CA6A 4CJ0B 1HUMA 1EIHA 1G2TA 2IL8A 4RA8A 1BF4A 2L4NA 2NZ1D 1QG7A 1EOTA 3KUPA 2FMMA 4XT1B 2X69A 2K03A 3IFDA 1WTRA 3MWYW 2N88A 2DY7A 1ML0D 2SDFA 3FDTA 1AZQA 1KNAA 1HFGA 1XX8A 2H1EA 2K1BA 4IUTA 2JYOA 2MGSA 5DNFA 4R9WA 2X6GA 4UAIA 1AP0A 1SDFA 1HHVA 2B2VC 3GV3A 5T1GA 1SAPA 2M2LA 2DY8A
chains in the Genus database with same CATH superfamily
3HZXA 3TBIB 4B3RL 4CKEA 2Z9HA 4RKLA 2JA7H 3SDZA 2VUMG 5EBDA 3MEHA 5KNCA 1OXSC 1SRUA 5G3LF 2EDGA 2EYOA 3HOZG 2SNSA 4JYAL 4GNXC 1LT3D 5DAUA 2HIXA 1A2UA 1JICA 3K5LA 4IOAA 5JJLA 4QF4A 2WP8J 1V1OA 4OX9Q 3F1ZA 2G9DA 2K5HA 3NSWA 4DV5Q 5IOCA 3BVZA 1D1IA 2KCCA 3KLRA 3HP3A 2OT2A 5IWAQ 1SLJA 1FD7D 1LTTD 2HDLA 4DK6C 4LUOA 2VY3A 2RKSA 2F0LA 5C3EH 1BCPF 4X64Q 1X3EA 3JAMi 3P1HA 5FLXE 1LV9A 3NQIA 4LK1C 1X32A 4LFAL 1CQVA 3GTQH 5HGQA 3SK4A 4K5VA 3J7AV 1J6QA 4B3TQ 4X62L 1JB3A 1KAAA 5KNBA 1O7LA 1F9RA 3EQLC 3UDFA 3BJUA 5CV9A 5C0XH 2F0VA 3T13A 1KABA 4TKOB 1HA6A 1MJCA 5M3FB 1Y1VG 2WACA 4L8JA 1A3VA 1OTCA 3UDXA 1A3TA 4R4QA 4FVMA 1Q12A 2A73B 3HKZG 3P75A 2K04A 1C8CA 1LM0A 2NWGA 3F2CA 1XMQL 1QVCA 1LTSD 4A75A 2NVTH 2ZXPA 2IX0A 1E2VA 3CMEA 4A3DH 1BCPC 2JP1A 5FO9B 4JI1L 1JOQA 4MHEA 1VQPA 4BBSH 4LFBL 3JAME 3KFUA 1MKHA 5C3WA 2VQEQ 1IZ6A 4IN3A 2DN8A 1KRTA 2PMZB 4F87A 3PUWA 4RA8A 1BF4A 2ZJPA 5DM73 4G7HC 2FMMA 2NN6I 4IFDJ 4UP7A 1QILA 5NUCA 4ZYSA 1HFGA 3RZOH 1FNUA 2K5DA 4R9WA 5I6YA 3K59A 3KLWA 4J8QA 2UXBQ 2QF7A 4C3IH 2ES2A 2B63B 2D2CC 3R2TA 4C3HG 2R6GA 3I4MH 5EAYA 2RSNA 2I5LX 4PZ8A 1C48A 1EOVA 1Q1EA 3A7LA 5COYA 2PQAA 3GTKH 2QDBA 3M7GA 3KF8A 2R61A 3BZKA 3I8ZA 4JI5Q 4YCWA 2F0HA 3I91A 5FO7B 2F0UA 1H9JA 4X3UA 3HOXH 2L12A 4B3RQ 1EYCA 1B7YB 1IYJB 3RD4A 3MTSA 4OONA 1MD2D 4BBRH 2K52A 2RQXA 1ZEQX 4JYAQ 3VYRA 4HJ9A 1TR5A 3I55A 2AHOB 3TMEA 1KAWA 4R8IA 1VF5C 4POFA 1VDZA 1PHJA 2JK8A 1A3UA 3WOFA 3A5UA 3M9BA 1TKWB 3DWAA 5K5PA 2ZTCA 3J81c 1PXUA 3BZDB 1U4MA 2PCFB 2SOBA 2RHSB 1YHBA 1TWAB 4UY8C 4R4IA 2Z4HA 3OW2A 1RF2D 4LFAQ 2M9VA 3S16B 2Z6KA 2R7FA 3T1YL 3GTJH 4X62Q 4JBKA 2I5MX 2JA8H 4A3BH 2B8GA 4BXXH 1WCMH 1JQYD 3E3XA 2EZVA 3NHHA 4K2LA 4Y52H 1NCVA 1O78A 3NBIA 5KIXA 2Y0SE 2VZAA 1BO0A 1B3AA 1RDPD 3MXGA 3IL8A 4H02A 2NZHA 3I90A 2UUAL 4NXML 1RD9D 3IRBA 1CA6A 4CJ0B 1G2TA 4A3KH 5EGTA 2HIVA 1C4QA 1MIUA 2Q2HA 5J1ZA 5M5YH 1XMQQ 4I7ZC 3GO5A 5A2QL 4XYOA 5JVH3 4RHSA 3Q8DA 1I4PA 5CC4A 1SN8A 1JJCB 2KCMA 4JI1Q 1SMXA 4GS3A 3CXCA 1XMOL 4LFBQ 4A3JB 1KLUD 1B4OA 2VS1A 3GTLH 3PIO3 4LNQA 1JT8A 2K4KA 3JC66 2B2VA 1VMCA 1B8AA 3PUYA 2DGYA 4IJHA 2EYLA 4ZRZA 1STAA 1CHQD 4N8X1 1QVFA 3WOEA 3H3VH 1V1PB 3ND8A 2D9UA 4H44C 4LF7L 1Y69U 4BY7H 3AB9A 3Q0AA 2KJXA 5ELNA 1WJJA 1EZ6A 1WOCA 3S17H 1TWCH 1KLGD 3L7ZC 1UE6A 5IYCG 2R93H 1VF7A 1TS5A 2E5LL 2HHHL 2JA5B 3VR6A 2R3ZA 2BA1A 1MJEA 2F0TA 4Y7NB 3CCVA 2EIFA 4DV2L 4K0KQ 3J80c 4XTCS 3J81i 2NVTB 4J6HA 3RN2A 3TP6A 2D0PA 5M3FG 1SXTA 2GA4B 2ZT9C 2E2JB 3TQYA 3IAYA 2RDFA 1PVOA 4FXDA 2LFNA 3H09A 4DV1Q 2OTLA 1MHWC 4OL7A 1J8IA 1VQJA 2VQFL 1WI5A 1EWIA 4DAMA 5BN5A 1GKHA 3MC0B 1JE5A 4AYBB 4JI2L 4HAEA 3H6MA 2O2LD 2SNMA 1A62A 2OCEA 3H0GH 5C44B 2F4VL 1JCKB 1HNWQ 4C2MH 2YU9B 4IUQA 3V05A 3E9HA 5JEAG 1U4PA 1U5KA 2FJ2A 3BDOA 1HTPA 1SYFA 1BQQT 2BH2A 3J81E 1KD1C 3CCRA 1AN8A 3T1YQ 2I46A 3CAMA 5J22A 3GTKB 5E3FA 5D3IB 2KA7A 1PZKD 1SE4A 2OQ0A 1AP0A 2WB1E 4DFAA 2B63G 1HHVA 5CYUA 1XPOA 3PO3H 3ZJYC 4IQZA 4DN4M 1SJHD 4IUPA 3ND9A 5E7NA 5EPJA 4NXMQ 4GN5A 3K58A 1EFID 1WD0A 4K5XA 2A6HD 1VQ4A 1D5ZC 3ULJA 4KHPL 4KKUA 1QB5D 4BBRB 3I7FA 4X6AH 1H9KA 1GUNA 2WINB 1LT6D 3S2DB 1GD7A 4R4TA 4LF9Q 2KCNA 5GADC 1XMOQ 2ASBA 2EJFC 4OIKA 3PIOA 2M00A 3KYHC 1YEZA 1KQSA 4JOIC 3DWQA 5D3DA 3U9OA 3MZ5A 3WWVA 2F0KA 4RCOA 4EQOA 3TSSA 5D65A 4CJ2C 3QG1A 2BCOA 4JI6Q 1DONA 5C4XB 1NY4A 4JV5L 3I4NB 3CPFA 4DA2A 1QZHA 1G6ZA 2KCTA 2R92B 4M8AA 2EY2A 1HH2P 4LF7Q 1F9SA 2N3SA 4QMGA 5GQOA 1I50H 3PIP3 1CM9A 1YJ9A 2Z6BA 1EIGA 1JWMD 2ZXRA 4QIWE 2AMCB 4MNOA 5T1IA 3MFGA 5E4XA 1PFNA 3LWEA 4UDUC 3CMAA 3GDEA 4OGQC 2K5NA 4A3LH 1YNNC 2HCCA 5FKAC 4GNXB 3H94A 5M5YB 3RN5A 1A6XA 4ABNA 4BY1H 3STBD 3CD6A 1ICFB 4NDXA 1CSPA 1BXTA 5IGCA 4C1NI 5AJ3L 1K8OA 2B39A 5M5WB 3QB3A 1E22A 5IP7G 1WYDA 3K5NA 1NJIC 1V1PA 5ELBA 5M3MB 4OHJA 3HKSA 4X3KA 4IURA 1U0LA 3MXPA 1HZ9A 2WFWA 4KLKA 3C3LA 3HOWH 1KIXA 2VQFQ 1BDOA 1HNXL 4EX5A 1Q86C 1YZ6A 4IJLA 5HY6A 3N6RA 4DV6L 1SE2A 5LL6X 3SGIA 2L55A 3BU2A 3D6CA 3S15H 4A3JG 3K5MA 4JI7Q 1B50A 1VQ6A 2XTIA 1IBLL 4B3SL 1SNMA 1R9TH 1IW7D 2RBMA 4OO1G 1IYUA 2UUBQ 5H1SE 4A3EB 4DR4L 1F2YA 3EA6A 3CCQA 1XNRQ 4DR7L 1KNEA 2K28A 4KJNA 1HCZA 1L1OC 3QO2A 3C1EA 1GOZA 3S1RH 4IFDG 1TQOA 2UXCL 4UHVA 1P8LA 3NK9A 3CRLC 2C35B 2R7ZG 1QOHA 2J4XA 1BCPB 3F2BA 5ISRA 3B6YA 4DAPA 1JB7A 3VA5A 2JA9A 1XTDA 5EKKA 4RHRA 2LY7A 2HQLA 4H7BA 3GTOB 2JA5G 1TVXA 4OIJA 1Y8NB 4KMUC 4ULLA 3Q22A 4GOPC 5CV5A 3ER0A 4AH6A 4G4KA 1CA5A 2L5TA 2HCIA 2EVBA 2QDLA 2NTSA 4CGYB 1S40A 3G7LA 1OXXK 5LMUL 4GZYC 3BVMA 3HRZC 1B2TA 3VYTA 4DAYB 4DR3L 1UAPA 3QR8A 2JE6I 3U9SA 3MVVA 4JI0Q 3NELA 4K2KA 4JCVE 4JV5Q 3VYUA 4P75A 4B9XA 4AYBG 2L1BA 3GQBA 1FR3A 4QL5A 4L5SA 3OTOQ 2JXMB 1BVSA 3PIPA 2MHVA 3L9AX 1D1KA 1QNUA 5C44G 1LACA 1YVCA 1VQKA 1ZKOA 1EQRA 1O7ZA 3F8TA 3GTMB 2FXQA 4V190 5JEAJ 3V2TA 4WFN3 3G4SA 2G9HD 1D5XC 1G6PA 2L4NA 1BOSA 1GJXA 5G3LD 3MWYW 1HTLD 5AJ3Q 4IUTA 1G291 2D5DA 2DY8A 3HGBA 1PH1A 3OSOA 1EFWA 4DU9A 3GTPB 3M4OH 3I3CA 3K7AH 4BBRG 1J5EQ 1G91A 1HNXQ 4J1MA 4KD3A 3CCSA 2VB3X 5ELOA 1Q81C 3E6ZX 2LMCB 4DV6Q 1BCPD 1HJPA 5GAEC 1BBUA 2R7DA 2QA4A 2XWJB 5AFWA 1PFSA 3RNUA 1XJVA 1HNZL 3AMUA 4PMWA 2XIWA 4OELB 1XPUA 1S5DD 4OXPA 3HOUB 4HCEA 4GNXA 2E2HB 1O7YA 1IBLQ 3EBEA 1B53A 4BS9A 3A55A 2I07B 3CP0A 4DV0L 3A7AB 5C4XG 2KEDA 3U4ZA 3DEOA 1QUQB 1JWUD 3I4NG 2ALYB 1SYCA 1TWFH 4DR4Q 1A63A 2ATWA 4DR7Q 4DXGA 2R92G 3DHQA 3RLNA 2AUJD 2Z8LA 1RTOA 4KD4A 4X3SA 2B2TA 2UXCQ 1SYBA 4Q0FA 1S4ZA 4HIMA 4QJFA 4LFCL 1DOKA 4GKJQ 2VL6A 4DR5L 2K6AA 4F88A 1EY6A 2NB0A 1EY9A 4NKLA 3FKIB 4KN4C 4DK1A 3W5OA 1HFNA 3S2HB 4JI3L 3DXJC 3BVGA 1IYVA 5BN4A 5IYDH 1LABA 5BR8L 3TEHB 1EY7A 1LTBD 1A2TA 2NN6H 1STYA 1Y1WH 3OWFA 1DZ1A 2GVBA 5C3XA 1SR3A 4FDBA 3R93A 2B2YC 3S1QB 2HT1A 2EY1A 1JJGA 5LMUQ 1DJRD 1PYBA 2KEEA 2JA6B 3H3VC 1OO9B 5M3MG 1VCIA 5IGGA 4DR3Q 1I4GA 2A69C 2F4IA 1UE7A 1IBKL 4NXNL 3BS1A 3CCEA 4A3CG 3D4RA 3U58A 4DR2L 5ELDA 3J7YW 4R4OA 4PZ6A 1SNCA 3MFYA 1WFQA 2NZ1D 2RF4A 1HA5A 3KUPA 1K0RA 1VQFA 1GUSA 4K5WA 1PTOH 3TS2A 2N88A 3DM3A 1GUTA 2A8VA 1L0YB 1KNAA 3EJIA 4DXFA 1R4QB 3HOVB 1EYGA 1ASZA 4N9PA 1AH9A 1EZ8A 2VNUD 2KUMA 2LS01 2YYZA 2X6LA 3K81C 2BE5C 1STEA 1ILPA 1UWVA 4A3EG 1CFMA 3PUZA 4FF3A 1AFPA 1AZPA 2N55A 5TSSA 4B08A 5IYBH 2E2DC 4A3IB 2K05A 2F0JA 4KI0A 2OTJA 2E76C 4IALA 3PO2H 2VB2X 3HFZB 1EYDA 1RL2A 4CBVA 4R1JA 3KJPA 5C0XJ 1N34Q 3T4AC 3CW2C 1RODA 2Q2TA 1PLFA 4LJZC 4XDXA 1ASYA 4JI8Q 1LT5D 1NSNS 5I2XA 4PMCA 5IGFA 4OO1I 1LTRD 4LF5L 3HOYH 3TZUA 2EXDA 5K36H 4OWWB 2G5DA 1VQDA 3HG9A 3RZDB 1N36L 2UXDL 2AWNA 2B2WC 2E8GA 4I7AA 2CW0C 4DNTB 2WV6D 2CVRA 4DV4L 3S1NB 1EL0A 3D4WA 3AYHB 3IKJA 1F9PA 3T1HL 5DM63 4DV0Q 1K83H 4ZUJA 1WTHA 1SFOB 2NVXB 1EWHA 1VQGA 2DNEA 4EGVA 1RHPA 4YWLA 1PH4A 2HUGA 3X3NA 5GAHC 3PUVA 5M5XB 3S1MB 2NUCA 5C4JB 5JPNC 5C6AA 1SJED 3M7NA 4IUNA 2B2UC 1S5CD 5J3BA 2ZXOA 4RFBA 1GUOA 4R8NA 5IP9G 4DR5Q 2KECA 2KVMA 3EROA 4QQBX 2PI2E 3FPUB 4JI3Q 3I73A 4XIGS 4QGUA 2RSOA 4GN4B 3TP7A 1ET6A 2OWOA 5FO8B 3AEVA 5GAGC 1GUGA 2F0WA 3V96A 4A3MB 4A93H 1QUQA 4QB4A 4LF4L 4OWXB 3W2DA 2MFIA 2SDFA 1OXTA 1SDFA 3SR1A 1IBKQ 4NXNQ 3GTGB 3E9IA 3KK7A 4A3GH 2VUMH 3TN2A 4HN7A 3Q6SA 3M4YA 4HSVA 1I94L 3K5OA 2JA7B 2PNRC 4OWTB 4EVOA 1VQEA 3HOZH 1TWFB 1A15A 1M8AA 2NVQH 4O42A 5IODA 3HOUG 4WORA 3VR2A 2Z1CA 2Y0SB 1UNSA 3PV0A 4UP9A 1F2LA 3BDCA 4G7OC 1FYCA 2Z6KC 3SK5A 4DR6L 4ZLTF 1SEBD 1D8LA 3MA2B 3ERQA 2FINB 1TS3A 4IPHA 2B3GA 2K50A 1QVGA 2QGQA 2VXWA 5LMNL 5KNDA 2F0SA 2KOLA 1YJWA 3ONAB 5C3EB 5I6WA 1FNVA 1Z47A 1HRJA 4PV1C 2MP1A 3FKIG 1PYSB 2WAQE 3GTQB 1ENCA 1MSGA 4IUVA 4QUCA 4FF1A 4HIOA 1EWCA 3A74A 3CHBD 1CUKA 5EPLA 4ME3A 1DCZA 1TXYA 4LF6L 3PGZA 1Y1VH 1CZGA 2IX1A 4DK3C 1BUVT 2J7ZA 3RUZA 4DGZA 2MQHA 4HIKA 1WD1A 4KKTA 4CJ1B 3ULPA 5JJZA 2P5ZX 4X66L 3BG3A 2EY5A 3CC7A 2UXDQ 1L1OB 2JA6G 2ZM6L 1W3SA 4AIMA 1Z9FA 2Q8RE 3W1GA 4DAVA 1HZBA 4HSPA 2KQ3A 3A8KE 3T1HQ 2K33A 2PQEA 4X65L 1IKMA 4JK1C 2K5QA 4A3DB 3NTKA 4IUUA 3CF5A 4ID6A 2EYFA 4BBSB 4HJ5A 4GOPB 4P73A 2PO4A 2WKDA 1M1KC 3RMHA 4DNRB 