1SSOA

Solution structure and dna-binding properties of a thermostable protein from the archaeon sulfolobus solfataricus
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
62
structure length
62
Chain Sequence
ATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and DNA-binding properties of a thermostable protein from the archaeon Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein
molecule keywords SSO7D
total genus 4
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1995-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ssoA00
1MGSA 2N88A 2KEDA 5EPKA 1O7YA 2KUMA 4ZAIA 4QUCA 4MN3A 5E4XA 1HHVA 2DY8A 1PLFA 2HCIA 2L9HA 2Q8RE 4DN4M 3KBXA 1HUNA 3FPUB 1PFMA 2B2WA 2KVMA 1PFBA 4IUPA 1U4PA 1HFNA 4LMQD 2K28A 1MI2A 5JJZA 1E0BA 5E4WC 1B4OA 1WTWA 1WD0A 1J8IA 1F9SA 2NZ1D 1QNKA 3KUPA 2Q8TA 1Q3LA 2FJ2A 1TVXA 2HDMA 1HRJA 1SDFA 4CJ1B 1JE4A 1DONA 1WTOA 3IFDA 1EIGA 1F9RA 3H91A 1KNAA 1DZ1A 2K04A 4CJ2C 2N55A 4RA8A 1KNEA 5DNFA 2JYOA 4IUTA 1AZQA 4RWSC 3MWYW 4HEDA 2B2VA 2HUGA 3P7JA 4MHEA 5D65A 1MSGA 5T1GA 1ICWA 4IUUA 4R9WA 1ESRA 1RHPA 1ILPA 4NW2A 4XT1B 5CORA 4X3TA 1ZXTA 1CA5A 1IL8A 3SVMA 2BDNA 2FMMA 2B2VC 2L4NA 2R3ZA 3FDTA 3UI2A 1XYIA 5AFWA 2KOLA 1F9QA 1X32A 4XDXA 1B50A 2RVLA 1O80A 2MGSA 4ZKCB 1IKMA 1WTQA 1IKLA 5D14A 1NCVA 4RAUC 3TN2A 1WVLA 1WTRA 1X3PA 2VXWA 4IURA 1S4ZA 4R8IA 1SAPA 2NYZD 1WTVA 2X69A 3HP3A 2KEEA 2IL8A 1B53A 2D9UA 1HA6A 1BBXC 1HUMA 3I91A 2X6LA 4U68A 5CMDA 2MPMA 1ILQA 2K05A 2CVRA 3GV6A 3N52A 2K03A 1G91A 1RJTA 5CBAE 2EE1A 1VMPA 4UAIA 2HDLA 3IL8A 4HCSA 1O7ZA 1CA6A 1DOKA 1NR2A 2FINB 2B2UC 4HSVA 2DY7A 1LV9A 2M2LA 2B2UA 1G2TA 2EOTA 4XT3B 1M8AA 3LWEA 1NAPA 2KECA 3I3CA 1G6ZA 2K01A 4OIJA 1U4MA 3R93A 1BF4A 1ML0D 2XIWA 1B2TA 1BO0A 1EIHA 2FFKB 1WTXA 1PFNA 1MSHA 2H1EA 4IUQA 1G2SA 2SDFA 4IUVA 3Q6SA 1QG7A 1F2LA 2MJ8A 2RSNA 4O42A 4X3UA 1C8CA 1AZPA 1EL0A 2L12A 1QE6A 1DOMA 1RODA 3GV3A 1XX8A 4ZLTF 3I90A 3TZDA 4QUFA 1F9PA 3F2UA 5T1IA 1DOLA 2EPBA 1SSOA 1RTNA 4ZKBB 1PDQA 2J7ZA 2X6GA 2FHTA 3D6WA 3QO2A 3DEOA 4CJ0B 2RSOA 2B2YA 1J9OA 1A15A 1NR4A 3I8ZA 2B2YC 1RTOA 3MTSA 5EJWA 2L1BA 2MP1A 2NWGA 2RA4A 1U4RA 3DEPA 3ONAB 5EKIA 5CBEE 3DM1A 1EOTA 5COYA 3G7LA 5EPLA 1WD1A 1GUWA 4ZK9B 1BNZA 4OIKA 1EQTA 1X3QA 2L11A 1HFGA 2B2TC 4X3SA 5EPJA 5EQ0A 2B2TA 2K1BA 1WTPA 2JP1A 1AP0A 1JICA 4HAEA 1B3AA 1VMCA 2HCCA 1CM9A 1U4LA 2B2WC 4X3KA
chains in the Genus database with same CATH superfamily
3T51B 5C4HA 2OF1A 3UDFA 5C3EH 5KGUA 3LNNA 3CCRA 3MC0B 2KVMA 3OTOQ 2B63G 2K32A 1U4PA 4KK7A 3MXGA 4RGMA 3I4NH 3B6YA 2EJGC 1I4XA 1LTBD 2V1CC 1SDFA 4CDDC 2CW0D 4NMZA 5I2XA 2VZAA 1BCPF 4QJFA 3SDZA 4IFDH 5LMUL 3P7JA 1JWUD 4IUUA 3RN2A 1LTSD 4BBSH 1VCIA 3LGJA 3TP8A 2DNEA 4GOPA 1Q1EA 1DYQA 1QJOA 3BDOA 2L4NA 4A3FB 5M3MB 5AJ3Q 3I4MH 3S1QB 2E2HH 1B50A 5KRUA 1S5BD 1D7QA 1XNRL 4FP5D 2VNUD 4RAUC 4V0BA 3PQIA 1HNWQ 1EWHA 4IURA 4FF1A 4OWXB 5IODA 2XRSD 4YY3Q 4LFBQ 3QB3A 3CPFA 1S3OA 2WINB 4GN4B 1IW7C 1ILQA 3BVGA 4B3TQ 3CC4A 2JA7B 1O7ZA 2YTVA 4YWKA 3CCUA 4IPDA 3D8GA 4DNTB 3HOVG 3HFZB 2I46A 4C3JG 3KFUA 2H1EA 3CAMA 5IYBG 1QG7A 1F2LA 1TU2B 2NVYB 2K5QA 1N36Q 4DR6Q 4K2LA 3ULLA 1Q86C 1W6KA 3MHBA 1DOLA 1PTOF 1SNMA 1WI5A 2EPBA 4O1NA 4A3DH 2X6GA 2FHTA 1YNJC 4CKEA 1K0SA 2ALYB 2GVAA 1YNNC 2L1BA 1C7YA 4DPGA 1J5EL 3J81j 1WD1A 4IOCA 1KQSA 1R4QB 4ZUIA 1PH7A 1EZ8A 2EVBA 1AFPA 2OT2A 3C2PA 5C4JB 1SNPA 2QEJC 4RKBA 2IT1A 4DNRB 5F2DA 1O7YA 4X64L 3HZXA 3DM3A 5JPNC 3PGZA 2DY8A 4LUZA 1LTLA 4DR4Q 1BVSA 4JI2Q 3S1RH 1QCBD 4K6DA 1N34Q 2RBMA 1HFNA 1XMOL 1YEZA 1EU3A 2B39A 2Z1CA 3HKZE 4HMJA 5C5LA 4IPCA 4DV0Q 4LFAL 1G291 2XNAC 1S72A 1Q3LA 2RDFA 3G48A 3SR1A 4A3JH 4JBWA 2UU9Q 3E0EA 4JOIA 2E75C 1KRSA 1GM5A 5AJ3L 1DZ1A 3T56B 4F87A 1CKNA 1HNZL 1L1OC 1GOZA 2ZTDA 2E5LL 2CKZB 2F0OA 4B3MQ 1B44D 1JR0D 3A8KE 4MZ9A 2WFWA 2QA4A 4JI0L 3U9SA 3DHQA 2F4VL 3FKIG 2NZHA 1N34L 3AYHB 3Q24A 2VQEL 2Q2IA 2VUMG 1X3FA 4IUNA 2KOLA 1O78A 1TKWB 2PZUA 3PSIA 1W6JA 5A35A 1D5XC 3ERSX 2CFMA 3WDNA 3CCEA 4NDXA 2JEAI 1UE7A 1H9KA 2E2JB 3H09A 1JOQA 1K83H 1PXUA 1RJTA 2CH4A 2F0PA 3PO2G 5D3DA 3IFTA 5H1SE 1CKMA 5C44H 3HOYG 2YYZA 1PRTD 1WTXA 1X9NA 1PFNA 1J6QA 1LT3D 3D4RA 1J5EQ 1II3A 3EVQA 2EY5A 3J7YW 2KJXA 3RNUA 1V1PB 1PH6A 5M5XB 1HZAA 1TS4A 2N78A 2PI2A 2K52A 3C3LA 1XPRA 4FF3A 1JWSD 1F9PA 2ZTCA 4J8QA 2BH8A 1STBA 1C9OA 4EQ5A 4OO1G 4CDEC 2NVQH 1J9OA 4FXKC 3HOZB 3J81c 3HKSA 3A8IE 2Z4HA 5EKIA 1JC7A 3QWNA 2WB1G 4I7AA 4PZ8A 1YIJA 1ASYA 1GUWA 3RLFA 2R92B 3CW2C 2B2TC 1FJGQ 3S16B 3IAYA 3I70A 4NP5A 1FNWA 2PNRC 2VL6A 1SJED 5ELBA 1EFID 2K33A 3F2BA 1H9JA 4A3CG 4QUCA 1DCZA 1L1OA 3OMGA 3KDFB 5KNCA 4XQNA 4A3GH 1JJGA 3UDIA 3GTJB 3HOWB 4L5QA 3GTPB 4BY1H 1TQOA 4NB3A 4OX9L 1J8IA 2NZ1D 1RF2D 4LNQA 1GKHA 1TY2A 5IOCA 4L5SA 4M1UB 1P8LA 1HNXL 2EJFC 3D4WA 1UE1A 1PH1A 2HHHQ 1N33Q 4O0AA 5IYDG 1AZQA 5D65A 4HIMA 3CCJA 1RHPA 3FEWX 3EQLC 4NKLA 4XYQA 4UP7A 2VQFQ 1RKNA 3M4PA 1ZKOA 4A3EH 1IKMA 2JK8A 1H9SB 1NCVA 2YTXA 3H0GB 3NBHA 1D2BA 4DR3L 4BA1I 2NYZD 1M90C 4A3BB 4RGTA 4ULLA 3PUYA 2BA1A 1S5DD 4X65Q 1U0LA 4IPGA 3EFXD 3JAMi 1LYLA 5M5YB 2EE1A 1VMPA 5ELNA 4ZUJA 2AQ2B 2M2LA 2ZM6L 3I3CA 5CV9A 1G6ZA 1U4MA 3NSWA 2XIWA 5C0XG 4DAPA 1VQCA 2OXPA 1EWCA 4HIDA 1EYAA 1R9TH 4GLAC 1SNDA 1HCZA 1EL0A 4OO1H 1WCMH 4K0KL 4GNXB 3TZDA 4BBRH 3PIPA 4OGQC 3K59A 3I4MG 3D6WA 1VQOA 1CUKA 2R6GA 3J80c 4HCEA 1YJNA 1A15A 3I8ZA 2Q8IB 1K8GA 2MP1A 5CBEE 3HOXG 4WJ3M 3CC7A 1TS2A 3PO2B 4A3FG 4K5VA 1BNZA 1WTPA 1K73C 1PH8A 2UXCQ 1QILA 1HJPA 2R92G 5IGBA 4A3CH 1ESFA 4HAEA 3ICEA 3L7ZC 4IFDI 5C6AA 4KJNA 2ZJPA 2F0TA 1E2VA 2N88A 3L9AX 1G51A 1HXYD 2JE6I 1SROA 2EYHA 4YCVA 1A3TA 3NPPA 4C3HB 4RCOA 1RCVD 2J4XA 4A93B 1DXMA 3JAMc 2VUMB 5FLMG 2DUDA 2EYLA 3P75A 4LF4Q 3HOXB 3GTMB 2OCEA 5BN3A 1VQGA 4GKJL 1TT2A 2NUCA 2QF7A 4ABNA 5IY0A 5DNFA 4DGZA 2VW9A 5T1GA 1PYWD 1SMYC 4R4TA 1LM0A 2A69D 2KCTA 5FLXE 4A3BH 1A0IA 3PUXA 1QUQB 4IOAA 1CA5A 2R7FA 4JI1Q 1CKOA 3E0JA 3UI2A 2KHSA 4G57A 1XYIA 1KC8C 4AIMA 2A8VA 3KLSA 4QQBX 4A3LH 2UXBL 3NELA 3A74A 3BJUA 4YIJA 2C5CA 4MTNA 4R8IA 1IXRA 1DJRD 2CWPA 3RZOH 1STYA 2V4DA 2F0WA 1QVCA 2F4VQ 1EQQA 4DAYB 4U68A 2KCMA 4JG2A 2VS1A 1EOVA 2GVBA 3IL8A 1CA6A 2UUCL 2FINB 2EOTA 4E6IA 4GLXA 1WFQA 3R3OA 2CW0C 1LTID 5D3IB 1EIHA 4R4OA 1WCMG 4BY1B 1E2WA 5J22A 4JBJA 2L0CA 1NJIC 5I9OA 1GVPA 2C9OA 4A3GB 5KEEA 3G4SA 3PMFA 1XX8A 1Y1VH 1E7ZA 3GTQB 1E1TA 3FKIH 3D0FA 3CCQA 4CBVA 1K8AC 1PTOC 4AYBG 4ZKBB 1EY9A 2JA6B 3QO2A 1DGSA 2RSOA 2EY6A 1IBML 1STNA 2R92H 2IX0A 5COYA 1C0AA 2JA7G 2UU9L 4FF2A 5FLXc 3FHWA 4UHVA 1EQTA 5IT9L 2AUKA 1X3GA 5C0XI 3HOZH 3VR5A 1HNZQ 4LF4L 4BA2I 4JI4L 1Q12A 1UE5A 3S24A 2D62A 4MN3A 1TWCB 3EJIA 5GAEC 4DR1Q 1KD1C 5M3FH 1FGUA 2JQOA 1PFBA 1AH9A 1PTOD 4LF7Q 1IYJB 3PCOB 4DAVA 1WTWA 1WD0A 4K8JA 1H95A 2FJ2A 1IBMQ 1TVXA 1SYDA 1V1QA 5I4DA 1K3RA 1TWAH 2F0KA 3E6ZX 4A93H 3K7UC 4RA8A 1SE4A 3HGBA 4ME3A 1V1PA 1ENCA 2HUGA 4G7OC 2ATWA 4X64Q 3S15H 4ZYSA 3M4OH 1JE5A 3K5LA 5JVH3 4DR4L 4X3TA 2F0VA 1E22A 1ENAA 1KDAA 3KF8A 4KN7C 4LF7L 1OXXK 3UDGA 2QILA 1QWYA 1I94L 3BG3A 4RFBA 3A7AB 4GN3B 4QMGA 2VXWA 1ICFB 3DWAA 1SE2A 2ES2A 3NBHB 4DV4Q 2NZOA 3BDLA 1L1OB 4DV3L 4JV5Q 5DM73 3FMCA 4JI0Q 4ILWA 4N9PA 3PO3H 1NNXA 4XT3B 1Q46A 3GO5A 4A3JB 3H6MA 3JAME 3F8TA 2OWOA 4WRDA 3TREA 3FPPA 1I4GA 1QE6A 3SK8A 2LXJA 5NUCA 4AH6A 5IYCH 1WJJA 1XNQQ 2A1AA 3T16A 2EYMA 3DEOA 4CJ0B 4DNIA 4PZ6A 5C4JH 4KHZA 1I6HB 1U5KA 2RA4A 2D0OA 4FO2A 1L0XB 5JPMC 1IBLQ 3S14B 4JCVE 2OEOA 5LMNW 2OTJA 2UUAL 1JICA 3E3XA 2NN6H 3ULJA 5C3XA 5FO9B 1B3AA 1XTCD 5CC4A 2SNSA 1SLJA 1YBYA 1K8OA 1W2BA 4RHRA 4H44C 1Q8KA 2HCIA 2K14A 4Q5VA 3AEVA 5JEAH 