3O13A 1WTRA 1CT1D 3OMGA 3HOVG 3IFTA 5BN3A 3EVQA 2F0DA 1IL2A 1Y8OB 3DMUA 4UAIA 2A1AA 4Q5VA 2M2LA 3RZOB 4C3HH 3C1FA 3T56B 1YNND 2AQ2B 2L11A 1SSOA 2F03A 4C3IB 1JE4A 4A3IG 4OEMB 3TREA 3I4MB 2VW9A 1EYAA 2A68C 2PW5A 2Z4IA 3AQQA 5IT9L 2L15A 2EE1A 4NMZA 2L9HA 4A3FH 2E2IH 4F7XA 1UE1A 1STNA 3HOXB 4HIDA 2JEAI 4NB3A 2UUAQ 2F0QA 1E7ZA 5GROA 1I94Q 2OEOA 1II3A 3BYYB 4JOIA 4HJAA 4TRDA 1W2BA 2BA0A 3LNNA 1I4XA 2V4DA 1WTVA 1V43A 1QE6A 3E0EA 5JOBA 1TWHH 2WB1B 1YNXA 3D6WA 1BBWA 3CRKC 2AWOA 4DUZL 5CR3A 4DR6Q 1KDBA 1ZYRC 4DV7L 1VQOA 1DD2A 4B9WA 2ICIA 2XGTA 3NENA 1GHJA 3I4LA 3L2PA 3NQTA 1WTOA 1CSQA 2F1MA 5FJ8G 3S14H 4QCLA 2XN9C 1AW7A 5CV4A 2AQ3B 5JAVA 1N32L 1K3BC 1ENFA 2FFKB 3J80i 4EQ5A 4B3ML 1STGA 4FYDA 3DWPA 4GLXA 3ZYYX 4KY5A 3GTJB 1VQIA 3EFXD 4A3BB 2JA8B 1PMRA 3L0OA 4WRDA 2TMPA 2EY6A 1WCMB 4LUVA 2XNAC 2EYPA 2IHEA 4A3GB 2I5HA 2YV5A 4A3MG 2E5LQ 2HHHQ 4X66Q 1KRSA 4LF8L 4CDCC 3TP5A 3ERSX 1OXVA 2ZM6Q 4A3KB 1C9OA 1H9SB 4DV2Q 2NVQB 1K0SA 4X65Q 5DNFA 2MUYA 3VA7A 1VS0A 3HS0C 1U4RA 2A19A 4QIWB 3CKIB 1HQRD 2JA7G 4RAUC 3L3OC 3DUZA 2NBFA 3J80E 1PTOF 4YHHL 1WTXA 3GTLB 3G71A 2IJ0A 1KHIA 3LX0A 1NUCA 4Z9CB 1K8AC 4FF4A 3C2PA 3KLSX 1QJOA 1HR0L 1D6EC 1JJ2A 3DM1A 2Y0SG 2MPMA 4KJOA 4JI2Q 4L5QA 3HKZE 1F77A 1X6OA 1EY8A 2F4VQ 1EY5A 2RDGA 2O5JC 4BY7B 2D0OA 2EYHA 3SE0A 1YIJA 4ALPA 5IYCH 5C3EG 1Y1VB 1MSHA 3LWUA 1NBWA 4RKBA 3S17B 1TWCB 4O1NA 3D4DA 3J81j 3SXHA 4ZKBB 1WTWA 2R93B 1ESFA 2N49A 4E6IA 5FLMH 4CDFC 1PTOC 2QEXA 1VQCA 3PF5A 5M3FH 4DUYL 1CTMA 1XNQL 5C0XG 1U9RA 5JJIA 3ICEA 3U4VA 4RGTA 1WTQA 1X3QA 1N9WA 3OYYA 1Q1BA 4KHPQ 3NBHB 3PMFA 4HTHA 1L2FA 1KDAA 5M9OA 2IT1A 3NTIA 3J7AF 5IGEA 4OX9L 1EU4A 5E1FA 1PZID 4DV5L 4A3DG 4DUZQ 2MO1A 2FMCA 4DV7Q 2NVYH 4BBSG 4N8FA 5JEAH 2CWPA 4C3JH 1DYQA 3H0GB 3G6EA 2JEBI 3PSIA 5CV7A 3PF4A 4C2MB 2HD3A 5KYLA 4X64L 1N32Q 4V0BA 5C4ZA 2KHIA 2XSCA 4L6TB 2X69A 3VR4A 1SBBB 2F0FA 2WKCA 4KV6A 1BR9A 1STBA 3QWNA 3D8GA 4LUZA 4B3TL 2JYOA 2MGSA 2B63H 4MIUA 1YBYA 1SAPA 1HPCA 2F3WA 4C3IG 4I65A 4A3FB 3OIPA 1B3QA 3VR3A 1WTPA 4PQXA 3PO3B 1NAPA 5CBEE 3I4MG 1P16A 4LF8Q 4DNIA 1HZCA 4A4IA 1SMYC 1E3PA 5L37A 3D31A 1SE3A 1YITA 1Q90A 1HQMC 2A69D 4HMJA 4ODGA 1FGUA 1RJTA 4HMIA 1JOOA 2KBNA 1EQTA 5CGKA 3HOXG 1XWEA 1S5FD 1SNDA 2PQAB 4UPAA 1PH9A 2BDNA 1RTNA 4U68A 1KTKA 4YHHQ 2CKZB 1EQVA 1QCBD 4MN3A 2DJGC 4GKKL 4RGNA 1NNXA 1WVLA 2IHFA 1XTCD 1IL8A 1PH2A 2WB1G 4KY6A 2A6EC 2CQOA 3W3AA 1LTID 1X54A 2BE5D 2B8FA 1MBYA 1STHA 4GLVB 3QOJA 1CHPD 3NXWA 2KENA 3X3MA 4B3SQ 1I50B 1TWAH 5DLQE 3S16H 4BA1I 2YTXA 4EQNA 5ELEA 3CC4A 5C4HA 4AQYL 1SNQA 3KBXA 1O7IA 2RDHA 5EKIA 3FEWX 2CH4A 3P7JA 2XWBB 1DGSA 1TS2A 3T16A 3M3YH 2LXKA 3FRPB 3Q23A 1U4LA 2YTYA 4A3BG 2JA8G 1NTGA 3CC2A 4BXXG 1WCMG 3AFQA 2PYKA 3NPPA 1XNQQ 5IP7H 4BY1B 4A3GG 1YNJC 1NE3A 2F0OA 2B2YA 1FVIA 1W6JA 3HEJA 2JJQA 1NR4A 1PZJD 1VQBA 2CFMA 4S3SA 2HDMA 2LKVA 2NTTA 3OIQA 3K0YA 3I2ZA 4JPBW 4A3KG 3EIVA 4U673 2K5WA 5HURA 3HOWB 2CW0D 1B1ZA 4YCVA 1N8RC 1PRTF 3URYA 4MZ9A 3NEMA 5F2DA 1I6VC 4A3JH 2K1BA 1PYWD 4MTNA 1L0WA 1QWYA 1TWGH 1VQHA 2K5VA 3S15B 4BA2I 1ICWA 4G57A 5I9OA 2B2TC 3FHWA 1NMFA 4RH6A 3OOCA 3GD7A 4OO1H 2H4OA 3AFPA 4K6LA 5JVG3 3PQIA 3VR5A 1R9TB 5A35A 2ZTDA 4ZK9B 2IPKD 4IFDH 1DOLA 1M4VA 4QUFA 3Q24A 2R7ZH 1I4RA 1D2BA 3BYTB 5IGBA 3S1RB 4BY7G 3NBHA 1KL9A 1A0IA 2F0MA 2N78A 5JJKA 1ONLA 1I4HA 1PRTC 1Y8PB 2A5HA 3NWSA 4UP8A 2JA5H 1LYLA 4H0LC 1GXDC 2ZTEA 3P20A 1EU3A 2KHSA 4KKSA 4Y7NH 1VQAA 4RGMA 1F9QA 1A8VA 2R93G 2K7VA 1VQMA 3R8BA 2UUCL 1HUNA 2PMZE 1CQFA 4DAYA 5FLXL 1I3QH 3C46A 2BOSA 1UE5A 5ELCA 1PFMA 1T5XD 1IKLA 5LHY1 4P71A 1H95A 2E2JH 2C5CA 1SYDA 3QOLA 1PV4A 2UU9L 4JBWA 2GN5A 5CORA 1OXUA 2B2WA 2NVYB 1RKNA 4YY3L 1SNPA 1BNZA 4GKKQ 5E4WC 4C3JB 4A76A 1F2ZA 3RLFA 1Q3LA 2IW3A 2NYZD 3A5ZB 2FHTA 2QEJC 1E24A 4PZ7A 3TS0A 3F2DA 3RLOA 2O4XA 3GV6A 5C44H 5KYIA 1HNZQ 2KHJA 2YU9H 4RCNA 4IFDI 3H0GG 4PG3A 2QILA 1B9NA 2B2UA 5IT9c 3JAML 4K14A 1LUZA 2QCPX 1Q82C 2K75A 4NP5A 4YWKA 5C0XI 4AQYQ 5IIFA 4L5TA 1V9PA 3CCMA 2K03A 4CKCA 3FP9A 1T5EA 2DY7A 2EYMA 1Z6HA 4K0KL 4LFCQ 3OPOA 2I0QA 4A3FG 3NUCA 3DLLA 3PO3G 2NZOA 2F52A 5IY0A 5BR8Q 4DV1L 1X3PA 3A8IE 3M4OB 1LTAD 1LT4D 3K7AB 3S2DH 3K57A 5A2QE 5CV6A 4ILWA 4CHTB 2C9OA 2LSSA 1HZAA 1S5ED 4X3TA 4F8MA 4DR1L 5EQ0A 1K9MC 3K0XA 4IPDA 5EKLA 4ZAIA 4YIJA 1HNWL 5C4XH 3W1BA 3UE1A 3I4NH 4DR2Q 2QKIC 3M85A 5C5MA 1TY0A 3U50C 1LLRD 3KJOA 2R92H 2ID0A 5I4DA 1KXLA 4APVA 1YHAA 5HGTA 2F0PA 1K73C 4LAAA 2RCNA 1DM0B 3S24A 3SK8A 4KTAA 1GM5A 2ZJQA 3T53B 2E75C 3R3OA 3M3YB 1E1OA 3K8AA 2F0NA 2EXZA 1GUWA 4PMBA 2MNAA 2A68D 2UUCQ 1L0XB 1O80A 3A0JA 3T51B 1KDCA 4K8IA 3TZDA 1RCVD 4EQPA 1IBML 4A3LG 1YI2A 1TS4A 4TVAB 1Y1WB 1CKNB 1B44D 2RHQB 5M5WH 3G6JB 2F3IA 4BY1G 2Q2IA 2UU9Q 4LF9L 5M3MH 1W6KA 1UEBA 2K01A 5J39A 4A3CH 4HCSA 1TWGB 2F0EA 4YY3Q 1S3OA 3OW7A 1UUPA 2L0CA 5EPKA 4JI6L 3HOWG 1EIHA 1PH3A 1EQQA 3CQZH 3NTHA 4LF5Q 3IFDA 5LMNW 3AU7A 1N36Q 1EIYB 1ML0D 1K8MA 4WJ4A 5KEEA 1JMCA 2WAQB 1ZYRD 2H1EA 1PTOB 1TY2A 3S9WA 4DV4Q 1FJGL 2B2VC 3R2IA 2R7ZB 1JORA 4RGOS 1RIPA 3TDQA 1EUJA 4A3EH 5I2YA 3NWTA 4ZCKA 2V1CC 1PH5A 4JBJA 1F2MA 4P2CB 2RA4A 3KF6B 3CPWA 5IE8A 4LMQD 3K80C 1X3FA 1YHQA 5IT9E 3FMCA 1V8QA 4JBMA 4KY7A 4AYBE 1I3QB 4RG1A 3DEPA 2IX3A 5FLMG 1ET9A 1E2WA 5IGDA 4CDEC 3GTOH 2AUKA 2TSSA 3PO2B 1CI3M 1C7YA 4K6DA 1JR0D 4ZKCB 2EPBA 2MJ8A 1IHZA 3PCOB 5KRUA 2JSOA 1K3RA 1BKBA 3H91A 1J9OA 3I56A 3FPPA 1SYEA 4XQNA 1X65A 1Q7YC 1EY0A 2Q8TA 4LF4Q 3UDIA 2ZJRA 1BBXC 1T9HA 1N33L 2Z0SA 1D5MC 3RR5A 4RWSC 4DR1Q 3HOYB 1XPRA 1M90C 3H3VI 4IZ8A 1I5FA 2CWAA 3TP8A 1C0AA 1K28A 4L63B 4JI7L 3SK6A 4G7ZC 4FXGC 4C3JG 2XVSA 1X3GA 3SEBA 1QZGA 1LO5D 1K83B 3VYSA 4TSSA 5CBAE 1PA6A 1SROA 1X9NA 4IOCA 2UUBL 1I4QA 5I9PA 3TRZA 3KDFB 1XNRL 4FNFA 5CV8A 4DPGA 1GVPA 4K8JA 2RCFA 1XYIA 5IP9H 3GTMH 1FL0A 1S5BD 2JN4A 1CZWA 1VQNA 5EBCA 2MO0A 2XRSD 2F0IA 4KHZA 1JC7A 1S72A 2PI2A 4FF2A 4DF7A 1HUMA 1I6HH 3J7A5 2IL8A 3CCJA 4MTKA 5LMNQ 1IBMQ 2AKWB 3OWEB 1QG7A 1PTOD 4POGA 3J81L 1VQ5A 5KGUA 4YWMA 1KC8C 2WIIB 4A93B 3QJYA 1G8ZD 3E0JA 3GV3A 1EIFA 5T1GA 3GTPH 3BDLA 2Q8IB 3MAQA 3MXNB 4LF6Q 1EEFD 4IPGA 4JI0L 4O0AA 2BDOA 1H9MA 2RVLA 3GP7A 1ILQA 2VUMB 2EOTA 2E74C 4N9TA 3KLSA 2IY5B 3MEFA 1E0BA 3OTOL 1ENAA 4RMFA 4KN7C 1VMPA 3HOUH 3HOZB 3SHLA 2K32A 4XQQA 2E2HH 3I70A 1ZXTA 1FJGQ 4YCUA 4FO2A 4XT3B 4WJ3M 2OQKA 1CKNA 5D14A 5FK9C 4H13C 1AE3A 3LGJA 2B29A 3F2UA 3I4OA 2PZUA 1DOMA 1X55A 1FGBD 1G2SA 1Q8KA 2OF1A 4GLAC 2A74C 3KOJA 4JI4L 3K6OA 3N52A 1LTGD 1K8GA 3CCLA 3G48A 4DV3L 3FKIH 3S2HH 3ITPA 1B70B 1DXMA 1LTLA 4DK0A 2JQOA 4GN3B 5CMDA 1R4PB 1L1OA 3OHXC 1EY4A 1SMYD 1CK1A 5IYDG 4P72A 1V1QA 2PZTA 1J5EL 2NN6G 1MI2A 3SVMA 1QNKA 3S1QH 1Y1WG 4KHVA 2F3VA 3UDGA 1HXYD 2A6HC 2JA6H 3CQZB 2CCZA 1Z7TA 3HKZB 1N33Q 4O2DA 3KF6A 1HR0W 1VQ7A 4GOPA 1GHKA 4M1UB 4LWCA 2PZWA 3UE0A 4C56C 4CKBA 1D7QA 1Y14B 1IXRA 3KBGA 1PRTB 4XQJA 1VQ8A 4XYQA 3J80L 3PUXA 3CCUA 1PFBA 3A54A 2A6ED 4ZUIA 4DKAC 3J7ZC 1PH7A 2CH4W 5LL6S 2CQAA 2WAQG 1E1TA 4R4CA 3CU7A 3NE5B 3HOVH 3FDTA 1AZQA 4L5RC 2D62A 1TT2A 4GKJL 2X6GA 3D3RA 3ULLA 4FXKC 5FLXc 1TU2B 5ELFA 5JPMC 5DEHA 2HQEA 5IWAL 3EN2A 2PPBC 2OXPA 2O5IC 3WDNA 2SEBD 4A3IH 2F0GA 4C3HB 1GO3E 4HR7B 4NW2A 1E2ZA 5C5LA 5IYBG 4TQUS 3I72A 4IPCA 4JC0A 5FOBB 2J0TD 3A8JE 1SE8A 1YNJD 3M4QA 4B3MQ 1EEID 2CHBD 4ZQ3A 1AE2A 3PO2G 3H15A 3KDFA 1PDQA 3UI2A 1Q46A 1TIID 3STBC 2XRQD 3VDYA 3FVQA 1MGSA 2DNCA 1JOKA 2E2IB 3D0FA 2ICEC 1B9MA 2EJGC 3RZDH 1PH6A 2AQ1B 4FP5D 3JAMc 3HOYG 3S1NH 3A56A 2GVAA 5K36G 4LW1A 3BZCA 1UEAB 1H9RA 1AEXA 3E5SA 1SFOH 3QIAA 1X56A 2NVXH 1TWHB 1G51A 5EJWA 4ME5A 1JWSD 2H5XA 2BH8A 3KF8B 3NP8A 5M5XH 1NMGA 4HJ7A 5C4JH 1SNOA 3S1MH 2VQEL 1PH8A 5FJ8H 2PW7A 2QW7A 1VQ9A 4JI4Q 3MXNA 2IWHA 1HR0Q 1I6HB 1XXGA 1IW7C 4KK7A 4IO9A 1YJNA 4C1NK 4J15A 3S14B 4DV3Q 2EJMA 2EYJA 2N8NA 4XXEA 3OMCA 2K14A 4JVZA 1CKMA 1PRTD 2YTVA 4CDDC 1CKOA 4HJ8A 1VQLA 2ENBA 1NR2A 4JG2A 4HEDA 2UXBL 1N34L 3MHBA 1H9SA 3M4PA 4JI8L 1ESRA 2EQSA 4WJWA 3K7UC 4A3MH 3MXUA 1EOTA 2LXJA 4NPSA 4P74A 4XT1B 4BWGB 4A93G 2Q2UA 4JI5L 2DJFC 2PNHA 4QY7A 1FNWA 2DUDA 3GTGH 1XX8A 4JW0A 1SYGA 1Q8IA 4DUYQ 4PNYA
chains in the Genus database with same CATH topology
3HZXA 3TBIB 4CKEA 4RKLA 3SDZA 5EBDA 3MEHA 5KNCA 1OXSC 5G3LF 2EDGA 2EYOA 2SNSA 1LT3D 5DAUA 3K5LA 1A2UA 1JICA 4QF4A 2WP8J 1V1OA 2G9DA 3NSWA 5IOCA 3BVZA 1D1IA 2KCCA 3KLRA 3HP3A 2OT2A 1FD7D 1LTTD 2HDLA 2RKSA 2F0LA 1BCPF 3P1HA 5FLXE 1LV9A 3NQIA 4LK1C 1X32A 1CQVA 3SK4A 4K5VA 3J7AV 1JB3A 1KAAA 5KNBA 1O7LA 1F9RA 3EQLC 5CV9A 5C0XH 2F0VA 3T13A 1KABA 4TKOB 1HA6A 5M3FB 2WACA 4L8JA 1A3VA 1A3TA 4FVMA 1Q12A 2A73B 3P75A 2K04A 1C8CA 2NWGA 1LTSD 2ZXPA 2IX0A 1E2VA 1BCPC 2JP1A 5FO9B 1JOQA 4MHEA 3JAME 5C3WA 4IN3A 2DN8A 2PMZB 4F87A 3PUWA 4RA8A 1BF4A 5DM73 4G7HC 2FMMA 2NN6I 4IFDJ 1QILA 5NUCA 4ZYSA 1HFGA 1FNUA 2K5DA 4R9WA 5I6YA 3K59A 4J8QA 2QF7A 2B63B 2D2CC 3R2TA 4C3HG 2R6GA 2RSNA 1C48A 1Q1EA 3A7LA 5COYA 2QDBA 3M7GA 3KF8A 2R61A 3I8ZA 2F0HA 3I91A 5FO7B 2F0UA 1H9JA 4X3UA 2L12A 1EYCA 3RD4A 3MTSA 1MD2D 2RQXA 1ZEQX 3VYRA 1TR5A 3TMEA 4R8IA 1VF5C 1VDZA 1A3UA 3WOFA 1TKWB 3DWAA 5K5PA 1PXUA 3BZDB 1U4MA 2PCFB 2SOBA 1TWAB 2Z4HA 1RF2D 2M9VA 3S16B 2B8GA 1JQYD 2EZVA 3NHHA 4K2LA 1NCVA 1O78A 3NBIA 5KIXA 1BO0A 1B3AA 1RDPD 3MXGA 3IL8A 3I90A 1RD9D 1CA6A 4CJ0B 1G2TA 5EGTA 1C4QA 5J1ZA 4I7ZC 3GO5A 5A2QL 4XYOA 5JVH3 4RHSA 5CC4A 1I4PA 4A3JB 1KLUD 1B4OA 3PIO3 2B2VA 1VMCA 3PUYA 2EYLA 4ZRZA 1STAA 1CHQD 3WOEA 1V1PB 3ND8A 2D9UA 4H44C 1Y69U 3AB9A 3Q0AA 2KJXA 1EZ6A 1KLGD 3L7ZC 1VF7A 1TS5A 2JA5B 3VR6A 2R3ZA 2BA1A 2F0TA 4Y7NB 4XTCS 2NVTB 4J6HA 3TP6A 1SXTA 2GA4B 2ZT9C 2E2JB 3IAYA 2RDFA 4FXDA 2LFNA 3H09A 4OL7A 1J8IA 5BN5A 3MC0B 4AYBB 4HAEA 3H6MA 2O2LD 2SNMA 5C44B 1JCKB 2YU9B 4IUQA 3V05A 5JEAG 1U4PA 2FJ2A 3BDOA 1HTPA 1SYFA 1BQQT 3J81E 1AN8A 2I46A 5J22A 3GTKB 5E3FA 5D3IB 2KA7A 1PZKD 1SE4A 1AP0A 4DFAA 1HHVA 5CYUA 4IQZA 4DN4M 1SJHD 4IUPA 3ND9A 5EPJA 3K58A 1EFID 1WD0A 4K5XA 2A6HD 1D5ZC 4KKUA 1QB5D 4BBRB 1H9KA 1GUNA 2WINB 1LT6D 3S2DB 2KCNA 2EJFC 4OIKA 2M00A 3DWQA 5D3DA 3U9OA 3MZ5A 4EQOA 2F0KA 4RCOA 3TSSA 5D65A 4CJ2C 3QG1A 2BCOA 1DONA 5C4XB 3I4NB 4DA2A 1G6ZA 2R92B 4M8AA 2EY2A 1F9SA 4QMGA 3PIP3 1CM9A 1EIGA 1JWMD 2ZXRA 5T1IA 3MFGA 5E4XA 1PFNA 3LWEA 4UDUC 4OGQC 1YNNC 2HCCA 5FKAC 3H94A 5M5YB 1A6XA 4ABNA 4NDXA 1BXTA 5IGCA 4C1NI 1K8OA 2B39A 5M5WB 3QB3A 3K5NA 1V1PA 5ELBA 5M3MB 4OHJA 4X3KA 4IURA 3MXPA 3C3LA 1BDOA 3N6RA 1SE2A 5LL6X 2L55A 3D6CA 3K5MA 1B50A 1SNMA 1IW7D 2RBMA 4OO1G 1IYUA 4A3EB 1F2YA 3EA6A 1KNEA 2K28A 4KJNA 1HCZA 3QO2A 3C1EA 1GOZA 4IFDG 1TQOA 3NK9A 3CRLC 1QOHA 2J4XA 1BCPB 5ISRA 4DAPA 3VA5A 5EKKA 4RHRA 2LY7A 4H7BA 3GTOB 1TVXA 4OIJA 1Y8NB 4KMUC 4ULLA 3Q22A 5CV5A 4G4KA 1CA5A 2L5TA 2HCIA 2EVBA 2NTSA 4CGYB 3G7LA 1OXXK 4GZYC 3BVMA 3HRZC 1B2TA 3VYTA 1UAPA 2JE6I 3U9SA 3MVVA 4K2KA 3VYUA 4B9XA 2L1BA 3GQBA 1FR3A 2JXMB 2MHVA 3L9AX 1D1KA 1QNUA 1LACA 1ZKOA 1O7ZA 3GTMB 4V190 5JEAJ 3V2TA 4WFN3 2G9HD 1D5XC 2L4NA 1BOSA 1GJXA 5G3LD 3MWYW 1HTLD 4IUTA 1G291 2D5DA 2DY8A 3HGBA 3OSOA 4DU9A 3GTPB 3I3CA 1G91A 4J1MA 4KD3A 2VB3X 3E6ZX 2LMCB 1BCPD 2XWJB 5AFWA 3AMUA 4PMWA 2XIWA 1S5DD 3HOUB 4HCEA 2E2HB 1O7YA 1B53A 4BS9A 3A55A 2I07B 3A7AB 2KEDA 3DEOA 1JWUD 1SYCA 4DXGA 3DHQA 2AUJD 2Z8LA 1RTOA 4KD4A 4X3SA 2B2TA 1SYBA 4Q0FA 1S4ZA 1DOKA 2K6AA 4F88A 1EY6A 2NB0A 1EY9A 4NKLA 3FKIB 4KN4C 4DK1A 1HFNA 3S2HB 3DXJC 3BVGA 1IYVA 5BN4A 1LABA 1EY7A 1LTBD 1A2TA 2NN6H 1STYA 3OWFA 1DZ1A 5C3XA 3R93A 2B2YC 3S1QB 2EY1A 1DJRD 2KEEA 2JA6B 3H3VC 1OO9B 1VCIA 5IGGA 1I4GA 2A69C 2F4IA 3BS1A 3D4RA 5ELDA 3J7YW 1SNCA 3MFYA 2NZ1D 1HA5A 3KUPA 1GUSA 4K5WA 1PTOH 2N88A 1GUTA 1L0YB 1KNAA 3EJIA 4DXFA 1R4QB 3HOVB 4N9PA 1EZ8A 2VNUD 2KUMA 2LS01 2YYZA 2X6LA 2BE5C 1STEA 1ILPA 1CFMA 3PUZA 4FF3A 1AFPA 1AZPA 2N55A 5TSSA 4B08A 2E2DC 4A3IB 2K05A 2F0JA 4KI0A 2E76C 4IALA 2VB2X 1EYDA 4CBVA 5C0XJ 3T4AC 1RODA 1PLFA 4LJZC 4XDXA 1LT5D 1NSNS 5I2XA 4PMCA 5IGFA 4OO1I 1LTRD 3TZUA 5K36H 3HG9A 3RZDB 2AWNA 2B2WC 2CW0C 4DNTB 2WV6D 2CVRA 3S1NB 1EL0A 3D4WA 3IKJA 1F9PA 5DM63 4ZUJA 1SFOB 2NVXB 1EWHA 2DNEA 4EGVA 1RHPA 2HUGA 3X3NA 3PUVA 5M5XB 3S1MB 2NUCA 5C4JB 5JPNC 5C6AA 1SJED 3M7NA 4IUNA 2B2UC 1S5CD 2ZXOA 4RFBA 1GUOA 4R8NA 2KECA 2KVMA 3EROA 3FPUB 3I73A 4XIGS 2RSOA 3TP7A 1ET6A 5FO8B 1GUGA 2F0WA 3V96A 4A3MB 4QB4A 3W2DA 2SDFA 1OXTA 1SDFA 3SR1A 3GTGB 3KK7A 3TN2A 4HN7A 3Q6SA 3M4YA 4HSVA 3K5OA 2JA7B 2PNRC 4EVOA 1TWFB 1A15A 1M8AA 4O42A 5IODA 4WORA 3VR2A 2Z1CA 2Y0SB 1UNSA 3PV0A 1F2LA 3BDCA 4G7OC 1FYCA 3SK5A 4ZLTF 1SEBD 3MA2B 3ERQA 2FINB 1TS3A 2VXWA 5KNDA 2F0SA 2KOLA 3ONAB 5C3EB 5I6WA 1FNVA 1Z47A 1HRJA 4PV1C 2MP1A 3GTQB 1ENCA 1MSGA 4IUVA 4QUCA 4FF1A 1EWCA 3CHBD 5EPLA 1DCZA 1CZGA 2IX1A 1BUVT 2J7ZA 3RUZA 4DGZA 1WD1A 4KKTA 4CJ1B 5JJZA 3BG3A 2EY5A 2Q8RE 4DAVA 4HSPA 2KQ3A 3A8KE 2K33A 2PQEA 1IKMA 4JK1C 2K5QA 4A3DB 3NTKA 4IUUA 4ID6A 2EYFA 4BBSB 2PO4A 2WKDA 3RMHA 4DNRB 3O13A 1WTRA 1CT1D 3OMGA 3IFTA 5BN3A 3EVQA 2F0DA 1Y8OB 3DMUA 4UAIA 4Q5VA 2M2LA 3RZOB 3C1FA 3T56B 1YNND 2AQ2B 2L11A 1SSOA 2F03A 4C3IB 1JE4A 3I4MB 1EYAA 2A68C 2PW5A 2Z4IA 5IT9L 2EE1A 4NMZA 2L9HA 4F7XA 1STNA 3HOXB 2JEAI 2F0QA 2OEOA 1II3A 3BYYB 4TRDA 2BA0A 3LNNA 1I4XA 2V4DA 1WTVA 1V43A 1QE6A 5JOBA 2WB1B 3D6WA 3CRKC 2AWOA 5CR3A 1KDBA 1ZYRC 1DD2A 4B9WA 2ICIA 1GHJA 3I4LA 3NQTA 1WTOA 2F1MA 4QCLA 2XN9C 1AW7A 5CV4A 2AQ3B 5JAVA 1ENFA 2FFKB 1STGA 4FYDA 3DWPA 3ZYYX 4KY5A 3GTJB 3EFXD 4A3BB 2JA8B 1PMRA 4WRDA 2TMPA 2EY6A 1WCMB 2XNAC 2EYPA 4A3GB 3TP5A 1OXVA 4A3KB 1H9SB 2NVQB 5DNFA 2MUYA 3VA7A 3HS0C 1U4RA 4QIWB 3CKIB 1HQRD 4RAUC 3L3OC 3DUZA 2NBFA 3J80E 1PTOF 1WTXA 3GTLB 2IJ0A 3LX0A 4Z9CB 1NUCA 4FF4A 3C2PA 3KLSX 1QJOA 1D6EC 3DM1A 2MPMA 4KJOA 1F77A 1EY8A 1EY5A 2RDGA 2O5JC 4BY7B 2EYHA 3SE0A 1Y1VB 1MSHA 3LWUA 4RKBA 3S17B 1TWCB 4O1NA 3D4DA 1WTWA 3SXHA 4ZKBB 2R93B 1ESFA 4E6IA 1PTOC 1CTMA 5C0XG 1U9RA 4RGTA 1WTQA 1X3QA 1Q1BA 3PMFA 4HTHA 1KDAA 5M9OA 2IT1A 3NTIA 3J7AF 5IGEA 1EU4A 5E1FA 1PZID 2FMCA 5JEAH 1DYQA 3H0GB 2JEBI 5CV7A 4C2MB 5KYLA 4V0BA 5C4ZA 2XSCA 4L6TB 2X69A 3VR4A 1SBBB 2F0FA 2WKCA 4KV6A 1BR9A 1STBA 3QWNA 3D8GA 2JYOA 2MGSA 4MIUA 1SAPA 1HPCA 2F3WA 4C3IG 4I65A 4A3FB 3OIPA 3VR3A 1WTPA 4PQXA 3PO3B 1NAPA 5CBEE 1SMYC 3D31A 1SE3A 1Q90A 1HQMC 2A69D 4HMJA 4ODGA 1RJTA 4HMIA 1JOOA 1EQTA 5CGKA 1XWEA 1S5FD 1SNDA 2BDNA 1RTNA 4U68A 1KTKA 1EQVA 1QCBD 4MN3A 4RGNA 1WVLA 1XTCD 1IL8A 4KY6A 2A6EC 3W3AA 1LTID 2BE5D 2B8FA 1MBYA 1STHA 3QOJA 1CHPD 3NXWA 3X3MA 1I50B 4BA1I 4EQNA 5ELEA 5C4HA 1SNQA 3KBXA 2RDHA 5EKIA 3FEWX 3P7JA 2XWBB 1TS2A 3T16A 3FRPB 3Q23A 1U4LA 2PYKA 3NPPA 4BY1B 1YNJC 2F0OA 2B2YA 1W6JA 3HEJA 1NR4A 1PZJD 4S3SA 2HDMA 2LKVA 2NTTA 3OIQA 3K0YA 4U673 2K5WA 5HURA 3HOWB 2CW0D 1B1ZA 1PRTF 3URYA 5F2DA 1I6VC 2K1BA 1PYWD 1QWYA 3S15B 4BA2I 1ICWA 4G57A 5I9OA 2B2TC 4RH6A 3OOCA 3GD7A 4OO1H 2H4OA 4K6LA 5JVG3 3VR5A 1R9TB 5A35A 4ZK9B 2IPKD 4IFDH 1DOLA 1M4VA 4QUFA 3Q24A 1I4RA 1D2BA 3BYTB 5IGBA 3S1RB 3NBHA 2F0MA 1ONLA 1I4HA 1PRTC 1Y8PB 2A5HA 3NWSA 4H0LC 1GXDC 3P20A 1EU3A 2KHSA 4KKSA 4RGMA 1F9QA 2K7VA 3R8BA 1HUNA 1CQFA 4DAYA 5FLXL 3C46A 2BOSA 5ELCA 1PFMA 1T5XD 1IKLA 5LHY1 2C5CA 1SYDA 3QOLA 4JBWA 5CORA 1OXUA 2B2WA 2NVYB 1RKNA 1SNPA 1BNZA 5E4WC 4C3JB 1F2ZA 3RLFA 1Q3LA 2IW3A 2NYZD 2FHTA 2QEJC 2O4XA 3GV6A 5KYIA 4RCNA 4IFDI 2QILA 1B9NA 2B2UA 3JAML 4K14A 2QCPX 4NP5A 5C0XI 5IIFA 2K03A 4CKCA 1T5EA 2DY7A 2EYMA 1Z6HA 3OPOA 3NUCA 1X3PA 3A8IE 3M4OB 1LTAD 1LT4D 3K7AB 3K57A 5A2QE 5CV6A 4ILWA 4CHTB 2C9OA 1S5ED 4X3TA 4F8MA 5EQ0A 5EKLA 4ZAIA 4YIJA 2QKIC 3M85A 5C5MA 1TY0A 1LLRD 2ID0A 5I4DA 5HGTA 2F0PA 4LAAA 1DM0B 3SK8A 4KTAA 3M3YB 3T53B 2E75C 3R3OA 2F0NA 2EXZA 1GUWA 4PMBA 2A68D 1L0XB 1O80A 3T51B 1KDCA 4K8IA 3TZDA 1RCVD 4EQPA 1TS4A 1Y1WB 1B44D 3G6JB 1W6KA 2K01A 5J39A 4HCSA 1TWGB 2F0EA 3OW7A 1UUPA 2L0CA 5EPKA 1EIHA 3NTHA 3IFDA 3AU7A 1ML0D 5KEEA 2WAQB 1ZYRD 2H1EA 1PTOB 1TY2A 3S9WA 2B2VC 3R2IA 2R7ZB 1JORA 4RGOS 3TDQA 5I2YA 3NWTA 1F2MA 4P2CB 2RA4A 4LMQD 5IT9E 3FMCA 1V8QA 4KY7A 1I3QB 3DEPA 2IX3A 1ET9A 1E2WA 5IGDA 2AUKA 2TSSA 3PO2B 1CI3M 4K6DA 1JR0D 4ZKCB 2EPBA 2MJ8A 1IHZA 5KRUA 2JSOA 3H91A 1J9OA 3FPPA 1SYEA 4XQNA 1EY0A 2Q8TA 1BBXC 1D5MC 4RWSC 3HOYB 4IZ8A 3TP8A 4L63B 3SK6A 4G7ZC 4FXGC 4C3JG 2XVSA 3SEBA 1LO5D 1K83B 3VYSA 4TSSA 5CBAE 1I4QA 5I9PA 4FNFA 5CV8A 4K8JA 1XYIA 1S5BD 1CZWA 5EBCA 2XRSD 2F0IA 4KHZA 1JC7A 4FF2A 4DF7A 1HUMA 2IL8A 3OWEB 1QG7A 1PTOD 3J81L 5KGUA 1SYGA 2WIIB 4A93B 3QJYA 1G8ZD 3E0JA 3GV3A 5T1GA 3BDLA 2Q8IB 3MAQA 1EEFD 2BDOA 1H9MA 2RVLA 3GP7A 1ILQA 2VUMB 2EOTA 2E74C 4N9TA 3KLSA 1E0BA 1ENAA 4KN7C 1VMPA 3HOZB 3SHLA 2K32A 4XQQA 3I70A 1ZXTA 4FO2A 4XT3B 5D14A 5FK9C 4H13C 3F2UA 2PZUA 1DOMA 1FGBD 1G2SA 2OF1A 2A74C 3K6OA 3N52A 1LTGD 3ITPA 1DXMA 4DK0A 5CMDA 1R4PB 3OHXC 1EY4A 1SMYD 1CK1A 2PZTA 2NN6G 1MI2A 3SVMA 