2EJMA 4L8JA 5G3LD 1HQRD 1MI2A 1E0BA 4A3KG 3M4OB 3I55A 1S5FD 4A93G 3ND9A 4EQNA 2R61A 1OXUA 3I4OA 1A8VA 4CKBA 3HOWH 1Y1WH 2I5LX 2DJFC 1CSPA 1G6PA 1LT4D 2K5DA 2CHBD 4DK6C 4K5XA 4G4KA 3NP8A 2MO0A 5M3FB 1UAPA 3A55A 4LFCL 4DU9A 4JV5L 5E7NA 2OQ0A 1F9QA 2L15A 3I4LA 3W5OA 5CGKA 3BZKA 5C4ZA 2F0QA 3MA2B 3KLWA 3CRKC 1HNXQ 1ET6A 3J80L 2I07B 1NSNS 2X69A 3HP3A 1KDBA 2D9UA 2ZJRA 4LF6L 1P16A 4ZRZA 1SMYD 2EYPA 1L2FA 5M5XH 2K03A 1O7LA 2PYKA 3HEJA 4IJLA 2AKWB 4B3RQ 1WTHA 4HSVA 1GO3E 5IE8A 4LAAA 4DAYA 5I2YA 1Q90A 1TIID 5K5PA 1BDOA 1KLUD 5C3WA 3R93A 1BF4A 1YZ6A 1CFMA 3PIP3 3JAML 2MJ8A 4F88A 1SXTA 3A5UA 2AHOB 4DR3Q 2UUCQ 1JWMD 2PI2E 3K5MA 3CXCA 1Z47A 1KAWA 3HKZB 4KKUA 5FK9C 4KMUC 1YJ9A 3J7AF 1X56A 1RTOA 2WAQB 5FJ8G 5EPLA 1MHWC 5FO8B 2MFIA 4X3SA 2R93G 3MXUA 1EQVA 1LT6D 4LF5Q 1I3QH 3S14H 1B7YB 5IIFA 4DK3C 1FNVA 5E4XA 3SGIA 4C56C 1B70B 4JI6L 2M9VA 5JAVA 2EZVA 5BR8Q 2A69C 4XYOA 3F2CA 3K80C 2IHEA 2RF4A 2A6ED 2UXBQ 3K7AB 1Z9FA 1EEID 4B9WA 4HIOA 3T1YL 3HOWG 4BY7H 3MVVA 4JI4Q 3M3YH 1DONA 4R4QA 4H0LC 4OO1I 2L5TA 4XQJA 2K04A 1TWAB 3S1RB 2IY5B 1N32Q 4GNXA 2HIXA 1TY0A 4P72A 3HOXH 1B1ZA 4LF5L 1Q81C 2ASBA 3PO3B 1C4QA 2ZJQA 2JA8B 5CORA 2XGTA 3A0JA 1HZ9A 4OEMB 1QVFA 3KBGA 2D0PA 2B8GA 4DUYQ 4UP8A 4I65A 5BR8L 4C3HH 5K36G 1E3PA 3PUZA 1TXYA 2SOBA 1LT5D 4BXXG 2SNMA 5IGCA 1EY4A 1B8AA 2MGSA 3P1HA 4LW1A 4B3ML 1IKLA 3K8AA 4R4CA 2AUJD 3A5ZB 2F4IA 4KY7A 3ZJYC 1GUOA 2B63H 3PO2H 2Y0SE 2F03A 2MPMA 3N52A 5C44G 4OWWB 3TDQA 4G7ZC 1I94Q 2PMZE 2B2UC 4JI1L 4N9TA 3S15B 1M8AA 1VQKA 4I7ZC 4DK1A 1Y1WB 2ZXOA 4P73A 1BOSA 1PMRA 4IUVA 2PNHA 4X3UA 2QDLA 2C35B 1UUPA 4X6AH 3I90A 1KXLA 1PRTF 2JA8G 1SSOA 3NQTA 2J7ZA 2YTYA 2CCZA 4DV0L 3S9WA 5JEAJ 4WORA 1G91A 4POFA 1I4PA 2R93H 5JOBA 3RZOB 2K6AA 4L63B 3WOFA 3CMEA 2L11A 3NWTA 4IZ8A 2JA5G 1ZYRC 2B2TA 2G9HD 4FNFA 4DV5L 4DR7Q 1XNQL 2E74C 2XTIA 2D2CC 2BCOA 4DR2L 1KLGD 3H0GG 4LUOA 1LTGD 1I6HH 1IHZA 2Z0SA 1B9MA 2KHIA 2LMCB 4IUPA 2Q2TA 2K28A 5FLXL 3OHXC 2VQEQ 2F0EA 1B9NA 1LTAD 1B4OA 1F9SA 2AQ1B 2JEBI 4IQZA 2UUAQ 4LF8L 1K9MC 3GTQH 2HDMA 5LL6S 1AE3A 3TZUA 2R93B 4H13C 4DAMA 5I6WA 4DUYL 2Y0SG 3SEBA 2KA7A 5GROA 3I4NB 4JOIC 1KNAA 4DF7A 2EYOA 3CQZB 1S5ED 1I4HA 2QEXA 4PG3A 2NVTH 1KDCA 1XWEA 4IUTA 4DR2Q 1VQ9A 1HTPA 2CQAA 4IALA 2ZXPA 2MHVA 4RMFA 2JJQA 4QCLA 1FYCA 1EYGA 1W3SA 3KLRA 4DR1L 1UEBA 3GTJH 2BE5C 4KKSA 1V43A 4JPBW 2A74C 3R2TA 1RIPA 1MKHA 1SEBD 1H9RA 1YNND 3KF6A 5EKKA 1WTRA 3I4NG 5IP9G 1YVCA 5IT9c 1OXTA 1HA6A 3KF6B 4DV1Q 4NXMQ 4LUVA 2ZT9C 1SMXA 4YHHL 4ALPA 1LTRD 1UE6A 4A3JG 1NUCA 2CQOA 4DXFA 3CD6A 2LXKA 2YV5A 3V05A 4BBRB 1FJGL 2PO4A 4GKKL 1ENFA 1MSHA 4JC0A 2QW7A 2JA8H 3KLSX 1IL2A 3Q6SA 1QOHA 1AZPA 1HR0Q 1JORA 4C1NK 4LK1C 2ENBA 5KNBA 2K5VA 4QY7A 1OXSC 2N3SA 2NBFA 2MO1A 2ZM6Q 4C3JH 2VUMH 3EN2A 1T5XD 4MIUA 2VB3X 3GQBA 1TWCH 3TP6A 2JXMB 4JI7Q 3M3YB 2A6HC 4BY7B 4OL7A 2K4KA 3MFYA 4OONA 1PA6A 5EQ0A 3PIO3 1JOKA 1VF5C 4APVA 3H91A 1U4LA 1KRTA 3OPOA 3QOJA 3CCSA 5JVG3 2KUMA 3F1ZA 3BYTB 2L9HA 3S17B 5DLQE 3W3AA 3AQQA 4JBMA 4EGVA 3TMEA 3H3VC 1G8ZD 5IYBH 1SE3A 3AFPA 2UXCL 3CCLA 2XN9C 1HR0W 3FKIB 4K8IA 1Y1VB 4JVZA 3MEFA 1Q7YC 4JI8Q 4UP9A 4WJWA 4Y52H 3A54A 2F3IA 1EIGA 2Q2UA 1XPUA 1D5ZC 3KYHC 5BN5A 4JI6Q 3TP5A 1X6OA 3MWYW 1IW7D 1MSGA 2NVTB 1CZGA 1BUVT 1ESRA 3NUCA 2F0GA 2F0JA 2TMPA 4YY3L 5DEHA 5CV6A 2E2IH 3NTKA 1Y69U 5M5YH 1EZ6A 3M9BA 4YHHQ 4A3IG 1X32A 4QB4A 1N32L 4GOPB 3SK6A 2MUYA 1HA5A 3MXNB 2K5WA 2Q2HA 4QL5A 1ZEQX 5CV7A 2LKVA 4A3EB 1SNOA 4LF9Q 1B53A 4N8FA 3J80E 4K5WA 2PQAB 1VQ4A 1EIFA 4KD3A 3NQIA 5JJKA 2KQ3A 4OELB 1Y1WG 3J81E 3LWEA 1SYBA 4EQOA 4OIJA 3M4QA 2K50A 2NVYH 3RD4A 5CV5A 3NENA 1EYCA 3HRZC 1Y8PB 4IJHA 4P2CB 4XXEA 4AYBE 1SBBB 5IGFA 3GTMH 4B3TL 1CZWA 2QDBA 1NTGA 1FD7D 2EQSA 2PCFB 3K58A 5HGTA 1PH9A 1K83B 1GUTA 4QIWE 1TWHB 4R4IA 2F0HA 3T1YQ 1VQAA 2RKSA 3NHHA 4DV7Q 1X3QA 5C3EG 1HFGA 4B3SL 1N36L 1V9PA 1YHQA 4OWTB 1LACA 1SNQA 1KNEA 1SNCA 1L0YB 2B2WC 3J7AV 4PMBA 2KEDA 2VY3A 1MIUA 1KAAA 4IPHA 2B63B 3I4MB 1E24A 4OXPA 1VQEA 3K0XA 3KBXA 3FPUB 1EY6A 3S2DH 5E4WC 1YNJD 3TEHB 3K5NA 2NTTA 1WCMB 3VR2A 3T4AC 2K5NA 2F0FA 1LTTD 3BZDB 4BBSG 4F8MA 4JI3L 1PYBA 4B3SQ 4KHPL 3D6CA 3I72A 2DNCA 1QUQA 1A3UA 3BZCA 1IYVA 4HN7A 4HEDA 2JA6G 4G7HC 4R9WA 2WV6D 5ELCA 1FR3A 1DD2A 3HS0C 4LF8Q 2I5MX 2RCFA 3OIPA 4GS3A 2H5XA 5A2QE 4ME5A 2WAQG 3ND8A 3H0GH 2B8FA 1WTQA 1EY5A 1T5EA 3OW7A 1X3PA 4JI3Q 4MNOA 3DUZA 4DK0A 3QOLA 5A2QL 1GXDC 4CDFC 2I5HA 2F1MA 3VYRA 3K57A 5KIXA 4HCSA 1VQDA 1BR9A 1EY7A 5IYDH 4UDUC 1KTKA 4L5TA 3U58A 4J15A 1CI3M 3SK4A 3Q22A 1IYUA 3GP7A 1VQ6A 1I5FA 4GOPC 4DUZL 3GV3A 3J81L 2ICIA 4A3EG 2AWOA 3RZDB 3CMAA 2BH2A 1A3VA 4ID6A 5J39A 1NMGA 2B2YA 2NWGA 4B08A 3G6EA 5EBCA 1BCPB 3G7LA 1F2ZA 1F77A 3R2IA 3UE1A 3VYUA 5ELFA 3M7GA 5M5WH 1CQVA 3GTLH 3AMUA 3J81i 2Z6BA 3S16H 4BS9A 3K6OA 2HCCA 1XTDA 5JEAG 3RUZA 1XJVA 1VQLA 4FYDA 2O5IC 2E2HB 4X62Q 2NVXH 4KHVA 1PLFA 4JI7L 3BVMA 2RHQB 1PFMA 3M7NA 1SJHD 2Z6KC 2J0TD 3FVQA 3T53B 1K3BC 3D31A 1SYCA 1QNKA 4LJZC 2MNAA 3NTIA 4M8AA 3IFDA 5DAUA 5G3LF 1NY4A 4C2MH 1EU4A 4N8X1 2JA6H 3T1HL 2VQFL 4DV5Q 3W1BA 1OTCA 1IBKQ 3KJPA 2JYOA 4K6LA 1ONLA 3A8JE 2B2VA 3VA7A 5C44B 1VQIA 4A3MG 3E9HA 4X62L 5ELOA 4WFN3 1VQ8A 3MZ5A 1D1IA 1NMFA 4XT1B 2JA7H 4DV6L 4X65L 1EUJA 2IWHA 2A5HA 2AMCB 3WWVA 5C3EB 3I7FA 4NPSA 1VQJA 2RDHA 3NWSA 5AFWA 3ERQA 5JJLA 2HHHL 3VYTA 2D5DA 4P74A 4JI5L 1K8MA 3LWUA 2IHFA 1S4ZA 2E76C 1VDZA 5LMUQ 5KNDA 3MXNA 2TSSA 1BBXC 5M3MH 1FVIA 5HGQA 2EYFA 2X6LA 3CKIB 1F2YA 1GHKA 3DMUA 3FP9A 2WAQE 5CBAE 3A7LA 2ZXRA 1K0RA 2WACA 2Z9HA 1QNUA 1DOKA 2A6HD 1V1OA 2ICEC 2LSSA 2DJGC 3SK5A 4GLVB 1Y14B 4RH6A 2PMZB 3ULPA 5ISRA 3GTOH 1T9HA 1BO0A 2WKDA 2FFKB 4RGNA 4JK1C 1HZCA 1I50H 1RD9D 3ER0A 5ELEA 3SHLA 2BOSA 4BY1G 5IGGA 1C8CA 3Q23A 1JCKB 1N9WA 1S5CD 1MBYA 3Q8DA 5IP7H 2JA9A 4B3RL 3F2UA 1F2MA 2ID0A 3CU7A 4AQYQ 1RTNA 4DFAA 1L0WA 1EIYB 4GN5A 1D5MC 2I0QA 1D1KA 4RKLA 1KL9A 2KENA 1BBUA 2IPKD 4ZK9B 1SYFA 1EFWA 1JB3A 1IZ6A 1LO5D 2H4OA 1FNUA 2PQEA 2OQKA 2JP1A 2O5JC 3NE5B 3N6RA 2DN8A 4K14A 3J7ZC 3HG9A 4YWMA 3CC2A 4A76A 1SN8A 4HJ9A 4ZAIA 2LS01 1HUNA 2B2WA 1CTMA 1M1KC 4DV7L 5JJZA 2PQAA 4LFCQ 3DXJC 3RN5A 2OTLA 4V190 2Q8TA 3KUPA 2IW3A 2NN6I 4H02A 3V96A 4B9XA 1JE4A 3HOVB 3UE0A 2EY1A 5IYCG 4CJ2C 1CQFA 3HOYH 2Y0SB 5E1FA 4JI5Q 1XNRQ 1GHJA 2A68D 4C3IG 4KTAA 4PZ7A 1GUGA 4NW2A 4JI2L 3BS1A 4LFBL 2BDNA 1XMOQ 2B2VC 5M9OA 3CF5A 2JA5B 5GAGC 2A6EC 2NN6G 3KJOA 2F0DA 3TS2A 4J6HA 5EGTA 1Q8IA 2XVSA 3EIVA 4H7BA 4CDCC 4KD4A 2IL8A 4CGYB 1PH4A 4IFDJ 3S1QH 4ZQ3A 4PMWA 4A3FH 1FL0A 1FGBD 5EAYA 1PTOH 3W2DA 3GV6A 1VQFA 2LY7A 1QB5D 1KABA 1OO9B 3H3VI 3QR8A 1YNXA 3MFGA 3TQYA 1E1OA 1GD7A 1Y8OB 4BBRG 5GQOA 2B3GA 2XWJB 2SDFA 1PTOB 3D3RA 2NTSA 4X66Q 2NVXB 1DOMA 2NB0A 1SFOH 2AQ3B 2F0SA 1PH3A 1JJCB 2KHJA 1VQNA 1PDQA 2WB1E 3DLLA 1EY8A 1PRTB 3BU2A 5HY6A 1NE3A 5IWAQ 2FXQA 1KIXA 4R8NA 1PZJD 1LABA 2BE5D 3TBIB 2B2YC 2G5DA 3TRZA 2QGQA 4A75A 1U4RA 5C4XB 3C1EA 3SXHA 1V8QA 2MQHA 1VQMA 1WTVA 4A3DG 2O4XA 2QKIC 3GD7A 3GTPH 1E2ZA 3IKJA 1PRTC 1JT8A 4LFAQ 4OHJA 2E2DC 4A4IA 4F7XA 3RZDH 2WP8J 1CM9A 1STGA 3DWPA 5CR3A 2YU9H 1MJCA 4L6TB 2AWNA 1X55A 2SEBD 4X66L 1HHVA 3GTGH 3ZYYX 5ELDA 2HD3A 5J3BA 1SYGA 4HJ7A 3QJYA 1B3QA 2E5LQ 1CSQA 2WIIB 4YCWA 1YHAA 1TWGB 3RMHA 4XTCS 1HRJA 2B29A 2EDGA 1STEA 3M4YA 4QGUA 4DV2Q 1VQPA 4A3BG 2EXDA 2PZWA 2K75A 1F9RA 3VA5A 3TS0A 1Z6HA 3LX0A 4U673 3K81C 2IJ0A 1XMQL 4GNXC 1X54A 3HOUB 1OXVA 3CPWA 3KF8B 4ODGA 3OYYA 5C5MA 1PV4A 4L5RC 4DA2A 1EYDA 1STAA 2R3ZA 5IGDA 4DV4L 2Z6KA 2RHSB 2EYJA 2KBNA 3STBC 3CP0A 4ZKCB 4DV2L 1WVLA 2R7ZG 3V2TA 4KHPQ 3Q0AA 1A2UA 4IN3A 2E2JH 4YWLA 