1QNKA 4KHVA 2F3VA 1HXYD 2A6HC 3CQZB 1Z7TA 3HKZB 1GHKA 4M1UB 2PZWA 4C56C 4CKBA 3KBGA 1PRTB 4XQJA 4XYQA 3J80L 3PUXA 1PFBA 3A54A 2A6ED 4ZUIA 5LL6S 2CQAA 3CU7A 3NE5B 3FDTA 1AZQA 2D62A 1TT2A 2X6GA 3D3RA 4FXKC 1TU2B 5ELFA 5JPMC 5DEHA 2HQEA 2PPBC 2OXPA 2O5IC 3WDNA 2SEBD 2F0GA 4C3HB 4HR7B 4NW2A 1E2ZA 5C5LA 4TQUS 3I72A 5FOBB 2J0TD 3A8JE 1YNJD 1EEID 2CHBD 4ZQ3A 1PDQA 3UI2A 1TIID 2XRQD 3FVQA 1MGSA 2DNCA 1JOKA 2E2IB 2ICEC 1B9MA 2EJGC 2AQ1B 4FP5D 3A56A 5K36G 1UEAB 1H9RA 1AEXA 3E5SA 3QIAA 1TWHB 5EJWA 4ME5A 1JWSD 3NP8A 1SNOA 2PW7A 3MXNA 2IWHA 1I6HB 1XXGA 1IW7C 4KK7A 4C1NK 3S14B 2EJMA 2EYJA 4XXEA 3OMCA 1PRTD 2ENBA 1NR2A 4HEDA 3MHBA 1H9SA 1ESRA 4WJWA 3MXUA 1EOTA 4XT1B 4BWGB 1FNWA 1XX8A 1K8MA 1Q8IA 4PNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U4R A;  2KUM A;  4DN4 M;  1B4O A;  2X6L A;  4IUP A;  1ICW A;  5EPJ A;  1WTP A;  4RAU C;  3TN2 A;  2B2T C;  1ILP A;  3Q6S A;  2L11 A;  1NAP A;  5CBE E;  1SSO A;  1WD0 A;  3I3C A;  2RVL A;  4HSV A;  1ILQ A;  2RSN A;  1JE4 A;  1G91 A;  1WTX A;  1X3P A;  2B2V A;  2RA4 A;  1VMC A;  2EOT A;  4LMQ D;  5COY A;  1AZP A;  4NW2 A;  2N55 A;  1B50 A;  1E0B A;  3I8Z A;  1A15 A;  1M8A A;  1KNE A;  2K05 A;  2K28 A;  3DM1 A;  3I91 A;  3QO2 A;  4ZK9 B;  1JIC A;  4O42 A;  2MPM A;  1VMP A;  1DOL A;  4X3U A;  5AFW A;  2D9U A;  2EE1 A;  3DEP A;  4QUF A;  1RJT A;  4X3T A;  1ZXT A;  1EQT A;  2XIW A;  2L9H A;  2L12 A;  4OIK A;  1PDQ A;  5EQ0 A;  3UI2 A;  3HP3 A;  1F2L A;  1O7Y A;  4XT3 B;  4ZAI A;  1B53 A;  1ROD A;  1PLF A;  4XDX A;  3MTS A;  5D14 A;  1MGS A;  2BDN A;  2HDL A;  1RTN A;  4U68 A;  2KED A;  5D65 A;  4ZKC B;  3DEO A;  4ZLT F;  4CJ2 C;  2EPB A;  1TVX A;  4OIJ A;  3F2U A;  2MJ8 A;  1DOM A;  4MN3 A;  2FIN B;  1DON A;  1F9Q A;  3H91 A;  1MSH A;  1G2S A;  1J9O A;  2VXW A;  1CA5 A;  1HUN A;  1LV9 A;  1WVL A;  2R3Z A;  1X32 A;  1IL8 A;  2KOL A;  1WTW A;  2HCI A;  3ONA B;  4ZKB B;  2Q8T A;  1G6Z A;  1RTO A;  4X3S A;  3N52 A;  2B2T A;  4R8I A;  1WTV A;  1BBX C;  1PFM A;  1QE6 A;  1HRJ A;  1S4Z A;  2MP1 A;  1F9S A;  2B2W C;  4RWS C;  1IKL A;  3D6W A;  1DOK A;  3G7L A;  2CVR A;  1EL0 A;  1MSG A;  1B2T A;  1F9R A;  4IUV A;  1F9P A;  4QUC A;  1CM9 A;  5CMD A;  1HFN A;  5EJW A;  1EIG A;  5COR A;  5EPL A;  5T1I A;  1HA6 A;  1U4M A;  2B2W A;  1RHP A;  2J7Z A;  1BNZ A;  5CBA E;  1GUW A;  5E4X A;  1PFN A;  2HUG A;  5E4W C;  1WD1 A;  3LWE A;  1WTO A;  1MI2 A;  4CJ1 B;  1O80 A;  1QNK A;  1X3Q A;  3SVM A;  2L1B A;  1WTQ A;  5JJZ A;  1J8I A;  3KBX A;  1Q3L A;  3TZD A;  5EKI A;  2NYZ D;  2HCC A;  3P7J A;  2FHT A;  1DZ1 A;  2K04 A;  1C8C A;  2NWG A;  2FFK B;  3R93 A;  2B2Y C;  2B2U C;  3GV6 A;  1XYI A;  1U4L A;  4HAE A;  2Q8R E;  2KEE A;  1NCV A;  2KEC A;  2JP1 A;  2KVM A;  1O7Z A;  2K01 A;  1IKM A;  1NR2 A;  1B3A A;  1BO0 A;  3FPU B;  4HED A;  4MHE A;  3IL8 A;  2B2U A;  2B2Y A;  4HCS A;  4IUQ A;  2RSO A;  4X3K A;  4IUR A;  4IUU A;  3I90 A;  1NR4 A;  1ESR A;  1U4P A;  2FJ2 A;  5EPK A;  2HDM A;  1PFB A;  1CA6 A;  4CJ0 B;  1HUM A;  1EIH A;  1G2T A;  2IL8 A;  4RA8 A;  1BF4 A;  2L4N A;  2NZ1 D;  1QG7 A;  1EOT A;  3KUP A;  2FMM A;  4XT1 B;  2X69 A;  2K03 A;  3IFD A;  1WTR A;  3MWY W;  2N88 A;  2DY7 A;  1ML0 D;  2SDF A;  3FDT A;  1AZQ A;  1KNA A;  1HFG A;  1XX8 A;  2H1E A;  2K1B A;  4IUT A;  2JYO A;  2MGS A;  5DNF A;  4R9W A;  2X6G A;  4UAI A;  1AP0 A;  1SDF A;  1HHV A;  2B2V C;  3GV3 A;  5T1G A;  1SAP A;  2M2L A;  2DY8 A; 
#chains in the Genus database with same CATH topology
 3HZX A;  3TBI B;  4B3R L;  4CKE A;  2Z9H A;  4RKL A;  2JA7 H;  3SDZ A;  2VUM G;  5EBD A;  3MEH A;  5KNC A;  1OXS C;  1SRU A;  5G3L F;  2EDG A;  2EYO A;  3HOZ G;  2SNS A;  4JYA L;  4GNX C;  1LT3 D;  5DAU A;  2HIX A;  1A2U A;  1JIC A;  3K5L A;  4IOA A;  5JJL A;  4QF4 A;  2WP8 J;  1V1O A;  4OX9 Q;  3F1Z A;  2G9D A;  2K5H A;  3NSW A;  4DV5 Q;  5IOC A;  3BVZ A;  1D1I A;  2KCC A;  3KLR A;  3HP3 A;  2OT2 A;  5IWA Q;  1SLJ A;  1FD7 D;  1LTT D;  2HDL A;  4DK6 C;  4LUO A;  2VY3 A;  2RKS A;  2F0L A;  5C3E H;  1BCP F;  4X64 Q;  1X3E A;  3JAM i;  3P1H A;  5FLX E;  1LV9 A;  3NQI A;  4LK1 C;  1X32 A;  4LFA L;  1CQV A;  3GTQ H;  5HGQ A;  3SK4 A;  4K5V A;  3J7A V;  1J6Q A;  4B3T Q;  4X62 L;  1JB3 A;  1KAA A;  5KNB A;  1O7L A;  1F9R A;  3EQL C;  3UDF A;  3BJU A;  5CV9 A;  5C0X H;  2F0V A;  3T13 A;  1KAB A;  4TKO B;  1HA6 A;  1MJC A;  5M3F B;  1Y1V G;  2WAC A;  4L8J A;  1A3V A;  1OTC A;  3UDX A;  1A3T A;  4R4Q A;  4FVM A;  1Q12 A;  2A73 B;  3HKZ G;  3P75 A;  2K04 A;  1C8C A;  1LM0 A;  2NWG A;  3F2C A;  1XMQ L;  1QVC A;  1LTS D;  4A75 A;  2NVT H;  2ZXP A;  2IX0 A;  1E2V A;  3CME A;  4A3D H;  1BCP C;  2JP1 A;  5FO9 B;  4JI1 L;  1JOQ A;  4MHE A;  1VQP A;  4BBS H;  4LFB L;  3JAM E;  3KFU A;  1MKH A;  5C3W A;  2VQE Q;  1IZ6 A;  4IN3 A;  2DN8 A;  1KRT A;  2PMZ B;  4F87 A;  3PUW A;  4RA8 A;  1BF4 A;  2ZJP A;  5DM7 3;  4G7H C;  2FMM A;  2NN6 I;  4IFD J;  4UP7 A;  1QIL A;  5NUC A;  4ZYS A;  1HFG A;  3RZO H;  1FNU A;  2K5D A;  4R9W A;  5I6Y A;  3K59 A;  3KLW A;  4J8Q A;  2UXB Q;  2QF7 A;  4C3I H;  2ES2 A;  2B63 B;  2D2C C;  3R2T A;  4C3H G;  2R6G A;  3I4M H;  5EAY A;  2RSN A;  2I5L X;  4PZ8 A;  1C48 A;  1EOV A;  1Q1E A;  3A7L A;  5COY A;  2PQA A;  3GTK H;  2QDB A;  3M7G A;  3KF8 A;  2R61 A;  3BZK A;  3I8Z A;  4JI5 Q;  4YCW A;  2F0H A;  3I91 A;  5FO7 B;  2F0U A;  1H9J A;  4X3U A;  3HOX H;  2L12 A;  4B3R Q;  1EYC A;  1B7Y B;  1IYJ B;  3RD4 A;  3MTS A;  4OON A;  1MD2 D;  4BBR H;  2K52 A;  2RQX A;  1ZEQ X;  4JYA Q;  3VYR A;  4HJ9 A;  1TR5 A;  3I55 A;  2AHO B;  3TME A;  1KAW A;  4R8I A;  1VF5 C;  4POF A;  1VDZ A;  1PHJ A;  2JK8 A;  1A3U A;  3WOF A;  3A5U A;  3M9B A;  1TKW B;  3DWA A;  5K5P A;  2ZTC A;  3J81 c;  1PXU A;  3BZD B;  1U4M A;  2PCF B;  2SOB A;  2RHS B;  1YHB A;  1TWA B;  4UY8 C;  4R4I A;  2Z4H A;  3OW2 A;  1RF2 D;  4LFA Q;  2M9V A;  3S16 B;  2Z6K A;  2R7F A;  3T1Y L;  3GTJ H;  4X62 Q;  4JBK A;  2I5M X;  2JA8 H;  4A3B H;  2B8G A;  4BXX H;  1WCM H;  1JQY D;  3E3X A;  2EZV A;  3NHH A;  4K2L A;  4Y52 H;  1NCV A;  1O78 A;  3NBI A;  5KIX A;  2Y0S E;  2VZA A;  1BO0 A;  1B3A A;  1RDP D;  3MXG A;  3IL8 A;  4H02 A;  2NZH A;  3I90 A;  2UUA L;  4NXM L;  1RD9 D;  3IRB A;  1CA6 A;  4CJ0 B;  1G2T A;  4A3K H;  5EGT A;  2HIV A;  1C4Q A;  1MIU A;  2Q2H A;  5J1Z A;  5M5Y H;  1XMQ Q;  4I7Z C;  3GO5 A;  5A2Q L;  4XYO A;  5JVH 3;  4RHS A;  3Q8D A;  1I4P A;  5CC4 A;  1SN8 A;  1JJC B;  2KCM A;  4JI1 Q;  1SMX A;  4GS3 A;  3CXC A;  1XMO L;  4LFB Q;  4A3J B;  1KLU D;  1B4O A;  2VS1 A;  3GTL H;  3PIO 3;  4LNQ A;  1JT8 A;  2K4K A;  3JC6 6;  2B2V A;  1VMC A;  1B8A A;  3PUY A;  2DGY A;  4IJH A;  2EYL A;  4ZRZ A;  1STA A;  1CHQ D;  4N8X 1;  1QVF A;  3WOE A;  3H3V H;  1V1P B;  3ND8 A;  2D9U A;  4H44 C;  4LF7 L;  1Y69 U;  4BY7 H;  3AB9 A;  3Q0A A;  2KJX A;  5ELN A;  1WJJ A;  1EZ6 A;  1WOC A;  3S17 H;  1TWC H;  1KLG D;  3L7Z C;  1UE6 A;  5IYC G;  2R93 H;  1VF7 A;  1TS5 A;  2E5L L;  2HHH L;  2JA5 B;  3VR6 A;  2R3Z A;  2BA1 A;  1MJE A;  2F0T A;  4Y7N B;  3CCV A;  2EIF A;  4DV2 L;  4K0K Q;  3J80 c;  4XTC S;  3J81 i;  2NVT B;  4J6H A;  3RN2 A;  3TP6 A;  2D0P A;  5M3F G;  1SXT A;  2GA4 B;  2ZT9 C;  2E2J B;  3TQY A;  3IAY A;  2RDF A;  1PVO A;  4FXD A;  2LFN A;  3H09 A;  4DV1 Q;  2OTL A;  1MHW C;  4OL7 A;  1J8I A;  1VQJ A;  2VQF L;  1WI5 A;  1EWI A;  4DAM A;  5BN5 A;  1GKH A;  3MC0 B;  1JE5 A;  4AYB B;  4JI2 L;  4HAE A;  3H6M A;  2O2L D;  2SNM A;  1A62 A;  2OCE A;  3H0G H;  5C44 B;  2F4V L;  1JCK B;  1HNW Q;  4C2M H;  2YU9 B;  4IUQ A;  3V05 A;  3E9H A;  5JEA G;  1U4P A;  1U5K A;  2FJ2 A;  3BDO A;  1HTP A;  1SYF A;  1BQQ T;  2BH2 A;  3J81 E;  1KD1 C;  3CCR A;  1AN8 A;  3T1Y Q;  2I46 A;  3CAM A;  5J22 A;  3GTK B;  5E3F A;  5D3I B;  2KA7 A;  1PZK D;  1SE4 A;  2OQ0 A;  1AP0 A;  2WB1 E;  4DFA A;  2B63 G;  1HHV A;  5CYU A;  1XPO A;  3PO3 H;  3ZJY C;  4IQZ A;  4DN4 M;  1SJH D;  4IUP A;  3ND9 A;  5E7N A;  5EPJ A;  4NXM Q;  4GN5 A;  3K58 A;  1EFI D;  1WD0 A;  4K5X A;  2A6H D;  1VQ4 A;  1D5Z C;  3ULJ A;  4KHP L;  4KKU A;  1QB5 D;  4BBR B;  3I7F A;  4X6A H;  1H9K A;  1GUN A;  2WIN B;  1LT6 D;  3S2D B;  1GD7 A;  4R4T A;  4LF9 Q;  2KCN A;  5GAD C;  1XMO