1EQRA 4EVOA 3S1MH 1H9SA 1UNSA 5J1ZA 1QVGA 5CMDA 3M85A 3HOZG 1KHIA 1TR5A 4BY7G 4QF4A 3OOCA 4R1JA 2HDLA 3PV0A 2JSOA 1NR2A 1LUZA 2DY7A 4HR7B 2B2UA 1LLRD 3PF5A 2EY2A 1NAPA 2KECA 3CCVA 4MTKA 5IWAL 3S2HH 4DR7L 4KY5A 1H9MA 5FLMH 1YI2A 1STHA 1XPOA 3S2DB 5I6YA 4NXML 5JJIA 4A3MB 4DV3Q 1HQMC 3NK9A 4LWCA 3RR5A 1ZYRD 3SE0A 3TP7A 3U9OA 3URYA 1RL2A 5CYUA 1R9TB 5LL6X 1RDPD 4IFDG 1N8RC 2RCNA 1NR4A 3DEPA 4RGOS 1I4QA 1EOTA 1BCPC 4UY8C 4HSPA 4JYAL 4A3KB 1K28A 4TQUS 3GTKH 4OX9Q 1VQHA 3L0OA 1HZBA 3H94A 1VMCA 4HMIA 4AQYL 3GDEA 5FJ8H 4FDBA 1VQ7A 2IX1A 2R7ZB 1U9RA 5EBDA 1Q82C 4K0KQ 3DWQA 2Q8RE 4DN4M 1VQBA 4DV6Q 1XMQQ 4A3IB 1IBLL 1EY0A 4C2MB 1A63A 2CH4W 5E3FA 4EX5A 3JC66 1AN8A 2N55A 3HOUG 2JN4A 3VR3A 2PW5A 4MHEA 4KI0A 3VDYA 2M00A 3NXWA 1ICWA 1D8LA 3AFQA 1GUNA 2L55A 1ILPA 2Z8LA 2F0NA 1Y1VG 1ZXTA 3UDXA 3GTLB 1CK1A 1MJEA 5M5WB 2EXZA 2FMMA 3WOEA 3STBD 3R8BA 4O2DA 4FF4A 2PZTA 1I4RA 2KCCA 5KYIA 1TWFH 4K2KA 5CV4A 4GKJQ 5D14A 1TS5A 1HR0L 5FOBB 1BXTA 5HURA 2UUBQ 4FXDA 3QIAA 3C1FA 3T1HQ 1TWFB 4XQQA 5K36H 1PYSB 3BVZA 4ZCKA 3I91A 3J7A5 2K05A 4RCNA 3FRPB 2A73B 1AE2A 1SR3A 3MAQA 1AEXA 5C4XG 2RQXA 3QG1A 2F3WA 2LFNA 3BDCA 1A6XA 3EROA 5BN4A 3NEMA 3MEHA 3J80i 2F3VA 2NVQB 2HQLA 4HJ8A 1CHPD 4BBSB 3RLOA 3S17H 3PF4A 3MXPA 2GA4B 4HTHA 1CKNB 5C0XH 2F0UA 4Y7NH 1YITA 5T1IA 3KOJA 1YJWA 1WYDA 4UPAA 3KK7A 4KY6A 4J1MA 5EJWA 5L37A 3ONAB 3U50C 4HIKA 1BBWA 3OWEB 5M3MG 1PH5A 4DXGA 3OMCA 2K1BA 1M4VA 4PMCA 1ASZA 3NBIA 4C3JB 3SVMA 4YCUA 4A3KH 2A19A 1MGSA 4P75A 3A56A 2UXDL 1QZHA 1EWIA 3RLNA 4P71A 2JA5H 3W1GA 1CT1D 4CKCA 5DM63 3OIQA 4LMQD 2A68C 3K5OA 2R7DA 3CRLC 3L3OC 4PQXA 1D6EC 4Y7NB 5FKAC 4CJ1B 2WKCA 3EA6A 3PIOA 2XRQD 4HJ5A 5C0XJ 2N8NA 4TSSA 2E8GA 5FO7B 4XIGS 2PW7A 2K7VA 3HOVH 4LF9L 3S2HB 3I2ZA 4RWSC 3S1NH 1HH2P 2F0IA 2UUBL 1TWGH 1XXGA 5KYLA 4KLKA 5LHY1 1Q1BA 3C46A 5LMNQ 4DR5Q 3F2DA 1IL8A 1JMCA 1AW7A 2IX3A 3H3VH 1GJXA 3FDTA 5IGEA 4FVMA 2G9DA 4PV1C 1HPCA 3H15A 1TS3A 1YHBA 2RVLA 1O80A 1TWHH 1A62A 2RDGA 4GZYC 5IT9E 4A3LG 4NXNL 1BCPD 4Z9CB 3U4VA 4C1NI 5C4XH 1A2TA 1QZGA 2KCNA 2K5HA 3VYSA 3KDFA 3CQZH 1VS0A 4PNYA 2VB2X 5LMNL 4DR5L 1LV9A 1SFOB 3IRBA 1X65A 1CHQD 1ML0D 1Y8NB 3OW2A 2P5ZX 1B2TA 4A3GG 4C3IH 4KJOA 1G2SA 1O7IA 1JQYD 1I50B 3I56A 4A3DB 2RSNA 4O42A 2QCPX 1DM0B 1RODA 4NXNQ 3GTOB 4FXGC 2N49A 4A3IH 2UXDQ 2HIVA 2O2LD 5IP9H 4POGA 1BQQT 2R7ZH 2BA0A 5GAHC 3I73A 3CHBD 3AU7A 4RG1A 2YU9B 2BDOA 4JW0A 1G2TA 1AP0A 2E2IB 2WB1B 3VR4A 1N33L 1EEFD 3E5SA 4RHSA 3GTKB 4C3HG 4X3KA 4WJ4A 3E9IA 3L2PA 5EPKA 1WOCA 3ITPA 4BXXH 1I6VC 3HKZG 4S3SA 1X3EA 2HT1A 1C48A 2XSCA 3EBEA 3P20A 4TVAB 2XWBB 4AYBB 2Z4IA 3OSOA 3CCMA 1NBWA 5M3FG 1UEAB 1UWVA 1S40A 3X3NA 5I9PA 4TKOB 4A3MH 3BYYB 4KV6A 1WTOA 3HOYB 3U4ZA 4IO9A 4HJAA 2ZTEA 5CV8A 2GN5A 3OTOL 1GUSA 3T13A 4BWGB 3AB9A 4C3IB 4DV1L 2FMCA 3S1MB 3G6JB 3PUVA 1JB7A 4XDXA 1HTLD 3NTHA 3TN2A 2HQEA 2PPBC 4TRDA 4DUZQ 3OWFA 1SAPA 1VF7A 2KEEA 3G71A 2F52A 4QIWB 1HUMA 4KN4C 1PFSA 1ET9A 1SYEA 2CVRA 2EIFA 1SE8A 1PZKD 4UAIA 2F0LA 4DKAC 3K0YA 4JYAQ 1HNWL 2K01A 3K7AH 3HOUH 4Q0FA 3PUWA 3O13A 2CWAA 2DGYA 5IP7G 4IUQA 1PH2A 1PZID 3PO3G 1PHJA 2L12A 3X3MA 3TSSA 3S1NB 4ZLTF 5EKLA 4QUFA 4JBKA 4LF6Q 1I3QB 1JOOA 1R4PB 2F0MA 1PVOA 4GKKQ 1BKBA 1SRUA 1MD2D 3MTSA 5TSSA 3D4DA 3GTGB 3VR6A 3DM1A 1JJ2A 5GADC 4CHTB 4KKTA 4OIKA 1Z7TA 5EPJA 4DR6L 1VQ5A 1IBKL 4EQPA 4JI8L
chains in the Genus database with same CATH topology
3T51B 5C4HA 2OF1A 5KGUA 3LNNA 3MC0B 2KVMA 2K32A 1U4PA 4KK7A 3MXGA 4RGMA 2EJGC 1I4XA 1LTBD 1SDFA 2CW0D 4NMZA 5I2XA 1BCPF 3SDZA 4IFDH 3P7JA 1JWUD 4IUUA 1LTSD 1VCIA 3TP8A 2DNEA 1Q1EA 1DYQA 1QJOA 3BDOA 2L4NA 4A3FB 5M3MB 3S1QB 1B50A 5KRUA 1S5BD 4FP5D 2VNUD 4RAUC 4V0BA 1EWHA 4IURA 4FF1A 5IODA 2XRSD 3QB3A 2WINB 1IW7C 1ILQA 3BVGA 2JA7B 1O7ZA 3D8GA 4DNTB 2I46A 4C3JG 2H1EA 1QG7A 1F2LA 1TU2B 2NVYB 2K5QA 4K2LA 1W6KA 3MHBA 1DOLA 1PTOF 1SNMA 2EPBA 4O1NA 2X6GA 2FHTA 1YNJC 4CKEA 1YNNC 2L1BA 1WD1A 1R4QB 4ZUIA 1EZ8A 2EVBA 1AFPA 2OT2A 3C2PA 5C4JB 1SNPA 2QEJC 4RKBA 2IT1A 4DNRB 5F2DA 1O7YA 3HZXA 5JPNC 2DY8A 1QCBD 4K6DA 2RBMA 1HFNA 1EU3A 2B39A 2Z1CA 4HMJA 5C5LA 1G291 2XNAC 1Q3LA 2RDFA 3SR1A 4JBWA 2E75C 1DZ1A 3T56B 4F87A 1GOZA 2F0OA 1B44D 1JR0D 3A8KE 3U9SA 3DHQA 3Q24A 4IUNA 2KOLA 1O78A 1TKWB 2PZUA 1W6JA 5A35A 1D5XC 3WDNA 4NDXA 2JEAI 1H9KA 2E2JB 3H09A 1JOQA 1PXUA 1RJTA 2F0PA 5D3DA 3IFTA 2YYZA 1PRTD 1WTXA 1LT3D 1PFNA 3D4RA 1II3A 3EVQA 2EY5A 3J7YW 2KJXA 1V1PB 5M5XB 1TS4A 3C3LA 4FF3A 1JWSD 1F9PA 4J8QA 1STBA 4OO1G 3HOZB 1J9OA 4FXKC 3A8IE 2Z4HA 5EKIA 1JC7A 3QWNA 1GUWA 3RLFA 2R92B 2B2TC 3S16B 3IAYA 3I70A 4NP5A 1FNWA 2PNRC 1SJED 5ELBA 1EFID 2K33A 1H9JA 4QUCA 1DCZA 3OMGA 5KNCA 4XQNA 3GTJB 3HOWB 3GTPB 1TQOA 1J8IA 2NZ1D 1RF2D 1TY2A 5IOCA 4M1UB 2EJFC 3D4WA 1AZQA 5D65A 1RHPA 3FEWX 3EQLC 4NKLA 4XYQA 1RKNA 1ZKOA 1IKMA 1H9SB 1NCVA 3H0GB 3NBHA 1D2BA 4BA1I 2NYZD 4A3BB 4RGTA 4ULLA 3PUYA 2BA1A 1S5DD 3EFXD 5M5YB 2EE1A 1VMPA 4ZUJA 2AQ2B 2M2LA 3I3CA 5CV9A 1G6ZA 1U4MA 3NSWA 2XIWA 5C0XG 4DAPA 2OXPA 1EWCA 1EYAA 1SNDA 1HCZA 1EL0A 4OO1H 3TZDA 4OGQC 3K59A 3D6WA 2R6GA 4HCEA 1A15A 3I8ZA 2Q8IB 2MP1A 5CBEE 1TS2A 3PO2B 1BNZA 4K5VA 1WTPA 1QILA 5IGBA 1ESFA 4HAEA 3L7ZC 4IFDI 5C6AA 4KJNA 2F0TA 1E2VA 2N88A 3L9AX 1HXYD 2JE6I 2EYHA 1A3TA 3NPPA 4C3HB 4RCOA 1RCVD 2J4XA 4A93B 1DXMA 2VUMB 2EYLA 3P75A 3HOXB 3GTMB 5BN3A 1TT2A 2NUCA 2QF7A 4ABNA 5DNFA 4DGZA 5T1GA 1PYWD 1SMYC 2A69D 5FLXE 3PUXA 1CA5A 3E0JA 3UI2A 2KHSA 4G57A 1XYIA 3KLSA 4YIJA 2C5CA 4R8IA 1DJRD 1STYA 2V4DA 2F0WA 4U68A 3IL8A 1CA6A 2FINB 2EOTA 4E6IA 3R3OA 2CW0C 1LTID 5D3IB 1EIHA 4BY1B 1E2WA 5J22A 2L0CA 5I9OA 4A3GB 2C9OA 5KEEA 3PMFA 1XX8A 3GTQB 4CBVA 1PTOC 4ZKBB 1EY9A 2JA6B 3QO2A 2RSOA 2EY6A 1STNA 2IX0A 5COYA 4FF2A 1EQTA 5IT9L 2AUKA 5C0XI 3VR5A 4BA2I 1Q12A 2D62A 4MN3A 1TWCB 3EJIA 1PFBA 1PTOD 4DAVA 1WTWA 1WD0A 4K8JA 2FJ2A 1TVXA 1SYDA 5I4DA 2F0KA 3E6ZX 4RA8A 1SE4A 3HGBA 1V1PA 1ENCA 2HUGA 4G7OC 4ZYSA 3K5LA 5JVH3 4X3TA 2F0VA 1ENAA 1KDAA 3KF8A 4KN7C 1OXXK 2QILA 1QWYA 3BG3A 4RFBA 3A7AB 4QMGA 2VXWA 3DWAA 1SE2A 3BDLA 5DM73 3FMCA 4ILWA 4N9PA 4XT3B 3GO5A 4A3JB 3H6MA 3JAME 4WRDA 3FPPA 1I4GA 1QE6A 3SK8A 5NUCA 3T16A 2EYMA 3DEOA 4CJ0B 4KHZA 1I6HB 2RA4A 4FO2A 1L0XB 5JPMC 3S14B 2OEOA 1JICA 2NN6H 5C3XA 5FO9B 1B3AA 1XTCD 5CC4A 2SNSA 1K8OA 4RHRA 4H44C 2HCIA 4Q5VA 5JEAH 2EJMA 4L8JA 5G3LD 1HQRD 1MI2A 1E0BA 3M4OB 1S5FD 3ND9A 4EQNA 2R61A 1OXUA 4CKBA 1LT4D 2K5DA 2CHBD 4K5XA 4G4KA 3NP8A 5M3FB 1UAPA 3A55A 4DU9A 1F9QA 5CGKA 3I4LA 5C4ZA 2F0QA 3MA2B 3CRKC 1ET6A 3J80L 2I07B 1NSNS 2X69A 3HP3A 1KDBA 2D9UA 4ZRZA 1SMYD 2EYPA 2K03A 1O7LA 2PYKA 3HEJA 4HSVA 4LAAA 4DAYA 5I2YA 1Q90A 1TIID 5K5PA 1BDOA 1KLUD 5C3WA 3R93A 1BF4A 1CFMA 3PIP3 3JAML 2MJ8A 4F88A 1SXTA 1JWMD 3K5MA 1Z47A 3HKZB 4KKUA 5FK9C 4KMUC 3J7AF 1RTOA 2WAQB 5EPLA 5FO8B 4X3SA 3MXUA 1EQVA 1LT6D 5IIFA 1FNVA 5E4XA 4C56C 2M9VA 5JAVA 2EZVA 2A69C 4XYOA 2A6ED 3K7AB 1EEID 4B9WA 3MVVA 1DONA 4H0LC 4OO1I 2L5TA 4XQJA 2K04A 1TWAB 3S1RB 1TY0A 1B1ZA 3PO3B 1C4QA 2JA8B 5CORA 3KBGA 2B8GA 4I65A 5K36G 3PUZA 2SOBA 1LT5D 2SNMA 5IGCA 1EY4A 2MGSA 3P1HA 1IKLA 2AUJD 2F4IA 4KY7A 1GUOA 2F03A 2MPMA 3N52A 3TDQA 4G7ZC 2B2UC 4N9TA 3S15B 1M8AA 4I7ZC 4DK1A 1Y1WB 2ZXOA 1BOSA 1PMRA 4IUVA 4X3UA 1UUPA 3I90A 1PRTF 1SSOA 3NQTA 2J7ZA 3S9WA 5JEAJ 4WORA 1G91A 1I4PA 5JOBA 3RZOB 2K6AA 4L63B 3WOFA 2L11A 3NWTA 4IZ8A 1ZYRC 2B2TA 2G9HD 4FNFA 2E74C 2D2CC 2BCOA 1KLGD 1LTGD 1IHZA 1B9MA 2LMCB 4IUPA 2K28A 5FLXL 3OHXC 2F0EA 1B9NA 1LTAD 1B4OA 1F9SA 2AQ1B 2JEBI 4IQZA 2HDMA 5LL6S 3TZUA 2R93B 4H13C 5I6WA 3SEBA 2KA7A 3I4NB 1KNAA 4DF7A 2EYOA 3CQZB 1S5ED 1I4HA 1KDCA 