Q;  2ASB A;  2EJF C;  4OIK A;  3PIO A;  2M00 A;  3KYH C;  1YEZ A;  1KQS A;  4JOI C;  3DWQ A;  5D3D A;  3U9O A;  3MZ5 A;  3WWV A;  2F0K A;  4RCO A;  4EQO A;  3TSS A;  5D65 A;  4CJ2 C;  3QG1 A;  2BCO A;  4JI6 Q;  1DON A;  5C4X B;  1NY4 A;  4JV5 L;  3I4N B;  3CPF A;  4DA2 A;  1QZH A;  1G6Z A;  2KCT A;  2R92 B;  4M8A A;  2EY2 A;  1HH2 P;  4LF7 Q;  1F9S A;  2N3S A;  4QMG A;  5GQO A;  1I50 H;  3PIP 3;  1CM9 A;  1YJ9 A;  2Z6B A;  1EIG A;  1JWM D;  2ZXR A;  4QIW E;  2AMC B;  4MNO A;  5T1I A;  3MFG A;  5E4X A;  1PFN A;  3LWE A;  4UDU C;  3CMA A;  3GDE A;  4OGQ C;  2K5N A;  4A3L H;  1YNN C;  2HCC A;  5FKA C;  4GNX B;  3H94 A;  5M5Y B;  3RN5 A;  1A6X A;  4ABN A;  4BY1 H;  3STB D;  3CD6 A;  1ICF B;  4NDX A;  1CSP A;  1BXT A;  5IGC A;  4C1N I;  5AJ3 L;  1K8O A;  2B39 A;  5M5W B;  3QB3 A;  1E22 A;  5IP7 G;  1WYD A;  3K5N A;  1NJI C;  1V1P A;  5ELB A;  5M3M B;  4OHJ A;  3HKS A;  4X3K A;  4IUR A;  1U0L A;  3MXP A;  1HZ9 A;  2WFW A;  4KLK A;  3C3L A;  3HOW H;  1KIX A;  2VQF Q;  1BDO A;  1HNX L;  4EX5 A;  1Q86 C;  1YZ6 A;  4IJL A;  5HY6 A;  3N6R A;  4DV6 L;  1SE2 A;  5LL6 X;  3SGI A;  2L55 A;  3BU2 A;  3D6C A;  3S15 H;  4A3J G;  3K5M A;  4JI7 Q;  1B50 A;  1VQ6 A;  2XTI A;  1IBL L;  4B3S L;  1SNM A;  1R9T H;  1IW7 D;  2RBM A;  4OO1 G;  1IYU A;  2UUB Q;  5H1S E;  4A3E B;  4DR4 L;  1F2Y A;  3EA6 A;  3CCQ A;  1XNR Q;  4DR7 L;  1KNE A;  2K28 A;  4KJN A;  1HCZ A;  1L1O C;  3QO2 A;  3C1E A;  1GOZ A;  3S1R H;  4IFD G;  1TQO A;  2UXC L;  4UHV A;  1P8L A;  3NK9 A;  3CRL C;  2C35 B;  2R7Z G;  1QOH A;  2J4X A;  1BCP B;  3F2B A;  5ISR A;  3B6Y A;  4DAP A;  1JB7 A;  3VA5 A;  2JA9 A;  1XTD A;  5EKK A;  4RHR A;  2LY7 A;  2HQL A;  4H7B A;  3GTO B;  2JA5 G;  1TVX A;  4OIJ A;  1Y8N B;  4KMU C;  4ULL A;  3Q22 A;  4GOP C;  5CV5 A;  3ER0 A;  4AH6 A;  4G4K A;  1CA5 A;  2L5T A;  2HCI A;  2EVB A;  2QDL A;  2NTS A;  4CGY B;  1S40 A;  3G7L A;  1OXX K;  5LMU L;  4GZY C;  3BVM A;  3HRZ C;  1B2T A;  3VYT A;  4DAY B;  4DR3 L;  1UAP A;  3QR8 A;  2JE6 I;  3U9S A;  3MVV A;  4JI0 Q;  3NEL A;  4K2K A;  4JCV E;  4JV5 Q;  3VYU A;  4P75 A;  4B9X A;  4AYB G;  2L1B A;  3GQB A;  1FR3 A;  4QL5 A;  4L5S A;  3OTO Q;  2JXM B;  1BVS A;  3PIP A;  2MHV A;  3L9A X;  1D1K A;  1QNU A;  5C44 G;  1LAC A;  1YVC A;  1VQK A;  1ZKO A;  1EQR A;  1O7Z A;  3F8T A;  3GTM B;  2FXQ A;  4V19 0;  5JEA J;  3V2T A;  4WFN 3;  3G4S A;  2G9H D;  1D5X C;  1G6P A;  2L4N A;  1BOS A;  1GJX A;  5G3L D;  3MWY W;  1HTL D;  5AJ3 Q;  4IUT A;  1G29 1;  2D5D A;  2DY8 A;  3HGB A;  1PH1 A;  3OSO A;  1EFW A;  4DU9 A;  3GTP B;  3M4O H;  3I3C A;  3K7A H;  4BBR G;  1J5E Q;  1G91 A;  1HNX Q;  4J1M A;  4KD3 A;  3CCS A;  2VB3 X;  5ELO A;  1Q81 C;  3E6Z X;  2LMC B;  4DV6 Q;  1BCP D;  1HJP A;  5GAE C;  1BBU A;  2R7D A;  2QA4 A;  2XWJ B;  5AFW A;  1PFS A;  3RNU A;  1XJV A;  1HNZ L;  3AMU A;  4PMW A;  2XIW A;  4OEL B;  1XPU A;  1S5D D;  4OXP A;  3HOU B;  4HCE A;  4GNX A;  2E2H B;  1O7Y A;  1IBL Q;  3EBE A;  1B53 A;  4BS9 A;  3A55 A;  2I07 B;  3CP0 A;  4DV0 L;  3A7A B;  5C4X G;  2KED A;  3U4Z A;  3DEO A;  1QUQ B;  1JWU D;  3I4N G;  2ALY B;  1SYC A;  1TWF H;  4DR4 Q;  1A63 A;  2ATW A;  4DR7 Q;  4DXG A;  2R92 G;  3DHQ A;  3RLN A;  2AUJ D;  2Z8L A;  1RTO A;  4KD4 A;  4X3S A;  2B2T A;  2UXC Q;  1SYB A;  4Q0F A;  1S4Z A;  4HIM A;  4QJF A;  4LFC L;  1DOK A;  4GKJ Q;  2VL6 A;  4DR5 L;  2K6A A;  4F88 A;  1EY6 A;  2NB0 A;  1EY9 A;  4NKL A;  3FKI B;  4KN4 C;  4DK1 A;  3W5O A;  1HFN A;  3S2H B;  4JI3 L;  3DXJ C;  3BVG A;  1IYV A;  5BN4 A;  5IYD H;  1LAB A;  5BR8 L;  3TEH B;  1EY7 A;  1LTB D;  1A2T A;  2NN6 H;  1STY A;  1Y1W H;  3OWF A;  1DZ1 A;  2GVB A;  5C3X A;  1SR3 A;  4FDB A;  3R93 A;  2B2Y C;  3S1Q B;  2HT1 A;  2EY1 A;  1JJG A;  5LMU Q;  1DJR D;  1PYB A;  2KEE A;  2JA6 B;  3H3V C;  1OO9 B;  5M3M G;  1VCI A;  5IGG A;  4DR3 Q;  1I4G A;  2A69 C;  2F4I A;  1UE7 A;  1IBK L;  4NXN L;  3BS1 A;  3CCE A;  4A3C G;  3D4R A;  3U58 A;  4DR2 L;  5ELD A;  3J7Y W;  4R4O A;  4PZ6 A;  1SNC A;  3MFY A;  1WFQ A;  2NZ1 D;  2RF4 A;  1HA5 A;  3KUP A;  1K0R A;  1VQF A;  1GUS A;  4K5W A;  1PTO H;  3TS2 A;  2N88 A;  3DM3 A;  1GUT A;  2A8V A;  1L0Y B;  1KNA A;  3EJI A;  4DXF A;  1R4Q B;  3HOV B;  1EYG A;  1ASZ A;  4N9P A;  1AH9 A;  1EZ8 A;  2VNU D;  2KUM A;  2LS0 1;  2YYZ A;  2X6L A;  3K81 C;  2BE5 C;  1STE A;  1ILP A;  1UWV A;  4A3E G;  1CFM A;  3PUZ A;  4FF3 A;  1AFP A;  1AZP A;  2N55 A;  5TSS A;  4B08 A;  5IYB H;  2E2D C;  4A3I B;  2K05 A;  2F0J A;  4KI0 A;  2OTJ A;  2E76 C;  4IAL A;  3PO2 H;  2VB2 X;  3HFZ B;  1EYD A;  1RL2 A;  4CBV A;  4R1J A;  3KJP A;  5C0X J;  1N34 Q;  3T4A C;  3CW2 C;  1ROD A;  2Q2T A;  1PLF A;  4LJZ C;  4XDX A;  1ASY A;  4JI8 Q;  1LT5 D;  1NSN S;  5I2X A;  4PMC A;  5IGF A;  4OO1 I;  1LTR D;  4LF5 L;  3HOY H;  3TZU A;  2EXD A;  5K36 H;  4OWW B;  2G5D A;  1VQD A;  3HG9 A;  3RZD B;  1N36 L;  2UXD L;  2AWN A;  2B2W C;  2E8G A;  4I7A A;  2CW0 C;  4DNT B;  2WV6 D;  2CVR A;  4DV4 L;  3S1N B;  1EL0 A;  3D4W A;  3AYH B;  3IKJ A;  1F9P A;  3T1H L;  5DM6 3;  4DV0 Q;  1K83 H;  4ZUJ A;  1WTH A;  1SFO B;  2NVX B;  1EWH A;  1VQG A;  2DNE A;  4EGV A;  1RHP A;  4YWL A;  1PH4 A;  2HUG A;  3X3N A;  5GAH C;  3PUV A;  5M5X B;  3S1M B;  2NUC A;  5C4J B;  5JPN C;  5C6A A;  1SJE D;  3M7N A;  4IUN A;  2B2U C;  1S5C D;  5J3B A;  2ZXO A;  4RFB A;  1GUO A;  4R8N A;  5IP9 G;  4DR5 Q;  2KEC A;  2KVM A;  3ERO A;  4QQB X;  2PI2 E;  3FPU B;  4JI3 Q;  3I73 A;  4XIG S;  4QGU A;  2RSO A;  4GN4 B;  3TP7 A;  1ET6 A;  2OWO A;  5FO8 B;  3AEV A;  5GAG C;  1GUG A;  2F0W A;  3V96 A;  4A3M B;  4A93 H;  1QUQ A;  4QB4 A;  4LF4 L;  4OWX B;  3W2D A;  2MFI A;  2SDF A;  1OXT A;  1SDF A;  3SR1 A;  1IBK Q;  4NXN Q;  3GTG B;  3E9I A;  3KK7 A;  4A3G H;  2VUM H;  3TN2 A;  4HN7 A;  3Q6S A;  3M4Y A;  4HSV A;  1I94 L;  3K5O A;  2JA7 B;  2PNR C;  4OWT B;  4EVO A;  1VQE A;  3HOZ H;  1TWF B;  1A15 A;  1M8A A;  2NVQ H;  4O42 A;  5IOD A;  3HOU G;  4WOR A;  3VR2 A;  2Z1C A;  2Y0S B;  1UNS A;  3PV0 A;  4UP9 A;  1F2L A;  3BDC A;  4G7O C;  1FYC A;  2Z6K C;  3SK5 A;  4DR6 L;  4ZLT F;  1SEB D;  1D8L A;  3MA2 B;  3ERQ A;  2FIN B;  1TS3 A;  4IPH A;  2B3G A;  2K50 A;  1QVG A;  2QGQ A;  2VXW A;  5LMN L;  5KND A;  2F0S A;  2KOL A;  1YJW A;  3ONA B;  5C3E B;  5I6W A;  1FNV A;  1Z47 A;  1HRJ A;  4PV1 C;  2MP1 A;  3FKI G;  1PYS B;  2WAQ E;  3GTQ B;  1ENC A;  1MSG A;  4IUV A;  4QUC A;  4FF1 A;  4HIO A;  1EWC A;  3A74 A;  3CHB D;  1CUK A;  5EPL A;  4ME3 A;  1DCZ A;  1TXY A;  4LF6 L;  3PGZ A;  1Y1V H;  1CZG A;  2IX1 A;  4DK3 C;  1BUV T;  2J7Z A;  3RUZ A;  4DGZ A;  2MQH A;  4HIK A;  1WD1 A;  4KKT A;  4CJ1 B;  3ULP A;  5JJZ A;  2P5Z X;  4X66 L;  3BG3 A;  2EY5 A;  3CC7 A;  2UXD Q;  1L1O B;  2JA6 G;  2ZM6 L;  1W3S A;  4AIM A;  1Z9F A;  2Q8R E;  3W1G A;  4DAV A;  1HZB A;  4HSP A;  2KQ3 A;  3A8K E;  3T1H Q;  2K33 A;  2PQE A;  4X65 L;  1IKM A;  4JK1 C;  2K5Q A;  4A3D B;  3NTK A;  4IUU A;  3CF5 A;  4ID6 A;  2EYF A;  4BBS B;  4HJ5 A;  4GOP B;  4P73 A;  2PO4 A;  2WKD A;  1M1K C;  3RMH A;  4DNR B;  3O13 A;  1WTR A;  1CT1 D;  3OMG A;  3HOV G;  3IFT A;  5BN3 A;  3EVQ A;  2F0D A;  1IL2 A;  1Y8O B;  3DMU A;  4UAI A;  2A1A A;  4Q5V A;  2M2L A;  3RZO B;  4C3H H;  3C1F A;  3T56 B;  1YNN D;  2AQ2 B;  2L11 A;  1SSO A;  2F03 A;  4C3I B;  1JE4 A;  4A3I G;  4OEM B;  3TRE A;  3I4M B;  2VW9 A;  1EYA A;  2A68 C;  2PW5 A;  2Z4I A;  3AQQ A;  5IT9 L;  2L15 A;  2EE1 A;  4NMZ A;  2L9H A;  4A3F H;  2E2I H;  4F7X A;  1UE1 A;  1STN A;  3HOX B;  4HID A;  2JEA I;  4NB3 A;  2UUA Q;  2F0Q A;  1E7Z A;  5GRO A;  1I94 Q;  2OEO A;  1II3 A;  3BYY B;  4JOI A;  4HJA A;  4TRD A;  1W2B A;  2BA0 A;  3LNN A;  1I4X A;  2V4D A;  1WTV A;  1V43 A;  1QE6 A;  3E0E A;  5JOB A;  1TWH H;  2WB1 B;  1YNX A;  3D6W A;  1BBW A;  3CRK C;  2AWO A;  4DUZ L;  5CR3 A;  4DR6 Q;  1KDB A;  1ZYR C;  4DV7 L;  1VQO A;  1DD2 A;  4B9W A;  2ICI A;  2XGT A;  3NEN A;  1GHJ A;  3I4L A;  3L2P A;  3NQT A;  1WTO A;  1CSQ A;  2F1M A;  5FJ8 G;  3S14 H;  4QCL A;  2XN9 C;  1AW7 A;  5CV4 A;  2AQ3 B;  5JAV A;  1N32 L;  1K3B C;  1ENF A;  2FFK B;  3J80 i;  4EQ5 A;  4B3M L;  1STG A;  4FYD A;  3DWP A;  4GLX A;  3ZYY X;  4KY5 A;  3GTJ B;  1VQI A;  3EFX D;  4A3B B;  2JA8 B;  1PMR A;  3L0O A;  4WRD A;  2TMP A;  2EY6 A;  1WCM B;  4LUV A;  2XNA C;  2EYP A;  2IHE A;  4A3G B;  2I5H A;  2YV5 A;  4A3M G;  2E5L Q;  2HHH Q;  4X66 Q;  1KRS A;  4LF8 L;  4CDC C;  3TP5 A;  3ERS X;  1OXV A;  2ZM6 Q;  4A3K B;  1C9O A;  1H9S B;  4DV2 Q;  2NVQ B;  1K0S A;  4X65 Q;  5DNF A;  2MUY A;  3VA7 A;  1VS0 A;  3HS0 C;  1U4R A;  2A19 A;  4QIW B;  3CKI B;  1HQR D;  2JA7 G;  4RAU C;  3L3O C;  3DUZ A;  2NBF A;  3J80 E;  1PTO F;  4YHH L;  1WTX A;  3GTL B;  3G71 A;  2IJ0 A;  1KHI A;  3LX0 A;  1NUC A;  4Z9C B;  1K8A C;  4FF4 A;  3C2P A;  3KLS X;  1QJO A;  1HR0 L;  1D6E C;  1JJ2 A;  3DM1 A;  2Y0S G;  2MPM A;  4KJO A;  4JI2 Q;  4L5Q A;  3HKZ E;  1F77 A;  1X6O A;  1EY8 A;  2F4V Q;  1EY5 A;  2RDG A;  2O5J C;  4BY7 B;  2D0O A;  2EYH A;  3SE0 A;  1YIJ A;  4ALP A;  5IYC H;  5C3E G;  1Y1V B;  1MSH A;  3LWU A;  1NBW A;  4RKB A;  3S17 B;  1TWC B;  4O1N A;  3D4D A;  3J81 j;  3SXH A;  4ZKB B;  1WTW A;  2R93 B;  1ESF A;  2N49 A;  4E6I A;  5FLM H;  4CDF C;  1PTO C;  2QEX A;  1VQC A;  3PF5 A;  5M3F H;  4DUY L;  1CTM A;  1XNQ L;  5C0X G;  1U9R A;  5JJI A;  3ICE A;  3U4V A;  4RGT A;  1WTQ A;  1X3Q A;  1N9W A;  3OYY A;  1Q1B A;  4KHP Q;  3NBH B;  3PMF A;  4HTH A;  1L2F A;  1KDA A;  5M9O A;  2IT1 A;  3NTI A;  3J7A F;  5IGE A;  4OX9 L;  1EU4 A;  5E1F A;  1PZI D;  4DV5 L;  4A3D G;  4DUZ Q;  2MO1 A;  2FMC A;  4DV7 Q;  2NVY H;  4BBS G;  4N8F A;  5JEA H;  2CWP A;  4C3J H;  1DYQ A;  3H0G B;  3G6E A;  2JEB I;  3PSI A;  5CV7 A;  3PF4 A;  4C2M B;  2HD3 A;  5KYL A;  4X64 L;  1N32 Q;  4V0B A;  5C4Z A;  2KHI A;  2XSC A;  4L6T B;  2X69 A;  3VR4 A;  1SBB B;  2F0F A;  2WKC A;  4KV6 A;  1BR9 A;  1STB A;  3QWN A;  3D8G A;  4LUZ A;  4B3T L;  2JYO A;  2MGS A;  2B63 H;  4MIU A;  1YBY A;  1SAP A;  1HPC A;  2F3W A;  4C3I G;  4I65 A;  4A3F B;  3OIP A;  1B3Q A;  3VR3 A;  1WTP A;  4PQX A;  3PO3 B;  1NAP A;  5CBE E;  3I4M G;  1P16 A;  4LF8 Q;  4DNI A;  1HZC A;  4A4I A;  1SMY C;  1E3P A;  5L37 A;  3D31 A;  1SE3 A;  1YIT A;  1Q90 A;  1HQM C;  2A69 D;  4HMJ A;  4ODG A;  1FGU A;  1RJT A;  4HMI A;  1JOO A;  2KBN A;  1EQT A;  5CGK A;  3HOX G;  1XWE A;  1S5F D;  1SND A;  2PQA B;  4UPA A;  1PH9 A;  2BDN A;  1RTN A;  4U68 A;  1KTK A;  4YHH Q;  2CKZ B;  1EQV A;  1QCB D;  4MN3 A;  2DJG C;  4GKK L;  4RGN A;  1NNX A;  1WVL A;  2IHF A;  1XTC D;  1IL8 A;  1PH2 A;  2WB1 G;  4KY6 A;  2A6E C;  2CQO A;  3W3A A;  1LTI D;  1X54 A;  2BE5 D;  2B8F A;  1MBY A;  1STH A;  4GLV B;  3QOJ A;  1CHP D;  3NXW A;  2KEN A;  3X3M A;  4B3S Q;  1I50 B;  1TWA H;  5DLQ E;  3S16 H;  4BA1 I;  2YTX A;  4EQN A;  5ELE A;  3CC4 A;  5C4H A;  4AQY L;  1SNQ A;  3KBX A;  1O7I A;  2RDH A;  5EKI A;  3FEW X;  2CH4 A;  3P7J A;  2XWB B;  1DGS A;  1TS2 A;  3T16 A;  3M3Y H;  2LXK A;  3FRP B;  3Q23 A;  1U4L A;  2YTY A;  4A3B G;  2JA8 G;  1NTG A;  3CC2 A;  4BXX G;  1WCM G;  3AFQ A;  2PYK A;  3NPP A;  1XNQ Q;  5IP7 H;  4BY1 B;  4A3G G;  1YNJ C;  1NE3 A;  2F0O A;  2B2Y A;  1FVI A;  1W6J A;  3HEJ A;  2JJQ A;  1NR4 A;  1PZJ D;  1VQB A;  2CFM A;  4S3S A;  2HDM A;  2LKV A;  2NTT A;  3OIQ A;  3K0Y A;  3I2Z A;  4JPB W;  4A3K G;  3EIV A;  4U67 3;  2K5W A;  5HUR A;  3HOW B;  2CW0 D;  1B1Z A;  4YCV A;  1N8R C;  1PRT F;  3URY A;  4MZ9 A;  3NEM A;  5F2D A;  1I6V C;  4A3J H;  2K1B A;  1PYW D;  4MTN A;  1L0W A;  1QWY A;  1TWG H;  1VQH A;  2K5V A;  3S15 B;  4BA2 I;  1ICW A;  4G57 A;  5I9O A;  2B2T C;  3FHW A;  1NMF A;  4RH6 A;  3OOC A;  3GD7 A;  4OO1 H;  2H4O A;  3AFP A;  4K6L A;  5JVG 3;  3PQI A;  3VR5 A;  1R9T B;  5A35 A;  2ZTD A;  4ZK9 B;  2IPK D;  4IFD H;  1DOL A;  1M4V A;  4QUF A;  3Q24 A;  2R7Z H;  1I4R A;  1D2B A;  3BYT B;  5IGB A;  3S1R B;  4BY7 G;  3NBH A;  1KL9 A;  1A0I A;  2F0M A;  2N78 A;  5JJK A;  1ONL A;  1I4H A;  1PRT C;  1Y8P B;  2A5H A;  3NWS A;  4UP8 A;  2JA5 H;  1LYL A;  4H0L C;  1GXD C;  2ZTE A;  3P20 A;  1EU3 A;  2KHS A;  4KKS A;  4Y7N H;  1VQA A;  4RGM A;  1F9Q A;  1A8V A;  2R93 G;  2K7V A;  1VQM A;  3R8B A;  2UUC L;  1HUN A;  2PMZ E;  1CQF A;  4DAY A;  5FLX L;  1I3Q H;  3C46 A;  2BOS A;  1UE5 A;  5ELC A;  1PFM A;  1T5X D;  1IKL A;  5LHY 1;  4P71 A;  1H95 A;  2E2J H;  2C5C A;  1SYD A;  3QOL A;  1PV4 A;  2UU9 L;  4JBW A;  2GN5 A;  5COR A;  1OXU A;  2B2W A;  2NVY B;  1RKN A;  4YY3 L;  1SNP A;  1BNZ A;  4GKK Q;  5E4W C;  4C3J B;  4A76 A;  1F2Z A;  3RLF A;  1Q3L A;  2IW3 A;  2NYZ D;  3A5Z B;  2FHT A;  2QEJ C;  1E24 A;  4PZ7 A;  3TS0 A;  3F2D A;  3RLO A;  2O4X A;  3GV6 A;  5C44 H;  5KYI A;  1HNZ Q;  2KHJ A;  2YU9 H;  4RCN A;  4IFD I;  3H0G G;  4PG3 A;  2QIL A;  1B9N A;  2B2U A;  5IT9 c;  3JAM L;  4K14 A;  1LUZ A;  2QCP X;  1Q82 C;  2K75 A;  4NP5 A;  4YWK A;  5C0X I;  4AQY Q;  5IIF A;  4L5T A;  1V9P A;  3CCM A;  2K03 A;  4CKC A;  3FP9 A;  1T5E A;  2DY7 A;  2EYM A;  1Z6H A;  4K0K L;  4LFC Q;  3OPO A;  2I0Q A;  4A3F G;  3NUC A;  3DLL A;  3PO3 G;  2NZO A;  2F52 A;  5IY0 A;  5BR8 Q;  4DV1 L;  1X3P A;  3A8I E;  3M4O B;  1LTA D;  1LT4 D;  3K7A B;  3S2D H;  3K57 A;  5A2Q E;  5CV6 A;  4ILW A;  4CHT B;  2C9O A;  2LSS A;  1HZA A;  1S5E D;  4X3T A;  4F8M A;  4DR1 L;  5EQ0 A;  1K9M C;  3K0X A;  4IPD A;  5EKL A;  4ZAI A;  4YIJ A;  1HNW L;  5C4X H;  3W1B A;  3UE1 A;  3I4N H;  4DR2 Q;  2QKI C;  3M85 A;  5C5M A;  1TY0 A;  3U50 C;  1LLR D;  3KJO A;  2R92 H;  2ID0 A;  5I4D A;  1KXL A;  4APV A;  1YHA A;  5HGT A;  2F0P A;  1K73 C;  4LAA A;  2RCN A;  1DM0 B;  3S24 A;  3SK8 A;  4KTA A;  1GM5 A;  2ZJQ A;  3T53 B;  2E75 C;  3R3O A;  3M3Y B;  1E1O A;  3K8A A;  2F0N A;  2EXZ A;  1GUW A;  4PMB A;  2MNA A;  2A68 D;  2UUC Q;  1L0X B;  1O80 A;  3A0J A;  3T51 B;  1KDC A;  4K8I A;  3TZD A;  1RCV D;  4EQP A;  1IBM L;  4A3L G;  1YI2 A;  1TS4 A;  4TVA B;  1Y1W B;  1CKN B;  1B44 D;  2RHQ B;  5M5W H;  3G6J B;  2F3I A;  4BY1 G;  2Q2I A;  2UU9 Q;  4LF9 L;  5M3M H;  1W6K A;  1UEB A;  2K01 A;  5J39 A;  4A3C H;  4HCS A;  1TWG B;  2F0E A;  4YY3 Q;  1S3O A;  3OW7 A;  1UUP A;  2L0C A;  5EPK A;  4JI6 L;  3HOW G;  1EIH A;  1PH3 A;  1EQQ A;  3CQZ H;  3NTH A;  4LF5 Q;  3IFD A;  5LMN W;  3AU7 A;  1N36 Q;  1EIY B;  1ML0 D;  1K8M A;  4WJ4 A;  5KEE A;  1JMC A;  2WAQ B;  1ZYR D;  2H1E A;  1PTO B;  1TY2 A;  3S9W A;  4DV4 Q;  1FJG L;  2B2V C;  3R2I A;  2R7Z B;  1JOR A;  4RGO S;  1RIP A;  3TDQ A;  1EUJ A;  4A3E H;  5I2Y A;  3NWT A;  4ZCK A;  2V1C C;  1PH5 A;  4JBJ A;  1F2M A;  4P2C B;  2RA4 A;  3KF6 B;  3CPW A;  5IE8 A;  4LMQ D;  3K80 C;  1X3F A;  1YHQ A;  5IT9 E;  3FMC A;  1V8Q A;  4JBM A;  4KY7 A;  4AYB E;  1I3Q B;  4RG1 A;  3DEP A;  2IX3 A;  5FLM G;  1ET9 A;  1E2W A;  5IGD A;  4CDE C;  3GTO H;  2AUK A;  2TSS A;  3PO2 B;  1CI3 M;  1C7Y A;  4K6D A;  1JR0 D;  4ZKC B;  2EPB A;  2MJ8 A;  1IHZ A;  3PCO B;  5KRU A;  2JSO A;  1K3R A;  1BKB A;  3H91 A;  1J9O A;  3I56 A;  3FPP A;  1SYE A;  4XQN A;  1X65 A;  1Q7Y C;  1EY0 A;  2Q8T A;  4LF4 Q;  3UDI A;  2ZJR A;  1BBX C;  1T9H A;  1N33 L;  2Z0S A;  1D5M C;  3RR5 A;  4RWS C;  4DR1 Q;  3HOY B;  1XPR A;  1M90 C;  3H3V I;  4IZ8 A;  1I5F A;  2CWA A;  3TP8 A;  1C0A A;  1K28 A;  4L63 B;  4JI7 L;  3SK6 A;  4G7Z C;  4FXG C;  4C3J G;  2XVS A;  1X3G A;  3SEB A;  1QZG A;  1LO5 D;  1K83 B;  3VYS A;  4TSS A;  5CBA E;  1PA6 A;  1SRO A;  1X9N A;  4IOC A;  2UUB L;  1I4Q A;  5I9P A;  3TRZ A;  3KDF B;  1XNR L;  4FNF A;  5CV8 A;  4DPG A;  1GVP A;  4K8J A;  2RCF A;  1XYI A;  5IP9 H;  3GTM H;  1FL0 A;  1S5B D;  2JN4 A;  1CZW A;  1VQN A;  5EBC A;  2MO0 A;  2XRS D;  2F0I A;  4KHZ A;  1JC7 A;  1S72 A;  2PI2 A;  4FF2 A;  4DF7 A;  1HUM A;  1I6H H;  3J7A 5;  2IL8 A;  3CCJ A;  4MTK A;  5LMN Q;  1IBM Q;  2AKW B;  3OWE B;  1QG7 A;  1PTO D;  4POG A;  3J81 L;  1VQ5 A;  5KGU A;  4YWM A;  1KC8 C;  2WII B;  4A93 B;  3QJY A;  1G8Z D;  3E0J A;  3GV3 A;  1EIF A;  5T1G A;  3GTP H;  3BDL A;  2Q8I B;  3MAQ A;  3MXN B;  4LF6 Q;  1EEF D;  4IPG A;  4JI0 L;  4O0A A;  2BDO A;  1H9M A;  2RVL A;  3GP7 A;  1ILQ A;  2VUM B;  2EOT A;  2E74 C;  4N9T A;  3KLS A;  2IY5 B;  3MEF A;  1E0B A;  3OTO L;  1ENA A;  4RMF A;  4KN7 C;  1VMP A;  3HOU H;  3HOZ B;  3SHL A;  2K32 A;  4XQQ A;  2E2H H;  3I70 A;  1ZXT A;  1FJG Q;  4YCU A;  4FO2 A;  4XT3 B;  4WJ3 M;  2OQK A;  1CKN A;  5D14 A;  5FK9 C;  4H13 C;  1AE3 A;  3LGJ A;  2B29 A;  3F2U A;  3I4O A;  2PZU A;  1DOM A;  1X55 A;  1FGB D;  1G2S A;  1Q8K A;  2OF1 A;  4GLA C;  2A74 C;  3KOJ A;  4JI4 L;  3K6O A;  3N52 A;  1LTG D;  1K8G A;  3CCL A;  3G48 A;  4DV3 L;  3FKI H;  3S2H H;  3ITP A;  1B70 B;  1DXM A;  1LTL A;  4DK0 A;  2JQO A;  4GN3 B;  5CMD A;  1R4P B;  1L1O A;  3OHX C;  1EY4 A;  1SMY D;  1CK1 A;  5IYD G;  4P72 A;  1V1Q A;  2PZT A;  1J5E L;  2NN6 G;  1MI2 A;  3SVM A;  1QNK A;  3S1Q H;  1Y1W G;  4KHV A;  2F3V A;  3UDG A;  1HXY D;  2A6H C;  2JA6 H;  3CQZ B;  2CCZ A;  1Z7T A;  3HKZ B;  1N33 Q;  4O2D A;  3KF6 A;  1HR0 W;  1VQ7 A;  4GOP A;  1GHK A;  4M1U B;  4LWC A;  2PZW A;  3UE0 A;  4C56 C;  4CKB A;  1D7Q A;  1Y14 B;  1IXR A;  3KBG A;  1PRT B;  4XQJ A;  1VQ8 A;  4XYQ A;  3J80 L;  3PUX A;  3CCU A;  1PFB A;  3A54 A;  2A6E D;  4ZUI A;  4DKA C;  3J7Z C;  1PH7 A;  2CH4 W;  5LL6 S;  2CQA A;  2WAQ G;  1E1T A;  4R4C A;  3CU7 A;  3NE5 B;  3HOV H;  3FDT A;  1AZQ A;  4L5R C;  2D62 A;  1TT2 A;  4GKJ L;  2X6G A;  3D3R A;  3ULL A;  4FXK C;  5FLX c;  1TU2 B;  5ELF A;  5JPM C;  5DEH A;  2HQE A;  5IWA L;  3EN2 A;  2PPB C;  2OXP A;  2O5I C;  3WDN A;  2SEB D;  4A3I H;  2F0G A;  4C3H B;  1GO3 E;  4HR7 B;  4NW2 A;  1E2Z A;  5C5L A;  5IYB G;  4TQU S;  3I72 A;  4IPC A;  4JC0 A;  5FOB B;  2J0T D;  3A8J E;  1SE8 A;  1YNJ D;  3M4Q A;  4B3M Q;  1EEI D;  2CHB D;  4ZQ3 A;  1AE2 A;  3PO2 G;  3H15 A;  3KDF A;  1PDQ A;  3UI2 A;  1Q46 A;  1TII D;  3STB C;  2XRQ D;  3VDY A;  3FVQ A;  1MGS A;  2DNC A;  1JOK A;  2E2I B;  3D0F A;  2ICE C;  1B9M A;  2EJG C;  3RZD H;  1PH6 A;  2AQ1 B;  4FP5 D;  3JAM c;  3HOY G;  3S1N H;  3A56 A;  2GVA A;  5K36 G;  4LW1 A;  3BZC A;  1UEA B;  1H9R A;  1AEX A;  3E5S A;  1SFO H;  3QIA A;  1X56 A;  2NVX H;  1TWH B;  1G51 A;  5EJW A;  4ME5 A;  1JWS D;  2H5X A;  2BH8 A;  3KF8 B;  3NP8 A;  5M5X H;  1NMG A;  4HJ7 A;  5C4J H;  1SNO A;  3S1M H;  2VQE L;  1PH8 A;  5FJ8 H;  2PW7 A;  2QW7 A;  1VQ9 A;  4JI4 Q;  3MXN A;  2IWH A;  1HR0 Q;  1I6H B;  1XXG A;  1IW7 C;  4KK7 A;  4IO9 A;  1YJN A;  4C1N K;  4J15 A;  3S14 B;  4DV3 Q;  2EJM A;  2EYJ A;  2N8N A;  4XXE A;  3OMC A;  2K14 A;  4JVZ A;  1CKM A;  1PRT D;  2YTV A;  4CDD C;  1CKO A;  4HJ8 A;  1VQL A;  2ENB A;  1NR2 A;  4JG2 A;  4HED A;  2UXB L;  1N34 L;  3MHB A;  1H9S A;  3M4P A;  4JI8 L;  1ESR A;  2EQS A;  4WJW A;  3K7U C;  4A3M H;  3MXU A;  1EOT A;  2LXJ A;  4NPS A;  4P74 A;  4XT1 B;  4BWG B;  4A93 G;  2Q2U A;  4JI5 L;  2DJF C;  2PNH A;  4QY7 A;  1FNW A;  2DUD A;  3GTG H;  1XX8 A;  4JW0 A;  1SYG A;  1Q8I A;  4DUY Q;  4PNY A; 
#chains in the Genus database with same CATH homology
 3HZX A;  3TBI B;  4CKE A;  4RKL A;  3SDZ A;  5EBD A;  3MEH A;  5KNC A;  1OXS C;  5G3L F;  2EDG A;  2EYO A;  2SNS A;  1LT3 D;  5DAU A;  3K5L A;  1A2U A;  1JIC A;  4QF4 A;  2WP8 J;  1V1O A;  2G9D A;  3NSW A;  5IOC A;  3BVZ A;  1D1I A;  2KCC A;  3KLR A;  3HP3 A;  2OT2 A;  1FD7 D;  1LTT D;  2HDL A;  2RKS A;  2F0L A;  1BCP F;  3P1H A;  5FLX E;  1LV9 A;  3NQI A;  4LK1 C;  1X32 A;  1CQV A;  3SK4 A;  4K5V A;  3J7A V;  1JB3 A;  1KAA A;  5KNB A;  1O7L A;  1F9R A;  3EQL C;  5CV9 A;  5C0X H;  2F0V A;  3T13 A;  1KAB A;  4TKO B;  1HA6 A;  5M3F B;  2WAC A;  4L8J A;  1A3V A;  1A3T A;  4FVM A;  1Q12 A;  2A73 B;  3P75 A;  2K04 A;  1C8C A;  2NWG A;  1LTS D;  2ZXP A;  2IX0 A;  1E2V A;  1BCP C;  2JP1 A;  5FO9 B;  1JOQ A;  4MHE A;  3JAM E;  5C3W A;  4IN3 A;  2DN8 A;  2PMZ B;  4F87 A;  3PUW A;  4RA8 A;  1BF4 A;  5DM7 3;  4G7H C;  2FMM A;  2NN6 I;  4IFD J;  1QIL A;  5NUC A;  4ZYS A;  1HFG A;  1FNU A;  2K5D A;  4R9W A;  5I6Y A;  3K59 A;  4J8Q A;  2QF7 A;  2B63 B;  2D2C C;  3R2T A;  4C3H G;  2R6G A;  2RSN A;  1C48 A;  1Q1E A;  3A7L A;  5COY A;  2QDB A;  3M7G A;  3KF8 A;  2R61 A;  3I8Z A;  2F0H A;  3I91 A;  5FO7 B;  2F0U A;  1H9J A;  4X3U A;  2L12 A;  1EYC A;  3RD4 A;  3MTS A;  1MD2 D;  2RQX A;  1ZEQ X;  3VYR A;  1TR5 A;  3TME A;  4R8I A;  1VF5 C;  1VDZ A;  1A3U A;  3WOF A;  1TKW B;  3DWA A;  5K5P A;  1PXU A;  3BZD B;  1U4M A;  2PCF B;  2SOB A;  1TWA B;  2Z4H A;  1RF2 D;  2M9V A;  3S16 B;  2B8G A;  1JQY D;  2EZV A;  3NHH A;  4K2L A;  1NCV A;  1O78 A;  3NBI A;  5KIX A;  1BO0 A;  1B3A A;  1RDP D;  3MXG A;  3IL8 A;  3I90 A;  1RD9 D;  1CA6 A;  4CJ0 B;  1G2T A;  5EGT A;  1C4Q A;  5J1Z A;  4I7Z C;  3GO5 A;  5A2Q L;  4XYO A;  5JVH 3;  4RHS A;  5CC4 A;  1I4P A;  4A3J B;  1KLU D;  1B4O A;  3PIO 3;  2B2V A;  1VMC A;  3PUY A;  2EYL A;  4ZRZ A;  1STA A;  1CHQ D;  3WOE A;  1V1P B;  3ND8 A;  2D9U A;  4H44 C;  1Y69 U;  3AB9 A;  3Q0A A;  2KJX A;  1EZ6 A;  1KLG D;  3L7Z C;  1VF7 A;  1TS5 A;  2JA5 B;  3VR6 A;  2R3Z A;  2BA1 A;  2F0T A;  4Y7N B;  4XTC S;  2NVT B;  4J6H A;  3TP6 A;  1SXT A;  2GA4 B;  2ZT9 C;  2E2J B;  3IAY A;  2RDF A;  4FXD A;  2LFN A;  3H09 A;  4OL7 A;  1J8I A;  5BN5 A;  3MC0 B;  4AYB B;  4HAE A;  3H6M A;  2O2L D;  2SNM A;  5C44 B;  1JCK B;  2YU9 B;  4IUQ A;  3V05 A;  5JEA G;  1U4P A;  2FJ2 A;  3BDO A;  1HTP A;  1SYF A;  1BQQ T;  3J81 E;  1AN8 A;  2I46 A;  5J22 A;  3GTK B;  5E3F A;  5D3I B;  2KA7 A;  1PZK D;  1SE4 A;  1AP0 A;  4DFA A;  1HHV A;  5CYU A;  4IQZ A;  4DN4 M;  1SJH D;  4IUP A;  3ND9 A;  5EPJ A;  3K58 A;  1EFI D;  1WD0 A;  4K5X A;  2A6H D;  1D5Z C;  4KKU A;  1QB5 D;  4BBR B;  1H9K A;  1GUN A;  2WIN B;  1LT6 D;  3S2D B;  2KCN A;  2EJF C;  4OIK A;  2M00 A;  3DWQ A;  5D3D A;  3U9O A;  3MZ5 A;  4EQO A;  2F0K A;  4RCO A;  3TSS A;  5D65 A;  4CJ2 C;  3QG1 A;  2BCO A;  1DON A;  5C4X B;  3I4N B;  4DA2 A;  1G6Z A;  2R92 B;  4M8A A;  2EY2 A;  1F9S A;  4QMG A;  3PIP 3;  1CM9 A;  1EIG A;  1JWM D;  2ZXR A;  5T1I A;  3MFG A;  5E4X A;  1PFN A;  3LWE A;  4UDU C;  4OGQ C;  1YNN C;  2HCC A;  5FKA C;  3H94 A;  5M5Y B;  1A6X A;  4ABN A;  4NDX A;  1BXT A;  5IGC A;  4C1N I;  1K8O A;  2B39 A;  5M5W B;  3QB3 A;  3K5N A;  1V1P A;  5ELB A;  5M3M B;  4OHJ A;  4X3K A;  4IUR A;  3MXP A;  3C3L A;  1BDO A;  3N6R A;  1SE2 A;  5LL6 X;  2L55 A;  3D6C A;  3K5M A;  1B50 A;  1SNM A;  1IW7 D;  2RBM A;  4OO1 G;  1IYU A;  4A3E B;  1F2Y A;  3EA6 A;  1KNE A;  2K28 A;  4KJN A;  1HCZ A;  3QO2 A;  3C1E A;  1GOZ A;  4IFD G;  1TQO A;  3NK9 A;  3CRL C;  1QOH A;  2J4X A;  1BCP B;  5ISR A;  4DAP A;  3VA5 A;  5EKK A;  4RHR A;  2LY7 A;  4H7B A;  3GTO B;  1TVX A;  4OIJ A;  1Y8N B;  4KMU C;  4ULL A;  3Q22 A;  5CV5 A;  4G4K A;  1CA5 A;  2L5T A;  2HCI A;  2EVB A;  2NTS A;  4CGY B;  3G7L A;  1OXX K;  4GZY C;  3BVM A;  3HRZ C;  1B2T A;  3VYT A;  1UAP A;  2JE6 I;  3U9S A;  3MVV A;  4K2K A;  3VYU A;  4B9X A;  2L1B A;  3GQB A;  1FR3 A;  2JXM B;  2MHV A;  3L9A X;  1D1K A;  1QNU A;  1LAC A;  1ZKO A;  1O7Z A;  3GTM B;  4V19 0;  5JEA J;  3V2T A;  4WFN 3;  2G9H D;  1D5X C;  2L4N A;  1BOS A;  1GJX A;  5G3L D;  3MWY W;  1HTL D;  4IUT A;  1G29 1;  2D5D A;  2DY8 A;  3HGB A;  3OSO A;  4DU9 A;  3GTP B;  3I3C A;  1G91 A;  4J1M A;  4KD3 A;  2VB3 X;  3E6Z X;  2LMC B;  1BCP D;  2XWJ B;  5AFW A;  3AMU A;  4PMW A;  2XIW A;  1S5D D;  3HOU B;  4HCE A;  2E2H B;  1O7Y A;  1B53 A;  4BS9 A;  3A55 A;  2I07 B;  3A7A B;  2KED A;  3DEO A;  1JWU D;  1SYC A;  4DXG A;  3DHQ A;  2AUJ D;  2Z8L A;  1RTO A;  4KD4 A;  4X3S A;  2B2T A;  1SYB A;  4Q0F A;  1S4Z A;  1DOK A;  2K6A A;  4F88 A;  1EY6 A;  2NB0 A;  1EY9 A;  4NKL A;  3FKI B;  4KN4 C;  4DK1 A;  1HFN A;  3S2H B;  3DXJ C;  3BVG A;  1IYV A;  5BN4 A;  1LAB A;  1EY7 A;  1LTB D;  1A2T A;  2NN6 H;  1STY A;  3OWF A;  1DZ1 A;  5C3X A;  3R93 A;  2B2Y C;  3S1Q B;  2EY1 A;  1DJR D;  2KEE A;  2JA6 B;  3H3V C;  1OO9 B;  1VCI A;  5IGG A;  1I4G A;  2A69 C;  2F4I A;  3BS1 A;  3D4R A;  5ELD A;  3J7Y W;  1SNC A;  3MFY A;  2NZ1 D;  1HA5 A;  3KUP A;  1GUS A;  4K5W A;  1PTO H;  2N88 A;  1GUT A;  1L0Y B;  1KNA A;  3EJI A;  4DXF A;  1R4Q B;  3HOV B;  4N9P A;  1EZ8 A;  2VNU D;  2KUM A;  2LS0 1;  2YYZ A;  2X6L A;  2BE5 C;  1STE A;  1ILP A;  1CFM A;  3PUZ A;  4FF3 A;  1AFP A;  1AZP A;  2N55 A;  5TSS A;  4B08 A;  2E2D C;  4A3I B;  2K05 A;  2F0J A;  4KI0 A;  2E76 C;  4IAL A;  2VB2 X;  1EYD A;  4CBV A;  5C0X J;  3T4A C;  1ROD A;  1PLF A;  4LJZ C;  4XDX A;  1LT5 D;  1NSN S;  5I2X A;  4PMC A;  5IGF A;  4OO1 I;  1LTR D;  3TZU A;  5K36 H;  3HG9 A;  3RZD B;  2AWN A;  