1XWEA 4IUTA 1HTPA 2CQAA 4IALA 2ZXPA 2MHVA 4QCLA 1FYCA 3KLRA 2BE5C 4KKSA 1V43A 2A74C 3R2TA 1SEBD 1H9RA 1YNND 5EKKA 1WTRA 1OXTA 1HA6A 2ZT9C 1LTRD 1NUCA 4DXFA 3V05A 4BBRB 2PO4A 1ENFA 1MSHA 3KLSX 3Q6SA 1QOHA 1AZPA 1JORA 4C1NK 4LK1C 2ENBA 5KNBA 1OXSC 2NBFA 1T5XD 4MIUA 2VB3X 3GQBA 3TP6A 2JXMB 3M3YB 2A6HC 4BY7B 4OL7A 3MFYA 5EQ0A 3PIO3 1JOKA 1VF5C 3H91A 1U4LA 3OPOA 3QOJA 5JVG3 2KUMA 3BYTB 2L9HA 3S17B 3W3AA 3H3VC 4EGVA 3TMEA 1G8ZD 1SE3A 2XN9C 3FKIB 4K8IA 1Y1VB 4WJWA 3A54A 1EIGA 1D5ZC 5BN5A 3TP5A 3MWYW 1IW7D 1MSGA 2NVTB 1CZGA 1BUVT 1ESRA 3NUCA 2F0GA 2F0JA 2TMPA 5DEHA 5CV6A 3NTKA 1Y69U 1EZ6A 1X32A 4QB4A 3SK6A 2MUYA 1HA5A 2K5WA 1ZEQX 5CV7A 2LKVA 4A3EB 1SNOA 1B53A 3J80E 4K5WA 4KD3A 3NQIA 2KQ3A 3J81E 3LWEA 1SYBA 4EQOA 4OIJA 3RD4A 5CV5A 1EYCA 3HRZC 1Y8PB 4P2CB 4XXEA 1SBBB 5IGFA 1CZWA 2QDBA 1FD7D 2PCFB 3K58A 5HGTA 1K83B 1GUTA 1TWHB 2F0HA 2RKSA 3NHHA 1X3QA 1HFGA 1LACA 1SNQA 1SNCA 1KNEA 1L0YB 2B2WC 3J7AV 4PMBA 2KEDA 1KAAA 2B63B 3I4MB 3KBXA 3FPUB 1EY6A 5E4WC 1YNJD 3K5NA 2NTTA 1WCMB 3VR2A 3T4AC 2F0FA 1LTTD 3BZDB 4F8MA 3D6CA 3I72A 2DNCA 1A3UA 1IYVA 4HN7A 4HEDA 4G7HC 4R9WA 2WV6D 5ELCA 1FR3A 1DD2A 3HS0C 3OIPA 5A2QE 4ME5A 3ND8A 2B8FA 1WTQA 1EY5A 1T5EA 3OW7A 1X3PA 3DUZA 4DK0A 3QOLA 5A2QL 1GXDC 2F1MA 3VYRA 3K57A 5KIXA 4HCSA 1BR9A 1EY7A 4UDUC 1KTKA 1CI3M 3SK4A 3Q22A 1IYUA 3GP7A 3GV3A 3J81L 2ICIA 2AWOA 3RZDB 1A3VA 4ID6A 5J39A 2B2YA 2NWGA 4B08A 5EBCA 1BCPB 3G7LA 1F2ZA 1F77A 3R2IA 3VYUA 5ELFA 3M7GA 1CQVA 3AMUA 4BS9A 3K6OA 2HCCA 5JEAG 3RUZA 4FYDA 2O5IC 2E2HB 4KHVA 1PLFA 3BVMA 1PFMA 3M7NA 1SJHD 2J0TD 3FVQA 3T53B 3D31A 1SYCA 1QNKA 4LJZC 3NTIA 4M8AA 3IFDA 5DAUA 5G3LF 1EU4A 2JYOA 4K6LA 1ONLA 3A8JE 2B2VA 3VA7A 5C44B 4WFN3 3MZ5A 1D1IA 4XT1B 2IWHA 2A5HA 5C3EB 2RDHA 5AFWA 3NWSA 3ERQA 3VYTA 2D5DA 1K8MA 3LWUA 1S4ZA 2E76C 1VDZA 5KNDA 3MXNA 2TSSA 1BBXC 2EYFA 2X6LA 3CKIB 1F2YA 1GHKA 3DMUA 5CBAE 3A7LA 2ZXRA 2WACA 1QNUA 1DOKA 2A6HD 1V1OA 2ICEC 3SK5A 4RH6A 2PMZB 5ISRA 1BO0A 2WKDA 2FFKB 4RGNA 4JK1C 1RD9D 5ELEA 3SHLA 2BOSA 5IGGA 1C8CA 3Q23A 1JCKB 1S5CD 1MBYA 3F2UA 1F2MA 2ID0A 3CU7A 1RTNA 4DFAA 1D5MC 1D1KA 4RKLA 2IPKD 4ZK9B 1SYFA 1JB3A 1LO5D 2H4OA 1FNUA 2PQEA 2O5JC 2JP1A 3NE5B 3N6RA 2DN8A 4K14A 3HG9A 4ZAIA 2LS01 1HUNA 2B2WA 1CTMA 5JJZA 3DXJC 4V190 2Q8TA 3KUPA 2IW3A 2NN6I 3V96A 4B9XA 1JE4A 3HOVB 2EY1A 4CJ2C 1CQFA 2Y0SB 5E1FA 1GHJA 2A68D 4C3IG 4KTAA 1GUGA 4NW2A 3BS1A 2BDNA 2B2VC 5M9OA 2JA5B 2A6EC 2NN6G 2F0DA 4J6HA 5EGTA 1Q8IA 2XVSA 4H7BA 4KD4A 2IL8A 4CGYB 4IFDJ 4ZQ3A 4PMWA 1FGBD 1PTOH 3W2DA 3GV6A 2LY7A 1QB5D 1KABA 1OO9B 3MFGA 1Y8OB 2XWJB 2SDFA 1PTOB 3D3RA 2NTSA 2NVXB 1DOMA 2NB0A 2AQ3B 2F0SA 1PDQA 1EY8A 1PRTB 4R8NA 3TBIB 1PZJD 1LABA 2BE5D 2B2YC 1U4RA 5C4XB 3C1EA 3SXHA 1V8QA 1WTVA 2O4XA 2QKIC 3GD7A 1E2ZA 3IKJA 1PRTC 4OHJA 2E2DC 4F7XA 2WP8J 1CM9A 1STGA 3DWPA 5CR3A 4L6TB 2AWNA 2SEBD 1HHVA 3ZYYX 5ELDA 1SYGA 3QJYA 2WIIB 1TWGB 3RMHA 4XTCS 1HRJA 2EDGA 1STEA 3M4YA 2PZWA 1F9RA 3VA5A 1Z6HA 3LX0A 4U673 2IJ0A 3HOUB 1OXVA 4ODGA 5C5MA 4DA2A 1EYDA 1STAA 2R3ZA 5IGDA 2EYJA 4ZKCB 1WVLA 3V2TA 3Q0AA 1A2UA 4IN3A 4EVOA 1H9SA 1UNSA 5J1ZA 5CMDA 3M85A 1TR5A 4QF4A 3OOCA 2HDLA 3PV0A 2JSOA 1NR2A 2DY7A 4HR7B 2B2UA 1LLRD 2EY2A 1NAPA 2KECA 4KY5A 1H9MA 1STHA 3S2DB 5I6YA 4A3MB 1HQMC 3NK9A 1ZYRD 3SE0A 3TP7A 3U9OA 3URYA 5CYUA 1R9TB 5LL6X 1RDPD 4IFDG 1NR4A 3DEPA 4RGOS 1I4QA 1EOTA 1BCPC 4HSPA 4A3KB 4TQUS 3H94A 1VMCA 4HMIA 2IX1A 2R7ZB 1U9RA 5EBDA 3DWQA 2Q8RE 4DN4M 4A3IB 1EY0A 4C2MB 5E3FA 1AN8A 2N55A 3VR3A 2PW5A 4MHEA 4KI0A 2M00A 3NXWA 1ICWA 1GUNA 2L55A 1ILPA 2Z8LA 2F0NA 1ZXTA 3GTLB 1CK1A 5M5WB 2EXZA 2FMMA 3WOEA 3R8BA 4FF4A 2PZTA 1I4RA 2KCCA 5KYIA 4K2KA 5CV4A 5D14A 1TS5A 5FOBB 1BXTA 5HURA 4FXDA 3QIAA 3C1FA 1TWFB 4XQQA 5K36H 3BVZA 3I91A 2K05A 4RCNA 3FRPB 2A73B 3MAQA 1AEXA 2RQXA 3QG1A 2F3WA 2LFNA 3BDCA 1A6XA 3EROA 5BN4A 3MEHA 2F3VA 2NVQB 1CHPD 4BBSB 3MXPA 2GA4B 4HTHA 5C0XH 2F0UA 5T1IA 3KK7A 4KY6A 4J1MA 5EJWA 3ONAB 3OWEB 4DXGA 3OMCA 2K1BA 1M4VA 4PMCA 3NBIA 4C3JB 3SVMA 1MGSA 3A56A 1CT1D 4CKCA 5DM63 3OIQA 4LMQD 2A68C 3K5OA 3CRLC 3L3OC 4PQXA 1D6EC 4Y7NB 5FKAC 4CJ1B 2WKCA 3EA6A 2XRQD 5C0XJ 4TSSA 5FO7B 4XIGS 2PW7A 2K7VA 3S2HB 4RWSC 2F0IA 1XXGA 5KYLA 5LHY1 1Q1BA 3C46A 1IL8A 1AW7A 2IX3A 1GJXA 3FDTA 5IGEA 4FVMA 2G9DA 4PV1C 1HPCA 1TS3A 2RVLA 1O80A 2RDGA 4GZYC 5IT9E 1BCPD 4Z9CB 4C1NI 1A2TA 2KCNA 3VYSA 4PNYA 2VB2X 1LV9A 1SFOB 1CHQD 1ML0D 1Y8NB 1B2TA 4KJOA 1G2SA 1JQYD 1I50B 4A3DB 2RSNA 4O42A 2QCPX 1DM0B 1RODA 3GTOB 4FXGC 2O2LD 1BQQT 2BA0A 3I73A 3CHBD 3AU7A 2YU9B 2BDOA 1G2TA 1AP0A 2E2IB 2WB1B 3VR4A 1EEFD 3E5SA 4RHSA 3GTKB 4C3HG 4X3KA 5EPKA 3ITPA 1I6VC 4S3SA 1C48A 2XSCA 3P20A 2XWBB 4AYBB 2Z4IA 3OSOA 1UEAB 3X3NA 5I9PA 4TKOB 3BYYB 4KV6A 1WTOA 3HOYB 5CV8A 1GUSA 3T13A 4BWGB 3AB9A 4C3IB 2FMCA 3S1MB 3G6JB 3PUVA 4XDXA 1HTLD 3NTHA 3TN2A 2HQEA 2PPBC 4TRDA 3OWFA 1SAPA 1VF7A 2KEEA 4QIWB 1HUMA 4KN4C 1ET9A 1SYEA 2CVRA 1PZKD 4UAIA 2F0LA 3K0YA 2K01A 4Q0FA 3PUWA 3O13A 4IUQA 1PZID 2L12A 3X3MA 3TSSA 3S1NB 4ZLTF 5EKLA 4QUFA 1I3QB 1JOOA 1R4PB 2F0MA 1MD2D 3MTSA 5TSSA 3D4DA 3GTGB 3VR6A 3DM1A 4CHTB 4KKTA 4OIKA 1Z7TA 5EPJA 4EQPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MGS A;  2N88 A;  2KED A;  5EPK A;  1O7Y A;  2KUM A;  4ZAI A;  4QUC A;  4MN3 A;  5E4X A;  1HHV A;  2DY8 A;  1PLF A;  2HCI A;  2L9H A;  2Q8R E;  4DN4 M;  3KBX A;  1HUN A;  3FPU B;  1PFM A;  2B2W A;  2KVM A;  1PFB A;  4IUP A;  1U4P A;  1HFN A;  4LMQ D;  2K28 A;  1MI2 A;  5JJZ A;  1E0B A;  5E4W C;  1B4O A;  1WTW A;  1WD0 A;  1J8I A;  1F9S A;  2NZ1 D;  1QNK A;  3KUP A;  2Q8T A;  1Q3L A;  2FJ2 A;  1TVX A;  2HDM A;  1HRJ A;  1SDF A;  4CJ1 B;  1JE4 A;  1DON A;  1WTO A;  3IFD A;  1EIG A;  1F9R A;  3H91 A;  1KNA A;  1DZ1 A;  2K04 A;  4CJ2 C;  2N55 A;  4RA8 A;  1KNE A;  5DNF A;  2JYO A;  4IUT A;  1AZQ A;  4RWS C;  3MWY W;  4HED A;  2B2V A;  2HUG A;  3P7J A;  4MHE A;  5D65 A;  1MSG A;  5T1G A;  1ICW A;  4IUU A;  4R9W A;  1ESR A;  1RHP A;  1ILP A;  4NW2 A;  4XT1 B;  5COR A;  4X3T A;  1ZXT A;  1CA5 A;  1IL8 A;  3SVM A;  2BDN A;  2FMM A;  2B2V C;  2L4N A;  2R3Z A;  3FDT A;  3UI2 A;  1XYI A;  5AFW A;  2KOL A;  1F9Q A;  1X32 A;  4XDX A;  1B50 A;  2RVL A;  1O80 A;  2MGS A;  4ZKC B;  1IKM A;  1WTQ A;  1IKL A;  5D14 A;  1NCV A;  4RAU C;  3TN2 A;  1WVL A;  1WTR A;  1X3P A;  2VXW A;  4IUR A;  1S4Z A;  4R8I A;  1SAP A;  2NYZ D;  1WTV A;  2X69 A;  3HP3 A;  2KEE A;  2IL8 A;  1B53 A;  2D9U A;  1HA6 A;  1BBX C;  1HUM A;  3I91 A;  2X6L A;  4U68 A;  5CMD A;  2MPM A;  1ILQ A;  2K05 A;  2CVR A;  3GV6 A;  3N52 A;  2K03 A;  1G91 A;  1RJT A;  5CBA E;  2EE1 A;  1VMP A;  4UAI A;  2HDL A;  3IL8 A;  4HCS A;  1O7Z A;  1CA6 A;  1DOK A;  1NR2 A;  2FIN B;  2B2U C;  4HSV A;  2DY7 A;  1LV9 A;  2M2L A;  2B2U A;  1G2T A;  2EOT A;  4XT3 B;  1M8A A;  3LWE A;  1NAP A;  2KEC A;  3I3C A;  1G6Z A;  2K01 A;  4OIJ A;  1U4M A;  3R93 A;  1BF4 A;  1ML0 D;  2XIW A;  1B2T A;  1BO0 A;  1EIH A;  2FFK B;  1WTX A;  1PFN A;  1MSH A;  2H1E A;  4IUQ A;  1G2S A;  2SDF A;  4IUV A;  3Q6S A;  1QG7 A;  1F2L A;  2MJ8 A;  2RSN A;  4O42 A;  4X3U A;  1C8C A;  1AZP A;  1EL0 A;  2L12 A;  1QE6 A;  1DOM A;  1ROD A;  3GV3 A;  1XX8 A;  4ZLT F;  3I90 A;  3TZD A;  4QUF A;  1F9P A;  3F2U A;  5T1I A;  1DOL A;  2EPB A;  1SSO A;  1RTN A;  4ZKB B;  1PDQ A;  2J7Z A;  2X6G A;  2FHT A;  3D6W A;  3QO2 A;  3DEO A;  4CJ0 B;  2RSO A;  2B2Y A;  1J9O A;  1A15 A;  1NR4 A;  3I8Z A;  2B2Y C;  1RTO A;  3MTS A;  5EJW A;  2L1B A;  2MP1 A;  2NWG A;  2RA4 A;  1U4R A;  3DEP A;  3ONA B;  5EKI A;  5CBE E;  3DM1 A;  1EOT A;  5COY A;  3G7L A;  5EPL A;  1WD1 A;  1GUW A;  4ZK9 B;  1BNZ A;  4OIK A;  1EQT A;  1X3Q A;  2L11 A;  1HFG A;  2B2T C;  4X3S A;  5EPJ A;  5EQ0 A;  2B2T A;  2K1B A;  1WTP A;  2JP1 A;  1AP0 A;  1JIC A;  4HAE A;  1B3A A;  1VMC A;  2HCC A;  1CM9 A;  1U4L A;  2B2W C;  4X3K A; 