2B2W C;  2CW0 C;  4DNT B;  2WV6 D;  2CVR A;  3S1N B;  1EL0 A;  3D4W A;  3IKJ A;  1F9P A;  5DM6 3;  4ZUJ A;  1SFO B;  2NVX B;  1EWH A;  2DNE A;  4EGV A;  1RHP A;  2HUG A;  3X3N A;  3PUV A;  5M5X B;  3S1M B;  2NUC A;  5C4J B;  5JPN C;  5C6A A;  1SJE D;  3M7N A;  4IUN A;  2B2U C;  1S5C D;  2ZXO A;  4RFB A;  1GUO A;  4R8N A;  2KEC A;  2KVM A;  3ERO A;  3FPU B;  3I73 A;  4XIG S;  2RSO A;  3TP7 A;  1ET6 A;  5FO8 B;  1GUG A;  2F0W A;  3V96 A;  4A3M B;  4QB4 A;  3W2D A;  2SDF A;  1OXT A;  1SDF A;  3SR1 A;  3GTG B;  3KK7 A;  3TN2 A;  4HN7 A;  3Q6S A;  3M4Y A;  4HSV A;  3K5O A;  2JA7 B;  2PNR C;  4EVO A;  1TWF B;  1A15 A;  1M8A A;  4O42 A;  5IOD A;  4WOR A;  3VR2 A;  2Z1C A;  2Y0S B;  1UNS A;  3PV0 A;  1F2L A;  3BDC A;  4G7O C;  1FYC A;  3SK5 A;  4ZLT F;  1SEB D;  3MA2 B;  3ERQ A;  2FIN B;  1TS3 A;  2VXW A;  5KND A;  2F0S A;  2KOL A;  3ONA B;  5C3E B;  5I6W A;  1FNV A;  1Z47 A;  1HRJ A;  4PV1 C;  2MP1 A;  3GTQ B;  1ENC A;  1MSG A;  4IUV A;  4QUC A;  4FF1 A;  1EWC A;  3CHB D;  5EPL A;  1DCZ A;  1CZG A;  2IX1 A;  1BUV T;  2J7Z A;  3RUZ A;  4DGZ A;  1WD1 A;  4KKT A;  4CJ1 B;  5JJZ A;  3BG3 A;  2EY5 A;  2Q8R E;  4DAV A;  4HSP A;  2KQ3 A;  3A8K E;  2K33 A;  2PQE A;  1IKM A;  4JK1 C;  2K5Q A;  4A3D B;  3NTK A;  4IUU A;  4ID6 A;  2EYF A;  4BBS B;  2PO4 A;  2WKD A;  3RMH A;  4DNR B;  3O13 A;  1WTR A;  1CT1 D;  3OMG A;  3IFT A;  5BN3 A;  3EVQ A;  2F0D A;  1Y8O B;  3DMU A;  4UAI A;  4Q5V A;  2M2L A;  3RZO B;  3C1F A;  3T56 B;  1YNN D;  2AQ2 B;  2L11 A;  1SSO A;  2F03 A;  4C3I B;  1JE4 A;  3I4M B;  1EYA A;  2A68 C;  2PW5 A;  2Z4I A;  5IT9 L;  2EE1 A;  4NMZ A;  2L9H A;  4F7X A;  1STN A;  3HOX B;  2JEA I;  2F0Q A;  2OEO A;  1II3 A;  3BYY B;  4TRD A;  2BA0 A;  3LNN A;  1I4X A;  2V4D A;  1WTV A;  1V43 A;  1QE6 A;  5JOB A;  2WB1 B;  3D6W A;  3CRK C;  2AWO A;  5CR3 A;  1KDB A;  1ZYR C;  1DD2 A;  4B9W A;  2ICI A;  1GHJ A;  3I4L A;  3NQT A;  1WTO A;  2F1M A;  4QCL A;  2XN9 C;  1AW7 A;  5CV4 A;  2AQ3 B;  5JAV A;  1ENF A;  2FFK B;  1STG A;  4FYD A;  3DWP A;  3ZYY X;  4KY5 A;  3GTJ B;  3EFX D;  4A3B B;  2JA8 B;  1PMR A;  4WRD A;  2TMP A;  2EY6 A;  1WCM B;  2XNA C;  2EYP A;  4A3G B;  3TP5 A;  1OXV A;  4A3K B;  1H9S B;  2NVQ B;  5DNF A;  2MUY A;  3VA7 A;  3HS0 C;  1U4R A;  4QIW B;  3CKI B;  1HQR D;  4RAU C;  3L3O C;  3DUZ A;  2NBF A;  3J80 E;  1PTO F;  1WTX A;  3GTL B;  2IJ0 A;  3LX0 A;  4Z9C B;  1NUC A;  4FF4 A;  3C2P A;  3KLS X;  1QJO A;  1D6E C;  3DM1 A;  2MPM A;  4KJO A;  1F77 A;  1EY8 A;  1EY5 A;  2RDG A;  2O5J C;  4BY7 B;  2EYH A;  3SE0 A;  1Y1V B;  1MSH A;  3LWU A;  4RKB A;  3S17 B;  1TWC B;  4O1N A;  3D4D A;  1WTW A;  3SXH A;  4ZKB B;  2R93 B;  1ESF A;  4E6I A;  1PTO C;  1CTM A;  5C0X G;  1U9R A;  4RGT A;  1WTQ A;  1X3Q A;  1Q1B A;  3PMF A;  4HTH A;  1KDA A;  5M9O A;  2IT1 A;  3NTI A;  3J7A F;  5IGE A;  1EU4 A;  5E1F A;  1PZI D;  2FMC A;  5JEA H;  1DYQ A;  3H0G B;  2JEB I;  5CV7 A;  4C2M B;  5KYL A;  4V0B A;  5C4Z A;  2XSC A;  4L6T B;  2X69 A;  3VR4 A;  1SBB B;  2F0F A;  2WKC A;  4KV6 A;  1BR9 A;  1STB A;  3QWN A;  3D8G A;  2JYO A;  2MGS A;  4MIU A;  1SAP A;  1HPC A;  2F3W A;  4C3I G;  4I65 A;  4A3F B;  3OIP A;  3VR3 A;  1WTP A;  4PQX A;  3PO3 B;  1NAP A;  5CBE E;  1SMY C;  3D31 A;  1SE3 A;  1Q90 A;  1HQM C;  2A69 D;  4HMJ A;  4ODG A;  1RJT A;  4HMI A;  1JOO A;  1EQT A;  5CGK A;  1XWE A;  1S5F D;  1SND A;  2BDN A;  1RTN A;  4U68 A;  1KTK A;  1EQV A;  1QCB D;  4MN3 A;  4RGN A;  1WVL A;  1XTC D;  1IL8 A;  4KY6 A;  2A6E C;  3W3A A;  1LTI D;  2BE5 D;  2B8F A;  1MBY A;  1STH A;  3QOJ A;  1CHP D;  3NXW A;  3X3M A;  1I50 B;  4BA1 I;  4EQN A;  5ELE A;  5C4H A;  1SNQ A;  3KBX A;  2RDH A;  5EKI A;  3FEW X;  3P7J A;  2XWB B;  1TS2 A;  3T16 A;  3FRP B;  3Q23 A;  1U4L A;  2PYK A;  3NPP A;  4BY1 B;  1YNJ C;  2F0O A;  2B2Y A;  1W6J A;  3HEJ A;  1NR4 A;  1PZJ D;  4S3S A;  2HDM A;  2LKV A;  2NTT A;  3OIQ A;  3K0Y A;  4U67 3;  2K5W A;  5HUR A;  3HOW B;  2CW0 D;  1B1Z A;  1PRT F;  3URY A;  5F2D A;  1I6V C;  2K1B A;  1PYW D;  1QWY A;  3S15 B;  4BA2 I;  1ICW A;  4G57 A;  5I9O A;  2B2T C;  4RH6 A;  3OOC A;  3GD7 A;  4OO1 H;  2H4O A;  4K6L A;  5JVG 3;  3VR5 A;  1R9T B;  5A35 A;  4ZK9 B;  2IPK D;  4IFD H;  1DOL A;  1M4V A;  4QUF A;  3Q24 A;  1I4R A;  1D2B A;  3BYT B;  5IGB A;  3S1R B;  3NBH A;  2F0M A;  1ONL A;  1I4H A;  1PRT C;  1Y8P B;  2A5H A;  3NWS A;  4H0L C;  1GXD C;  3P20 A;  1EU3 A;  2KHS A;  4KKS A;  4RGM A;  1F9Q A;  2K7V A;  3R8B A;  1HUN A;  1CQF A;  4DAY A;  5FLX L;  3C46 A;  2BOS A;  5ELC A;  1PFM A;  1T5X D;  1IKL A;  5LHY 1;  2C5C A;  1SYD A;  3QOL A;  4JBW A;  5COR A;  1OXU A;  2B2W A;  2NVY B;  1RKN A;  1SNP A;  1BNZ A;  5E4W C;  4C3J B;  1F2Z A;  3RLF A;  1Q3L A;  2IW3 A;  2NYZ D;  2FHT A;  2QEJ C;  2O4X A;  3GV6 A;  5KYI A;  4RCN A;  4IFD I;  2QIL A;  1B9N A;  2B2U A;  3JAM L;  4K14 A;  2QCP X;  4NP5 A;  5C0X I;  5IIF A;  2K03 A;  4CKC A;  1T5E A;  2DY7 A;  2EYM A;  1Z6H A;  3OPO A;  3NUC A;  1X3P A;  3A8I E;  3M4O B;  1LTA D;  1LT4 D;  3K7A B;  3K57 A;  5A2Q E;  5CV6 A;  4ILW A;  4CHT B;  2C9O A;  1S5E D;  4X3T A;  4F8M A;  5EQ0 A;  5EKL A;  4ZAI A;  4YIJ A;  2QKI C;  3M85 A;  5C5M A;  1TY0 A;  1LLR D;  2ID0 A;  5I4D A;  5HGT A;  2F0P A;  4LAA A;  1DM0 B;  3SK8 A;  4KTA A;  3M3Y B;  3T53 B;  2E75 C;  3R3O A;  2F0N A;  2EXZ A;  1GUW A;  4PMB A;  2A68 D;  1L0X B;  1O80 A;  3T51 B;  1KDC A;  4K8I A;  3TZD A;  1RCV D;  4EQP A;  1TS4 A;  1Y1W B;  1B44 D;  3G6J B;  1W6K A;  2K01 A;  5J39 A;  4HCS A;  1TWG B;  2F0E A;  3OW7 A;  1UUP A;  2L0C A;  5EPK A;  1EIH A;  3NTH A;  3IFD A;  3AU7 A;  1ML0 D;  5KEE A;  2WAQ B;  1ZYR D;  2H1E A;  1PTO B;  1TY2 A;  3S9W A;  2B2V C;  3R2I A;  2R7Z B;  1JOR A;  4RGO S;  3TDQ A;  5I2Y A;  3NWT A;  1F2M A;  4P2C B;  2RA4 A;  4LMQ D;  5IT9 E;  3FMC A;  1V8Q A;  4KY7 A;  1I3Q B;  3DEP A;  2IX3 A;  1ET9 A;  1E2W A;  5IGD A;  2AUK A;  2TSS A;  3PO2 B;  1CI3 M;  4K6D A;  1JR0 D;  4ZKC B;  2EPB A;  2MJ8 A;  1IHZ A;  5KRU A;  2JSO A;  3H91 A;  1J9O A;  3FPP A;  1SYE A;  4XQN A;  1EY0 A;  2Q8T A;  1BBX C;  1D5M C;  4RWS C;  3HOY B;  4IZ8 A;  3TP8 A;  4L63 B;  3SK6 A;  4G7Z C;  4FXG C;  4C3J G;  2XVS A;  3SEB A;  1LO5 D;  1K83 B;  3VYS A;  4TSS A;  5CBA E;  1I4Q A;  5I9P A;  4FNF A;  5CV8 A;  4K8J A;  1XYI A;  1S5B D;  1CZW A;  5EBC A;  2XRS D;  2F0I A;  4KHZ A;  1JC7 A;  4FF2 A;  4DF7 A;  1HUM A;  2IL8 A;  3OWE B;  1QG7 A;  1PTO D;  3J81 L;  5KGU A;  1SYG A;  2WII B;  4A93 B;  3QJY A;  1G8Z D;  3E0J A;  3GV3 A;  5T1G A;  3BDL A;  2Q8I B;  3MAQ A;  1EEF D;  2BDO A;  1H9M A;  2RVL A;  3GP7 A;  1ILQ A;  2VUM B;  2EOT A;  2E74 C;  4N9T A;  3KLS A;  1E0B A;  1ENA A;  4KN7 C;  1VMP A;  3HOZ B;  3SHL A;  2K32 A;  4XQQ A;  3I70 A;  1ZXT A;  4FO2 A;  4XT3 B;  5D14 A;  5FK9 C;  4H13 C;  3F2U A;  2PZU A;  1DOM A;  1FGB D;  1G2S A;  2OF1 A;  2A74 C;  3K6O A;  3N52 A;  1LTG D;  3ITP A;  1DXM A;  4DK0 A;  5CMD A;  1R4P B;  3OHX C;  1EY4 A;  1SMY D;  1CK1 A;  2PZT A;  2NN6 G;  1MI2 A;  3SVM A;  1QNK A;  4KHV A;  2F3V A;  1HXY D;  2A6H C;  3CQZ B;  1Z7T A;  3HKZ B;  1GHK A;  4M1U B;  2PZW A;  4C56 C;  4CKB A;  3KBG A;  1PRT B;  4XQJ A;  4XYQ A;  3J80 L;  3PUX A;  1PFB A;  3A54 A;  2A6E D;  4ZUI A;  5LL6 S;  2CQA A;  3CU7 A;  3NE5 B;  3FDT A;  1AZQ A;  2D62 A;  1TT2 A;  2X6G A;  3D3R A;  4FXK C;  1TU2 B;  5ELF A;  5JPM C;  5DEH A;  2HQE A;  2PPB C;  2OXP A;  2O5I C;  3WDN A;  2SEB D;  2F0G A;  4C3H B;  4HR7 B;  4NW2 A;  1E2Z A;  5C5L A;  4TQU S;  3I72 A;  5FOB B;  2J0T D;  3A8J E;  1YNJ D;  1EEI D;  2CHB D;  4ZQ3 A;  1PDQ A;  3UI2 A;  1TII D;  2XRQ D;  3FVQ A;  1MGS A;  2DNC A;  1JOK A;  2E2I B;  2ICE C;  1B9M A;  2EJG C;  2AQ1 B;  4FP5 D;  3A56 A;  5K36 G;  1UEA B;  1H9R A;  1AEX A;  3E5S A;  3QIA A;  1TWH B;  5EJW A;  4ME5 A;  1JWS D;  3NP8 A;  1SNO A;  2PW7 A;  3MXN A;  2IWH A;  1I6H B;  1XXG A;  1IW7 C;  4KK7 A;  4C1N K;  3S14 B;  2EJM A;  2EYJ A;  4XXE A;  3OMC A;  1PRT D;  2ENB A;  1NR2 A;  4HED A;  3MHB A;  1H9S A;  1ESR A;  4WJW A;  3MXU A;  1EOT A;  4XT1 B;  4BWG B;  1FNW A;  1XX8 A;  1K8M A;  1Q8I A;  4PNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...