#chains in the Genus database with same CATH topology
 3T51 B;  5C4H A;  2OF1 A;  3UDF A;  5C3E H;  5KGU A;  3LNN A;  3CCR A;  3MC0 B;  2KVM A;  3OTO Q;  2B63 G;  2K32 A;  1U4P A;  4KK7 A;  3MXG A;  4RGM A;  3I4N H;  3B6Y A;  2EJG C;  1I4X A;  1LTB D;  2V1C C;  1SDF A;  4CDD C;  2CW0 D;  4NMZ A;  5I2X A;  2VZA A;  1BCP F;  4QJF A;  3SDZ A;  4IFD H;  5LMU L;  3P7J A;  1JWU D;  4IUU A;  3RN2 A;  1LTS D;  4BBS H;  1VCI A;  3LGJ A;  3TP8 A;  2DNE A;  4GOP A;  1Q1E A;  1DYQ A;  1QJO A;  3BDO A;  2L4N A;  4A3F B;  5M3M B;  5AJ3 Q;  3I4M H;  3S1Q B;  2E2H H;  1B50 A;  5KRU A;  1S5B D;  1D7Q A;  1XNR L;  4FP5 D;  2VNU D;  4RAU C;  4V0B A;  3PQI A;  1HNW Q;  1EWH A;  4IUR A;  4FF1 A;  4OWX B;  5IOD A;  2XRS D;  4YY3 Q;  4LFB Q;  3QB3 A;  3CPF A;  1S3O A;  2WIN B;  4GN4 B;  1IW7 C;  1ILQ A;  3BVG A;  4B3T Q;  3CC4 A;  2JA7 B;  1O7Z A;  2YTV A;  4YWK A;  3CCU A;  4IPD A;  3D8G A;  4DNT B;  3HOV G;  3HFZ B;  2I46 A;  4C3J G;  3KFU A;  2H1E A;  3CAM A;  5IYB G;  1QG7 A;  1F2L A;  1TU2 B;  2NVY B;  2K5Q A;  1N36 Q;  4DR6 Q;  4K2L A;  3ULL A;  1Q86 C;  1W6K A;  3MHB A;  1DOL A;  1PTO F;  1SNM A;  1WI5 A;  2EPB A;  4O1N A;  4A3D H;  2X6G A;  2FHT A;  1YNJ C;  4CKE A;  1K0S A;  2ALY B;  2GVA A;  1YNN C;  2L1B A;  1C7Y A;  4DPG A;  1J5E L;  3J81 j;  1WD1 A;  4IOC A;  1KQS A;  1R4Q B;  4ZUI A;  1PH7 A;  1EZ8 A;  2EVB A;  1AFP A;  2OT2 A;  3C2P A;  5C4J B;  1SNP A;  2QEJ C;  4RKB A;  2IT1 A;  4DNR B;  5F2D A;  1O7Y A;  4X64 L;  3HZX A;  3DM3 A;  5JPN C;  3PGZ A;  2DY8 A;  4LUZ A;  1LTL A;  4DR4 Q;  1BVS A;  4JI2 Q;  3S1R H;  1QCB D;  4K6D A;  1N34 Q;  2RBM A;  1HFN A;  1XMO L;  1YEZ A;  1EU3 A;  2B39 A;  2Z1C A;  3HKZ E;  4HMJ A;  5C5L A;  4IPC A;  4DV0 Q;  4LFA L;  1G29 1;  2XNA C;  1S72 A;  1Q3L A;  2RDF A;  3G48 A;  3SR1 A;  4A3J H;  4JBW A;  2UU9 Q;  3E0E A;  4JOI A;  2E75 C;  1KRS A;  1GM5 A;  5AJ3 L;  1DZ1 A;  3T56 B;  4F87 A;  1CKN A;  1HNZ L;  1L1O C;  1GOZ A;  2ZTD A;  2E5L L;  2CKZ B;  2F0O A;  4B3M Q;  1B44 D;  1JR0 D;  3A8K E;  4MZ9 A;  2WFW A;  2QA4 A;  4JI0 L;  3U9S A;  3DHQ A;  2F4V L;  3FKI G;  2NZH A;  1N34 L;  3AYH B;  3Q24 A;  2VQE L;  2Q2I A;  2VUM G;  1X3F A;  4IUN A;  2KOL A;  1O78 A;  1TKW B;  2PZU A;  3PSI A;  1W6J A;  5A35 A;  1D5X C;  3ERS X;  2CFM A;  3WDN A;  3CCE A;  4NDX A;  2JEA I;  1UE7 A;  1H9K A;  2E2J B;  3H09 A;  1JOQ A;  1K83 H;  1PXU A;  1RJT A;  2CH4 A;  2F0P A;  3PO2 G;  5D3D A;  3IFT A;  5H1S E;  1CKM A;  5C44 H;  3HOY G;  2YYZ A;  1PRT D;  1WTX A;  1X9N A;  1PFN A;  1J6Q A;  1LT3 D;  3D4R A;  1J5E Q;  1II3 A;  3EVQ A;  2EY5 A;  3J7Y W;  2KJX A;  3RNU A;  1V1P B;  1PH6 A;  5M5X B;  1HZA A;  1TS4 A;  2N78 A;  2PI2 A;  2K52 A;  3C3L A;  1XPR A;  4FF3 A;  1JWS D;  1F9P A;  2ZTC A;  4J8Q A;  2BH8 A;  1STB A;  1C9O A;  4EQ5 A;  4OO1 G;  4CDE C;  2NVQ H;  1J9O A;  4FXK C;  3HOZ B;  3J81 c;  3HKS A;  3A8I E;  2Z4H A;  5EKI A;  1JC7 A;  3QWN A;  2WB1 G;  4I7A A;  4PZ8 A;  1YIJ A;  1ASY A;  1GUW A;  3RLF A;  2R92 B;  3CW2 C;  2B2T C;  1FJG Q;  3S16 B;  3IAY A;  3I70 A;  4NP5 A;  1FNW A;  2PNR C;  2VL6 A;  1SJE D;  5ELB A;  1EFI D;  2K33 A;  3F2B A;  1H9J A;  4A3C G;  4QUC A;  1DCZ A;  1L1O A;  3OMG A;  3KDF B;  5KNC A;  4XQN A;  4A3G H;  1JJG A;  3UDI A;  3GTJ B;  3HOW B;  4L5Q A;  3GTP B;  4BY1 H;  1TQO A;  4NB3 A;  4OX9 L;  1J8I A;  2NZ1 D;  1RF2 D;  4LNQ A;  1GKH A;  1TY2 A;  5IOC A;  4L5S A;  4M1U B;  1P8L A;  1HNX L;  2EJF C;  3D4W A;  1UE1 A;  1PH1 A;  2HHH Q;  1N33 Q;  4O0A A;  5IYD G;  1AZQ A;  5D65 A;  4HIM A;  3CCJ A;  1RHP A;  3FEW X;  3EQL C;  4NKL A;  4XYQ A;  4UP7 A;  2VQF Q;  1RKN A;  3M4P A;  1ZKO A;  4A3E H;  1IKM A;  2JK8 A;  1H9S B;  1NCV A;  2YTX A;  3H0G B;  3NBH A;  1D2B A;  4DR3 L;  4BA1 I;  2NYZ D;  1M90 C;  4A3B B;  4RGT A;  4ULL A;  3PUY A;  2BA1 A;  1S5D D;  4X65 Q;  1U0L A;  4IPG A;  3EFX D;  3JAM i;  1LYL A;  5M5Y B;  2EE1 A;  1VMP A;  5ELN A;  4ZUJ A;  2AQ2 B;  2M2L A;  2ZM6 L;  3I3C A;  5CV9 A;  1G6Z A;  1U4M A;  3NSW A;  2XIW A;  5C0X G;  4DAP A;  1VQC A;  2OXP A;  1EWC A;  4HID A;  1EYA A;  1R9T H;  4GLA C;  1SND A;  1HCZ A;  1EL0 A;  4OO1 H;  1WCM H;  4K0K L;  4GNX B;  3TZD A;  4BBR H;  3PIP A;  4OGQ C;  3K59 A;  3I4M G;  3D6W A;  1VQO A;  1CUK A;  2R6G A;  3J80 c;  4HCE A;  1YJN A;  1A15 A;  3I8Z A;  2Q8I B;  1K8G A;  2MP1 A;  5CBE E;  3HOX G;  4WJ3 M;  3CC7 A;  1TS2 A;  3PO2 B;  4A3F G;  4K5V A;  1BNZ A;  1WTP A;  1K73 C;  1PH8 A;  2UXC Q;  1QIL A;  1HJP A;  2R92 G;  5IGB A;  4A3C H;  1ESF A;  4HAE A;  3ICE A;  3L7Z C;  4IFD I;  5C6A A;  4KJN A;  2ZJP A;  2F0T A;  1E2V A;  2N88 A;  3L9A X;  1G51 A;  1HXY D;  2JE6 I;  1SRO A;  2EYH A;  4YCV A;  1A3T A;  3NPP A;  4C3H B;  4RCO A;  1RCV D;  2J4X A;  4A93 B;  1DXM A;  3JAM c;  2VUM B;  5FLM G;  2DUD A;  2EYL A;  3P75 A;  4LF4 Q;  3HOX B;  3GTM B;  2OCE A;  5BN3 A;  1VQG A;  4GKJ L;  1TT2 A;  2NUC A;  2QF7 A;  4ABN A;  5IY0 A;  5DNF A;  4DGZ A;  2VW9 A;  5T1G A;  1PYW D;  1SMY C;  4R4T A;  1LM0 A;  2A69 D;  2KCT A;  5FLX E;  4A3B H;  1A0I A;  3PUX A;  1QUQ B;  4IOA A;  1CA5 A;  2R7F A;  4JI1 Q;  1CKO A;  3E0J A;  3UI2 A;  2KHS A;  4G57 A;  1XYI A;  1KC8 C;  4AIM A;  2A8V A;  3KLS A;  4QQB X;  4A3L H;  2UXB L;  3NEL A;  3A74 A;  3BJU A;  4YIJ A;  2C5C A;  4MTN A;  4R8I A;  1IXR A;  1DJR D;  2CWP A;  3RZO H;  1STY A;  2V4D A;  2F0W A;  1QVC A;  2F4V Q;  1EQQ A;  4DAY B;  4U68 A;  2KCM A;  4JG2 A;  2VS1 A;  1EOV A;  2GVB A;  3IL8 A;  1CA6 A;  2UUC L;  2FIN B;  2EOT A;  4E6I A;  4GLX A;  1WFQ A;  3R3O A;  2CW0 C;  1LTI D;  5D3I B;  1EIH A;  4R4O A;  1WCM G;  4BY1 B;  1E2W A;  5J22 A;  4JBJ A;  2L0C A;  1NJI C;  5I9O A;  1GVP A;  2C9O A;  4A3G B;  5KEE A;  3G4S A;  3PMF A;  1XX8 A;  1Y1V H;  1E7Z A;  3GTQ B;  1E1T A;  3FKI H;  3D0F A;  3CCQ A;  4CBV A;  1K8A C;  1PTO C;  4AYB G;  4ZKB B;  1EY9 A;  2JA6 B;  3QO2 A;  1DGS A;  2RSO A;  2EY6 A;  1IBM L;  1STN A;  2R92 H;  2IX0 A;  5COY A;  1C0A A;  2JA7 G;  2UU9 L;  4FF2 A;  5FLX c;  3FHW A;  4UHV A;  1EQT A;  5IT9 L;  2AUK A;  1X3G A;  5C0X I;  3HOZ H;  3VR5 A;  1HNZ Q;  4LF4 L;  4BA2 I;  4JI4 L;  1Q12 A;  1UE5 A;  3S24 A;  2D62 A;  4MN3 A;  1TWC B;  3EJI A;  5GAE C;  4DR1 Q;  1KD1 C;  5M3F H;  1FGU A;  2JQO A;  1PFB A;  1AH9 A;  1PTO D;  4LF7 Q;  1IYJ B;  3PCO B;  4DAV A;  1WTW A;  1WD0 A;  4K8J A;  1H95 A;  2FJ2 A;  1IBM Q;  1TVX A;  1SYD A;  1V1Q A;  5I4D A;  1K3R A;  1TWA H;  2F0K A;  3E6Z X;  4A93 H;  3K7U C;  4RA8 A;  1SE4 A;  3HGB A;  4ME3 A;  1V1P A;  1ENC A;  2HUG A;  4G7O C;  2ATW A;  4X64 Q;  3S15 H;  4ZYS A;  3M4O H;  1JE5 A;  3K5L A;  5JVH 3;  4DR4 L;  4X3T A;  2F0V A;  1E22 A;  1ENA A;  1KDA A;  3KF8 A;  4KN7 C;  4LF7 L;  1OXX K;  3UDG A;  2QIL A;  1QWY A;  1I94 L;  3BG3 A;  4RFB A;  3A7A B;  4GN3 B;  4QMG A;  2VXW A;  1ICF B;  3DWA A;  1SE2 A;  2ES2 A;  3NBH B;  4DV4 Q;  2NZO A;  3BDL A;  1L1O B;  4DV3 L;  4JV5 Q;  5DM7 3;  3FMC A;  4JI0 Q;  4ILW A;  4N9P A;  3PO3 H;  1NNX A;  4XT3 B;  1Q46 A;  3GO5 A;  4A3J B;  3H6M A;  3JAM E;  3F8T A;  2OWO A;  4WRD A;  3TRE A;  3FPP A;  1I4G A;  1QE6 A;  3SK8 A;  2LXJ A;  5NUC A;  4AH6 A;  5IYC H;  1WJJ A;  1XNQ Q;  2A1A A;  3T16 A;  2EYM A;  3DEO A;  4CJ0 B;  4DNI A;  4PZ6 A;  5C4J H;  4KHZ A;  1I6H B;  1U5K A;  2RA4 A;  2D0O A;  4FO2 A;  1L0X B;  5JPM C;  1IBL Q;  3S14 B;  4JCV E;  2OEO A;  5LMN W;  2OTJ A;  2UUA L;  1JIC A;  3E3X A;  2NN6 H;  3ULJ A;  5C3X A;  5FO9 B;  1B3A A;  1XTC D;  5CC4 A;  2SNS A;  1SLJ A;  1YBY A;  1K8O A;  1W2B A;  4RHR A;  4H44 C;  1Q8K A;  2HCI A;  2K14 A;  4Q5V A;  3AEV A;  5JEA H;  2EJM A;  4L8J A;  5G3L D;  1HQR D;  1MI2 A;  1E0B A;  4A3K G;  3M4O B;  3I55 A;  1S5F D;  4A93 G;  3ND9 A;  4EQN A;  2R61 A;  1OXU A;  3I4O A;  1A8V A;  4CKB A;  3HOW H;  1Y1W H;  2I5L X;  2DJF C;  1CSP A;  1G6P A;  1LT4 D;  2K5D A;  2CHB D;  4DK6 C;  4K5X A;  4G4K A;  3NP8 A;  2MO0 A;  5M3F B;  1UAP A;  3A55 A;  4LFC L;  4DU9 A;  4JV5 L;  5E7N A;  2OQ0 A;  1F9Q A;  2L15 A;  3I4L A;  3W5O A;  5CGK A;  3BZK A;  5C4Z A;  2F0Q A;  3MA2 B;  3KLW A;  3CRK C;  1HNX Q;  1ET6 A;  3J80 L;  2I07 B;  1NSN S;  2X69 A;  3HP3 A;  1KDB A;  2D9U A;  2ZJR A;  4LF6 L;  1P16 A;  4ZRZ A;  1SMY D;  2EYP A;  1L2F A;  5M5X H;  2K03 A;  1O7L A;  2PYK A;  3HEJ A;  4IJL A;  2AKW B;  4B3R Q;  1WTH A;  4HSV A;  1GO3 E;  5IE8 A;  4LAA A;  4DAY A;  5I2Y A;  1Q90 A;  1TII D;  5K5P A;  1BDO A;  1KLU D;  5C3W A;  3R93 A;  1BF4 A;  1YZ6 A;  1CFM A;  3PIP 3;  3JAM L;  2MJ8 A;  4F88 A;  1SXT A;  3A5U A;  2AHO B;  4DR3 Q;  2UUC Q;  1JWM D;  2PI2 E;  3K5M A;  3CXC A;  1Z47 A;  1KAW A;  3HKZ B;  4KKU A;  5FK9 C;  4KMU C;  1YJ9 A;  3J7A F;  1X56 A;  1RTO A;  2WAQ B;  5FJ8 G;  5EPL A;  1MHW C;  5FO8 B;  2MFI A;  4X3S A;  2R93 G;  3MXU A;  1EQV A;  1LT6 D;  4LF5 Q;  1I3Q H;  3S14 H;  1B7Y B;  5IIF A;  4DK3 C;  1FNV A;  5E4X A;  3SGI A;  4C56 C;  1B70 B;  4JI6 L;  2M9V A;  5JAV A;  2EZV A;  5BR8 Q;  2A69 C;  4XYO A;  3F2C A;  3K80 C;  2IHE A;  2RF4 A;  2A6E D;  2UXB Q;  3K7A B;  1Z9F A;  1EEI D;  4B9W A;  4HIO A;  3T1Y L;  3HOW G;  4BY7 H;  3MVV A;  4JI4 Q;  3M3Y H;  1DON A;  4R4Q A;  4H0L C;  4OO1 I;  2L5T A;  4XQJ A;  2K04 A;  1TWA B;  3S1R B;  2IY5 B;  1N32 Q;  4GNX A;  2HIX A;  1TY0 A;  4P72 A;  3HOX H;  1B1Z A;  4LF5 L;  1Q81 C;  2ASB A;  3PO3 B;  1C4Q A;  2ZJQ A;  2JA8 B;  5COR A;  2XGT A;  3A0J A;  1HZ9 A;  4OEM B;  1QVF A;  3KBG A;  2D0P A;  2B8G A;  4DUY Q;  4UP8 A;  4I65 A;  5BR8 L;  4C3H H;  5K36 G;  1E3P A;  3PUZ A;  1TXY A;  2SOB A;  1LT5 D;  4BXX G;  2SNM A;  5IGC A;  1EY4 A;  1B8A A;  2MGS A;  3P1H A;  4LW1 A;  4B3M L;  1IKL A;  3K8A A;  4R4C A;  2AUJ D;  3A5Z B;  2F4I A;  4KY7 A;  3ZJY C;  1GUO A;  2B63 H;  3PO2 H;  2Y0S E;  2F03 A;  2MPM A;  3N52 A;  5C44 G;  4OWW B;  3TDQ A;  4G7Z C;  1I94 Q;  2PMZ E;  2B2U C;  4JI1 L;  4N9T A;  3S15 B;  1M8A A;  1VQK A;  4I7Z C;  4DK1 A;  1Y1W B;  2ZXO A;  4P73 A;  1BOS A;  1PMR A;  4IUV A;  2PNH A;  4X3U A;  2QDL A;  2C35 B;  1UUP A;  4X6A H;  3I90 A;  1KXL A;  1PRT F;  2JA8 G;  1SSO A;  3NQT A;  2J7Z A;  2YTY A;  2CCZ A;  4DV0 L;  3S9W A;  5JEA J;  4WOR A;  1G91 A;  4POF A;  1I4P A;  2R93 H;  5JOB A;  3RZO B;  2K6A A;  4L63 B;  3WOF A;  3CME A;  2L11 A;  3NWT A;  4IZ8 A;  2JA5 G;  1ZYR C;  2B2T A;  2G9H D;  4FNF A;  4DV5 L;  4DR7 Q;  1XNQ L;  2E74 C;  2XTI A;  2D2C C;  2BCO A;  4DR2 L;  1KLG D;  3H0G G;  4LUO A;  1LTG D;  1I6H H;  1IHZ A;  2Z0S A;  1B9M A;  2KHI A;  2LMC B;  4IUP A;  2Q2T A;  2K28 A;  5FLX L;  3OHX C;  2VQE Q;  2F0E A;  1B9N A;  1LTA D;  1B4O A;  1F9S A;  2AQ1 B;  2JEB I;  4IQZ A;  2UUA Q;  4LF8 L;  1K9M C;  3GTQ H;  2HDM A;  5LL6 S;  1AE3 A;  3TZU A;  2R93 B;  4H13 C;  4DAM A;  5I6W A;  4DUY L;  2Y0S G;  3SEB A;  2KA7 A;  5GRO A;  3I4N B;  4JOI C;  1KNA A;  4DF7 A;  2EYO A;  3CQZ B;  1S5E D;  1I4H A;  2QEX A;  4PG3 A;  2NVT H;  1KDC A;  1XWE A;  4IUT A;  4DR2 Q;  1VQ9 A;  1HTP A;  2CQA A;  4IAL A;  2ZXP A;  2MHV A;  4RMF A;  2JJQ A;  4QCL A;  1FYC A;  1EYG A;  1W3S A;  3KLR A;  4DR1 L;  1UEB A;  3GTJ H;  2BE5 C;  4KKS A;  1V43 A;  4JPB W;  2A74 C;  3R2T A;  1RIP A;  1MKH A;  1SEB D;  1H9R A;  1YNN D;  3KF6 A;  5EKK A;  1WTR A;  3I4N G;  5IP9 G;  1YVC A;  5IT9 c;  1OXT A;  1HA6 A;  3KF6 B;  4DV1 Q;  4NXM Q;  4LUV A;  2ZT9 C;  1SMX A;  4YHH L;  4ALP A;  1LTR D;  1UE6 A;  4A3J G;  1NUC A;  2CQO A;  4DXF A;  3CD6 A;  2LXK A;  2YV5 A;  3V05 A;  4BBR B;  1FJG L;  2PO4 A;  4GKK L;  1ENF A;  1MSH A;  4JC0 A;  2QW7 A;  2JA8 H;  3KLS X;  1IL2 A;  3Q6S A;  1QOH A;  1AZP A;  1HR0 Q;  1JOR A;  4C1N K;  4LK1 C;  2ENB A;  5KNB A;  2K5V A;  4QY7 A;  1OXS C;  2N3S A;  2NBF A;  2MO1 A;  2ZM6 Q;  4C3J H;  2VUM H;  3EN2 A;  1T5X D;  4MIU A;  2VB3 X;  3GQB A;  1TWC H;  3TP6 A;  2JXM B;  4JI7 Q;  3M3Y B;  2A6H C;  4BY7 B;  4OL7 A;  2K4K A;  3MFY A;  4OON A;  1PA6 A;  5EQ0 A;  3PIO 3;  1JOK A;  1VF5 C;  4APV A;  3H91 A;  1U4L A;  1KRT A;  3OPO A;  3QOJ A;  3CCS A;  5JVG 3;  2KUM A;  3F1Z A;  3BYT B;  2L9H A;  3S17 B;  5DLQ E;  3W3A A;  3AQQ A;  4JBM A;  4EGV A;  3TME A;  3H3V C;  1G8Z D;  5IYB H;  1SE3 A;  3AFP A;  2UXC L;  3CCL A;  2XN9 C;  1HR0 W;  3FKI B;  4K8I A;  1Y1V B;  4JVZ A;  3MEF A;  1Q7Y C;  4JI8 Q;  4UP9 A;  4WJW A;  4Y52 H;  3A54 A;  2F3I A;  1EIG A;  2Q2U A;  1XPU A;  1D5Z C;  3KYH C;  5BN5 A;  4JI6 Q;  3TP5 A;  1X6O A;  3MWY W;  1IW7 D;  1MSG A;  2NVT B;  1CZG A;  1BUV T;  1ESR A;  3NUC A;  2F0G A;  2F0J A;  2TMP A;  4YY3 L;  5DEH A;  5CV6 A;  2E2I H;  3NTK A;  1Y69 U;  5M5Y H;  1EZ6 A;  3M9B A;  4YHH Q;  4A3I G;  1X32 A;  4QB4 A;  1N32 L;  4GOP B;  3SK6 A;  2MUY A;  1HA5 A;  3MXN B;  2K5W A;  2Q2H A;  4QL5 A;  1ZEQ X;  5CV7 A;  2LKV A;  4A3E B;  1SNO A;  4LF9 Q;  1B53 A;  4N8F A;  3J80 E;  4K5W A;  2PQA B;  1VQ4 A;  1EIF A;  4KD3 A;  3NQI A;  5JJK A;  2KQ3 A;  4OEL B;  1Y1W G;  3J81 E;  3LWE A;  1SYB A;  4EQO A;  4OIJ A;  3M4Q A;  2K50 A;  2NVY H;  3RD4 A;  5CV5 A;  3NEN A;  1EYC A;  3HRZ C;  1Y8P B;  4IJH A;  4P2C B;  4XXE A;  4AYB E;  1SBB B;  5IGF A;  3GTM H;  4B3T L;  1CZW A;  2QDB A;  1NTG A;  1FD7 D;  2EQS A;  2PCF B;  3K58 A;  5HGT A;  1PH9 A;  1K83 B;  1GUT A;  4QIW E;  1TWH B;  4R4I A;  2F0H A;  3T1Y Q;  1VQA A;  2RKS A;  3NHH A;  4DV7 Q;  1X3Q A;  5C3E G;  1HFG A;  4B3S L;  1N36 L;  1V9P A;  1YHQ A;  4OWT B;  1LAC A;  1SNQ A;  1KNE A;  1SNC A;  1L0Y B;  2B2W C;  3J7A V;  4PMB A;  2KED A;  2VY3 A;  1MIU A;  1KAA A;  4IPH A;  2B63 B;  3I4M B;  1E24 A;  4OXP A;  1VQE A;  3K0X A;  3KBX A;  3FPU B;  1EY6 A;  3S2D H;  5E4W C;  1YNJ D;  3TEH B;  3K5N A;  2NTT A;  1WCM B;  3VR2 A;  3T4A C;  2K5N A;  2F0F A;  1LTT D;  3BZD B;  4BBS G;  4F8M A;  4JI3 L;  1PYB A;  4B3S Q;  4KHP L;  3D6C A;  3I72 A;  2DNC A;  1QUQ A;  1A3U A;  3BZC A;  1IYV A;  4HN7 A;  4HED A;  2JA6 G;  4G7H C;  4R9W A;  2WV6 D;  5ELC A;  1FR3 A;  1DD2 A;  3HS0 C;  4LF8 Q;  2I5M X;  2RCF A;  3OIP A;  4GS3 A;  2H5X A;  5A2Q E;  4ME5 A;  2WAQ G;  3ND8 A;  3H0G H;  2B8F A;  1WTQ A;  1EY5 A;  1T5E A;  3OW7 A;  1X3P A;  4JI3 Q;  4MNO A;  3DUZ A;  4DK0 A;  3QOL A;  5A2Q L;  1GXD C;  4CDF C;  2I5H A;  2F1M A;  3VYR A;  3K57 A;  5KIX A;  4HCS A;  1VQD A;  1BR9 A;  1EY7 A;  5IYD H;  4UDU C;  1KTK A;  4L5T A;  3U58 A;  4J15 A;  1CI3 M;  3SK4 A;  3Q22 A;  1IYU A;  3GP7 A;  1VQ6 A;  1I5F A;  4GOP C;  4DUZ L;  3GV3 A;  3J81 L;  2ICI A;  4A3E G;  2AWO A;  3RZD B;  3CMA A;  2BH2 A;  1A3V A;  4ID6 A;  5J39 A;  1NMG A;  2B2Y A;  2NWG A;  4B08 A;  3G6E A;  5EBC A;  1BCP B;  3G7L A;  1F2Z A;  1F77 A;  3R2I A;  3UE1 A;  3VYU A;  5ELF A;  3M7G A;  5M5W H;  1CQV A;  3GTL H;  3AMU A;  3J81 i;  2Z6B A;  3S16 H;  4BS9 A;  3K6O A;  2HCC A;  1XTD A;  5JEA G;  3RUZ A;  1XJV A;  1VQL A;  4FYD A;  2O5I C;  2E2H B;  4X62 Q;  2NVX H;  4KHV A;  1PLF A;  4JI7 L;  3BVM A;  2RHQ B;  1PFM A;  3M7N A;  1SJH D;  2Z6K C;  2J0T D;  3FVQ A;  3T53 B;  1K3B C;  3D31 A;  1SYC A;  1QNK A;  4LJZ C;  2MNA A;  3NTI A;  4M8A A;  3IFD A;  5DAU A;  5G3L F;  1NY4 A;  4C2M H;  1EU4 A;  4N8X 1;  2JA6 H;  3T1H L;  2VQF L;  4DV5 Q;  3W1B A;  1OTC A;  1IBK Q;  3KJP A;  2JYO A;  4K6L A;  1ONL A;  3A8J E;  2B2V A;  3VA7 A;  5C44 B;  1VQI A;  4A3M G;  3E9H A;  4X62 L;  5ELO A;  4WFN 3;  1VQ8 A;  3MZ5 A;  1D1I A;  1NMF A;  4XT1 B;  2JA7 H;  4DV6 L;  4X65 L;  1EUJ A;  2IWH A;  2A5H A;  2AMC B;  3WWV A;  5C3E B;  3I7F A;  4NPS A;  1VQJ A;  2RDH A;  3NWS A;  5AFW A;  3ERQ A;  5JJL A;  2HHH L;  3VYT A;  2D5D A;  4P74 A;  4JI5 L;  1K8M A;  3LWU A;  2IHF A;  1S4Z A;  2E76 C;  1VDZ A;  5LMU Q;  5KND A;  3MXN A;  2TSS A;  1BBX C;  5M3M H;  1FVI A;  5HGQ A;  2EYF A;  2X6L A;  3CKI B;  1F2Y A;  1GHK A;  3DMU A;  3FP9 A;  2WAQ E;  5CBA E;  3A7L A;  2ZXR A;  1K0R A;  2WAC A;  2Z9H A;  1QNU A;  1DOK A;  2A6H D;  1V1O A;  2ICE C;  2LSS A;  2DJG C;  3SK5 A;  4GLV B;  1Y14 B;  4RH6 A;  2PMZ B;  3ULP A;  5ISR A;  3GTO H;  1T9H A;  1BO0 A;  2WKD A;  2FFK B;  4RGN A;  4JK1 C;  1HZC A;  1I50 H;  1RD9 D;  3ER0 A;  5ELE A;  3SHL A;  2BOS A;  4BY1 G;  5IGG A;  1C8C A;  3Q23 A;  1JCK B;  1N9W A;  1S5C D;  1MBY A;  3Q8D A;  5IP7 H;  2JA9 A;  4B3R L;  3F2U A;  1F2M A;  2ID0 A;  3CU7 A;  4AQY Q;  1RTN A;  4DFA A;  1L0W A;  1EIY B;  4GN5 A;  1D5M C;  2I0Q A;  1D1K A;  4RKL A;  1KL9 A;  2KEN A;  1BBU A;  2IPK D;  4ZK9 B;  1SYF A;  1EFW A;  1JB3 A;  1IZ6 A;  1LO5 D;  2H4O A;  1FNU A;  2PQE A;  2OQK A;  2JP1 A;  2O5J C;  3NE5 B;  3N6R A;  2DN8 A;  4K14 A;  3J7Z C;  3HG9 A;  4YWM A;  3CC2 A;  4A76 A;  1SN8 A;  4HJ9 A;  4ZAI A;  2LS0 1;  1HUN A;  2B2W A;  1CTM A;  1M1K C;  4DV7 L;  5JJZ A;  2PQA A;  4LFC Q;  3DXJ C;  3RN5 A;  2OTL A;  4V19 0;  2Q8T A;  3KUP A;  2IW3 A;  2NN6 I;  4H02 A;  3V96 A;  4B9X A;  1JE4 A;  3HOV B;  3UE0 A;  2EY1 A;  5IYC G;  4CJ2 C;  1CQF A;  3HOY H;  2Y0S B;  5E1F A;  4JI5 Q;  1XNR Q;  1GHJ A;  2A68 D;  4C3I G;  4KTA A;  4PZ7 A;  1GUG A;  4NW2 A;  4JI2 L;  3BS1 A;  4LFB L;  2BDN A;  1XMO Q;  2B2V C;  5M9O A;  3CF5 A;  2JA5 B;  5GAG C;  2A6E C;  2NN6 G;  3KJO A;  2F0D A;  3TS2 A;  4J6H A;  5EGT A;  1Q8I A;  2XVS A;  3EIV A;  4H7B A;  4CDC C;  4KD4 A;  2IL8 A;  4CGY B;  1PH4 A;  4IFD J;  3S1Q H;  4ZQ3 A;  4PMW A;  4A3F H;  1FL0 A;  1FGB D;  5EAY A;  1PTO H;  3W2D A;  3GV6 A;  1VQF A;  2LY7 A;  1QB5 D;  1KAB A;  1OO9 B;  3H3V I;  3QR8 A;  1YNX A;  3MFG A;  3TQY A;  1E1O A;  1GD7 A;  1Y8O B;  4BBR G;  5GQO A;  2B3G A;  2XWJ B;  2SDF A;  1PTO B;  3D3R A;  2NTS A;  4X66 Q;  2NVX B;  1DOM A;  2NB0 A;  1SFO H;  2AQ3 B;  2F0S A;  1PH3 A;  1JJC B;  2KHJ A;  1VQN A;  1PDQ A;  2WB1 E;  3DLL A;  1EY8 A;  1PRT B;  3BU2 A;  5HY6 A;  1NE3 A;  5IWA Q;  2FXQ A;  1KIX A;  4R8N A;  1PZJ D;  1LAB A;  2BE5 D;  3TBI B;  2B2Y C;  2G5D A;  3TRZ A;  2QGQ A;  4A75 A;  1U4R A;  5C4X B;  3C1E A;  3SXH A;  1V8Q A;  2MQH A;  1VQM A;  1WTV A;  4A3D G;  2O4X A;  2QKI C;  3GD7 A;  3GTP H;  1E2Z A;  3IKJ A;  1PRT C;  1JT8 A;  4LFA Q;  4OHJ A;  2E2D C;  4A4I A;  4F7X A;  3RZD H;  2WP8 J;  1CM9 A;  1STG A;  3DWP A;  5CR3 A;  2YU9 H;  1MJC A;  4L6T B;  2AWN A;  1X55 A;  2SEB D;  4X66 L;  1HHV A;  3GTG H;  3ZYY X;  5ELD A;  2HD3 A;  5J3B A;  1SYG A;  4HJ7 A;  3QJY A;  1B3Q A;  2E5L Q;  1CSQ A;  2WII B;  4YCW A;  1YHA A;  1TWG B;  3RMH A;  4XTC S;  1HRJ A;  2B29 A;  2EDG A;  1STE A;  3M4Y A;  4QGU A;  4DV2 Q;  1VQP A;  4A3B G;  2EXD A;  2PZW A;  2K75 A;  1F9R A;  3VA5 A;  3TS0 A;  1Z6H A;  3LX0 A;  4U67 3;  3K81 C;  2IJ0 A;  1XMQ L;  4GNX C;  1X54 A;  3HOU B;  1OXV A;  3CPW A;  3KF8 B;  4ODG A;  3OYY A;  5C5M A;  1PV4 A;  4L5R C;  4DA2 A;  1EYD A;  1STA A;  2R3Z A;  5IGD A;  4DV4 L;  2Z6K A;  2RHS B;  2EYJ A;  2KBN A;  3STB C;  3CP0 A;  4ZKC B;  4DV2 L;  1WVL A;  2R7Z G;  3V2T A;  4KHP Q;  3Q0A A;  1A2U A;  4IN3 A;  2E2J H;  4YWL A;  1EQR A;  4EVO A;  3S1M H;  1H9S A;  1UNS A;  5J1Z A;  1QVG A;  5CMD A;  3M85 A;  3HOZ G;  1KHI A;  1TR5 A;  4BY7 G;  4QF4 A;  3OOC A;  4R1J A;  2HDL A;  3PV0 A;  2JSO A;  1NR2 A;  1LUZ A;  2DY7 A;  4HR7 B;  2B2U A;  1LLR D;  3PF5 A;  2EY2 A;  1NAP A;  2KEC A;  3CCV A;  4MTK A;  5IWA L;  3S2H H;  4DR7 L;  4KY5 A;  1H9M A;  5FLM H;  1YI2 A;  1STH A;  1XPO A;  3S2D B;  5I6Y A;  4NXM L;  5JJI A;  4A3M B;  4DV3 Q;  1HQM C;  3NK9 A;  4LWC A;  3RR5 A;  1ZYR D;  3SE0 A;  3TP7 A;  3U9O A;  3URY A;  1RL2 A;  5CYU A;  1R9T B;  5LL6 X;  1RDP D;  4IFD G;  1N8R C;  2RCN A;  1NR4 A;  3DEP A;  4RGO S;  1I4Q A;  1EOT A;  1BCP C;  4UY8 C;  4HSP A;  4JYA L;  4A3K B;  1K28 A;  4TQU S;  3GTK H;  4OX9 Q;  1VQH A;  3L0O A;  1HZB A;  3H94 A;  1VMC A;  4HMI A;  4AQY L;  3GDE A;  5FJ8 H;  4FDB A;  1VQ7 A;  2IX1 A;  2R7Z B;  1U9R A;  5EBD A;  1Q82 C;  4K0K Q;  3DWQ A;  2Q8R E;  4DN4 M;  1VQB A;  4DV6 Q;  1XMQ Q;  4A3I B;  1IBL L;  1EY0 A;  4C2M B;  1A63 A;  2CH4 W;  5E3F A;  4EX5 A;  3JC6 6;  1AN8 A;  2N55 A;  3HOU G;  2JN4 A;  3VR3 A;  2PW5 A;  4MHE A;  4KI0 A;  3VDY A;  2M00 A;  3NXW A;  1ICW A;  1D8L A;  3AFQ A;  1GUN A;  2L55 A;  1ILP A;  2Z8L A;  2F0N A;  1Y1V G;  1ZXT A;  3UDX A;  3GTL B;  1CK1 A;  1MJE A;  5M5W B;  2EXZ A;  2FMM A;  3WOE A;  3STB D;  3R8B A;  4O2D A;  4FF4 A;  2PZT A;  1I4R A;  2KCC A;  5KYI A;  1TWF H;  4K2K A;  5CV4 A;  4GKJ Q;  5D14 A;  1TS5 A;  1HR0 L;  5FOB B;  1BXT A;  5HUR A;  2UUB Q;  4FXD A;  3QIA A;  3C1F A;  3T1H Q;  1TWF B;  4XQQ A;  5K36 H;  1PYS B;  3BVZ A;  4ZCK A;  3I91 A;  3J7A 5;  2K05 A;  4RCN A;  3FRP B;  2A73 B;  1AE2 A;  1SR3 A;  3MAQ A;  1AEX A;  5C4X G;  2RQX A;  3QG1 A;  2F3W A;  2LFN A;  3BDC A;  1A6X A;  3ERO A;  5BN4 A;  3NEM A;  3MEH A;  3J80 i;  2F3V A;  2NVQ B;  2HQL A;  4HJ8 A;  1CHP D;  4BBS B;  3RLO A;  3S17 H;  3PF4 A;  3MXP A;  2GA4 B;  4HTH A;  1CKN B;  5C0X H;  2F0U A;  4Y7N H;  1YIT A;  5T1I A;  3KOJ A;  1YJW A;  1WYD A;  4UPA A;  3KK7 A;  4KY6 A;  4J1M A;  5EJW A;  5L37 A;  3ONA B;  3U50 C;  4HIK A;  1BBW A;  3OWE B;  5M3M G;  1PH5 A;  4DXG A;  3OMC A;  2K1B A;  1M4V A;  4PMC A;  1ASZ A;  3NBI A;  4C3J B;  3SVM A;  4YCU A;  4A3K H;  2A19 A;  1MGS A;  4P75 A;  3A56 A;  2UXD L;  1QZH A;  1EWI A;  3RLN A;  4P71 A;  2JA5 H;  3W1G A;  1CT1 D;  4CKC A;  5DM6 3;  3OIQ A;  4LMQ D;  2A68 C;  3K5O A;  2R7D A;  3CRL C;  3L3O C;  4PQX A;  1D6E C;  4Y7N B;  5FKA C;  4CJ1 B;  2WKC A;  3EA6 A;  3PIO A;  2XRQ D;  4HJ5 A;  5C0X J;  2N8N A;  4TSS A;  2E8G A;  5FO7 B;  4XIG S;  2PW7 A;  2K7V A;  3HOV H;  4LF9 L;  3S2H B;  3I2Z A;  4RWS C;  3S1N H;  1HH2 P;  2F0I A;  2UUB L;  1TWG H;  1XXG A;  5KYL A;  4KLK A;  5LHY 1;  1Q1B A;  3C46 A;  5LMN Q;  4DR5 Q;  3F2D A;  1IL8 A;  1JMC A;  1AW7 A;  2IX3 A;  3H3V H;  1GJX A;  3FDT A;  5IGE A;  4FVM A;  2G9D A;  4PV1 C;  1HPC A;  3H15 A;  1TS3 A;  1YHB A;  2RVL A;  1O80 A;  1TWH H;  1A62 A;  2RDG A;  4GZY C;  5IT9 E;  4A3L G;  4NXN L;  1BCP D;  4Z9C B;  3U4V A;  4C1N I;  5C4X H;  1A2T A;  1QZG A;  2KCN A;  2K5H A;  3VYS A;  3KDF A;  3CQZ H;  1VS0 A;  4PNY A;  2VB2 X;  5LMN L;  4DR5 L;  1LV9 A;  1SFO B;  3IRB A;  1X65 A;  1CHQ D;  1ML0 D;  1Y8N B;  3OW2 A;  2P5Z X;  1B2T A;  4A3G G;  4C3I H;  4KJO A;  1G2S A;  1O7I A;  1JQY D;  1I50 B;  3I56 A;  4A3D B;  2RSN A;  4O42 A;  2QCP X;  1DM0 B;  1ROD A;  4NXN Q;  3GTO B;  4FXG C;  2N49 A;  4A3I H;  2UXD Q;  2HIV A;  2O2L D;  5IP9 H;  4POG A;  1BQQ T;  2R7Z H;  2BA0 A;  5GAH C;  3I73 A;  3CHB D;  3AU7 A;  4RG1 A;  2YU9 B;  2BDO A;  4JW0 A;  1G2T A;  1AP0 A;  2E2I B;  2WB1 B;  3VR4 A;  1N33 L;  1EEF D;  3E5S A;  4RHS A;  3GTK B;  4C3H G;  4X3K A;  4WJ4 A;  3E9I A;  3L2P A;  5EPK A;  1WOC A;  3ITP A;  4BXX H;  1I6V C;  3HKZ G;  4S3S A;  1X3E A;  2HT1 A;  1C48 A;  2XSC A;  3EBE A;  3P20 A;  4TVA B;  2XWB B;  4AYB B;  2Z4I A;  3OSO A;  3CCM A;  1NBW A;  5M3F G;  1UEA B;  1UWV A;  1S40 A;  3X3N A;  5I9P A;  4TKO B;  4A3M H;  3BYY B;  4KV6 A;  1WTO A;  3HOY B;  3U4Z A;  4IO9 A;  4HJA A;  2ZTE A;  5CV8 A;  2GN5 A;  3OTO L;  1GUS A;  3T13 A;  4BWG B;  3AB9 A;  4C3I B;  4DV1 L;  2FMC A;  3S1M B;  3G6J B;  3PUV A;  1JB7 A;  4XDX A;  1HTL D;  3NTH A;  3TN2 A;  2HQE A;  2PPB C;  4TRD A;  4DUZ Q;  3OWF A;  1SAP A;  1VF7 A;  2KEE A;  3G71 A;  2F52 A;  4QIW B;  1HUM A;  4KN4 C;  1PFS A;  1ET9 A;  1SYE A;  2CVR A;  2EIF A;  1SE8 A;  1PZK D;  4UAI A;  2F0L A;  4DKA C;  3K0Y A;  4JYA Q;  1HNW L;  2K01 A;  3K7A H;  3HOU H;  4Q0F A;  3PUW A;  3O13 A;  2CWA A;  2DGY A;  5IP7 G;  4IUQ A;  1PH2 A;  1PZI D;  3PO3 G;  1PHJ A;  2L12 A;  3X3M A;  3TSS A;  3S1N B;  4ZLT F;  5EKL A;  4QUF A;  4JBK A;  4LF6 Q;  1I3Q B;  1JOO A;  1R4P B;  2F0M A;  1PVO A;  4GKK Q;  1BKB A;  1SRU A;  1MD2 D;  3MTS A;  5TSS A;  3D4D A;  3GTG B;  3VR6 A;  3DM1 A;  1JJ2 A;  5GAD C;  4CHT B;  4KKT A;  4OIK A;  1Z7T A;  5EPJ A;  4DR6 L;  1VQ5 A;  1IBK L;  4EQP A;  4JI8 L; 
#chains in the Genus database with same CATH homology
 3T51 B;  5C4H A;  2OF1 A;  5KGU A;  3LNN A;  3MC0 B;  2KVM A;  2K32 A;  1U4P A;  4KK7 A;  3MXG A;  4RGM A;  2EJG C;  1I4X A;  1LTB D;  1SDF A;  2CW0 D;  4NMZ A;  5I2X A;  1BCP F;  3SDZ A;  4IFD H;  3P7J A;  1JWU D;  4IUU A;  1LTS D;  1VCI A;  3TP8 A;  2DNE A;  1Q1E A;  1DYQ A;  1QJO A;  3BDO A;  2L4N A;  4A3F B;  5M3M B;  3S1Q B;  1B50 A;  5KRU A;  1S5B D;  4FP5 D;  2VNU D;  4RAU C;  4V0B A;  1EWH A;  4IUR A;  4FF1 A;  5IOD A;  2XRS D;  3QB3 A;  2WIN B;  1IW7 C;  1ILQ A;  3BVG A;  2JA7 B;  1O7Z A;  3D8G A;  4DNT B;  2I46 A;  4C3J G;  2H1E A;  1QG7 A;  1F2L A;  1TU2 B;  2NVY B;  2K5Q A;  4K2L A;  1W6K A;  3MHB A;  1DOL A;  1PTO F;  1SNM A;  2EPB A;  4O1N A;  2X6G A;  2FHT A;  1YNJ C;  4CKE A;  1YNN C;  2L1B A;  1WD1 A;  1R4Q B;  4ZUI A;  1EZ8 A;  2EVB A;  1AFP A;  2OT2 A;  3C2P A;  5C4J B;  1SNP A;  2QEJ C;  4RKB A;  2IT1 A;  4DNR B;  5F2D A;  1O7Y A;  3HZX A;  5JPN C;  2DY8 A;  1QCB D;  4K6D A;  2RBM A;  1HFN A;  1EU3 A;  2B39 A;  2Z1C A;  4HMJ A;  5C5L A;  1G29 1;  2XNA C;  1Q3L A;  2RDF A;  3SR1 A;  4JBW A;  2E75 C;  1DZ1 A;  3T56 B;  4F87 A;  1GOZ A;  2F0O A;  1B44 D;  1JR0 D;  3A8K E;  3U9S A;  3DHQ A;  3Q24 A;  4IUN A;  2KOL A;  1O78 A;  1TKW B;  2PZU A;  1W6J A;  5A35 A;  1D5X C;  3WDN A;  4NDX A;  2JEA I;  1H9K A;  2E2J B;  3H09 A;  1JOQ A;  1PXU A;  1RJT A;  2F0P A;  5D3D A;  3IFT A;  2YYZ A;  1PRT D;  1WTX A;  1LT3 D;  1PFN A;  3D4R A;  1II3 A;  3EVQ A;  2EY5 A;  3J7Y W;  2KJX A;  1V1P B;  5M5X B;  1TS4 A;  3C3L A;  4FF3 A;  1JWS D;  1F9P A;  4J8Q A;  1STB A;  4OO1 G;  3HOZ B;  1J9O A;  4FXK C;  3A8I E;  2Z4H A;  5EKI A;  1JC7 A;  3QWN A;  1GUW A;  3RLF A;  2R92 B;  2B2T C;  3S16 B;  3IAY A;  3I70 A;  4NP5 A;  1FNW A;  2PNR C;  1SJE D;  5ELB A;  1EFI D;  2K33 A;  1H9J A;  4QUC A;  1DCZ A;  3OMG A;  5KNC A;  4XQN A;  3GTJ B;  3HOW B;  3GTP B;  1TQO A;  1J8I A;  2NZ1 D;  1RF2 D;  1TY2 A;  5IOC A;  4M1U B;  2EJF C;  3D4W A;  1AZQ A;  5D65 A;  1RHP A;  3FEW X;  3EQL C;  4NKL A;  4XYQ A;  1RKN A;  1ZKO A;  1IKM A;  1H9S B;  1NCV A;  3H0G B;  3NBH A;  1D2B A;  4BA1 I;  2NYZ D;  4A3B B;  4RGT A;  4ULL A;  3PUY A;  2BA1 A;  1S5D D;  3EFX D;  5M5Y B;  2EE1 A;  1VMP A;  4ZUJ A;  2AQ2 B;  2M2L A;  3I3C A;  5CV9 A;  1G6Z A;  1U4M A;  3NSW A;  2XIW A;  5C0X G;  4DAP A;  2OXP A;  1EWC A;  1EYA A;  1SND A;  1HCZ A;  1EL0 A;  4OO1 H;  3TZD A;  4OGQ C;  3K59 A;  3D6W A;  2R6G A;  4HCE A;  1A15 A;  3I8Z A;  2Q8I B;  2MP1 A;  5CBE E;  1TS2 A;  3PO2 B;  1BNZ A;  4K5V A;  1WTP A;  1QIL A;  5IGB A;  1ESF A;  4HAE A;  3L7Z C;  4IFD I;  5C6A A;  4KJN A;  2F0T A;  1E2V A;  2N88 A;  3L9A X;  1HXY D;  2JE6 I;  2EYH A;  1A3T A;  3NPP A;  4C3H B;  4RCO A;  1RCV D;  2J4X A;  4A93 B;  1DXM A;  2VUM B;  2EYL A;  3P75 A;  3HOX B;  3GTM B;  5BN3 A;  1TT2 A;  2NUC A;  2QF7 A;  4ABN A;  5DNF A;  4DGZ A;  5T1G A;  1PYW D;  1SMY C;  2A69 D;  5FLX E;  3PUX A;  1CA5 A;  3E0J A;  3UI2 A;  2KHS A;  4G57 A;  1XYI A;  3KLS A;  4YIJ A;  2C5C A;  4R8I A;  1DJR D;  1STY A;  2V4D A;  2F0W A;  4U68 A;  3IL8 A;  1CA6 A;  2FIN B;  2EOT A;  4E6I A;  3R3O A;  2CW0 C;  1LTI D;  5D3I B;  1EIH A;  4BY1 B;  1E2W A;  5J22 A;  2L0C A;  5I9O A;  4A3G B;  2C9O A;  5KEE A;  3PMF A;  1XX8 A;  3GTQ B;  4CBV A;  1PTO C;  4ZKB B;  1EY9 A;  2JA6 B;  3QO2 A;  2RSO A;  2EY6 A;  1STN A;  2IX0 A;  5COY A;  4FF2 A;  1EQT A;  5IT9 L;  2AUK A;  5C0X I;  3VR5 A;  4BA2 I;  1Q12 A;  2D62 A;  4MN3 A;  1TWC B;  3EJI A;  1PFB A;  1PTO D;  4DAV A;  1WTW A;  1WD0 A;  4K8J A;  2FJ2 A;  1TVX A;  1SYD A;  5I4D A;  2F0K A;  3E6Z X;  4RA8 A;  1SE4 A;  3HGB A;  1V1P A;  1ENC A;  2HUG A;  4G7O C;  4ZYS A;  3K5L A;  5JVH 3;  4X3T A;  2F0V A;  1ENA A;  1KDA A;  3KF8 A;  4KN7 C;  1OXX K;  2QIL A;  1QWY A;  3BG3 A;  4RFB A;  3A7A B;  4QMG A;  2VXW A;  3DWA A;  1SE2 A;  3BDL A;  5DM7 3;  3FMC A;  4ILW A;  4N9P A;  4XT3 B;  3GO5 A;  4A3J B;  3H6M A;  3JAM E;  4WRD A;  3FPP A;  1I4G A;  1QE6 A;  3SK8 A;  5NUC A;  3T16 A;  2EYM A;  3DEO A;  4CJ0 B;  4KHZ A;  1I6H B;  2RA4 A;  4FO2 A;  1L0X B;  5JPM C;  3S14 B;  2OEO A;  1JIC A;  2NN6 H;  5C3X A;  5FO9 B;  1B3A A;  1XTC D;  5CC4 A;  2SNS A;  1K8O A;  4RHR A;  4H44 C;  2HCI A;  4Q5V A;  5JEA H;  2EJM A;  4L8J A;  5G3L D;  1HQR D;  1MI2 A;  1E0B A;  3M4O B;  1S5F D;  3ND9 A;  4EQN A;  2R61 A;  1OXU A;  4CKB A;  1LT4 D;  2K5D A;  2CHB D;  4K5X A;  4G4K A;  3NP8 A;  5M3F B;  1UAP A;  3A55 A;  4DU9 A;  1F9Q A;  5CGK A;  3I4L A;  5C4Z A;  2F0Q A;  3MA2 B;  3CRK C;  1ET6 A;  3J80 L;  2I07 B;  1NSN S;  2X69 A;  3HP3 A;  1KDB A;  2D9U A;  4ZRZ A;  1SMY D;  2EYP A;  2K03 A;  1O7L A;  2PYK A;  3HEJ A;  4HSV A;  4LAA A;  4DAY A;  5I2Y A;  1Q90 A;  1TII D;  5K5P A;  1BDO A;  1KLU D;  5C3W A;  3R93 A;  1BF4 A;  1CFM A;  3PIP 3;  3JAM L;  2MJ8 A;  4F88 A;  1SXT A;  1JWM D;  3K5M A;  1Z47 A;  3HKZ B;  4KKU A;  5FK9 C;  4KMU C;  3J7A F;  1RTO A;  2WAQ B;  5EPL A;  5FO8 B;  4X3S A;  3MXU A;  1EQV A;  1LT6 D;  5IIF A;  1FNV A;  5E4X A;  4C56 C;  2M9V A;  5JAV A;  2EZV A;  2A69 C;  4XYO A;  2A6E D;  3K7A B;  1EEI D;  4B9W A;  3MVV A;  1DON A;  4H0L C;  4OO1 I;  2L5T A;  4XQJ A;  2K04 A;  1TWA B;  3S1R B;  1TY0 A;  1B1Z A;  3PO3 B;  1C4Q A;  2JA8 B;  5COR A;  3KBG A;  2B8G A;  4I65 A;  5K36 G;  3PUZ A;  2SOB A;  1LT5 D;  2SNM A;  5IGC A;  1EY4 A;  2MGS A;  3P1H A;  1IKL A;  2AUJ D;  2F4I A;  4KY7 A;  1GUO A;  2F03 A;  2MPM A;  3N52 A;  3TDQ A;  4G7Z C;  2B2U C;  4N9T A;  3S15 B;  1M8A A;  4I7Z C;  4DK1 A;  1Y1W B;  2ZXO A;  1BOS A;  1PMR A;  4IUV A;  4X3U A;  1UUP A;  3I90 A;  1PRT F;  1SSO A;  3NQT A;  2J7Z A;  3S9W A;  5JEA J;  4WOR A;  1G91 A;  1I4P A;  5JOB A;  3RZO B;  2K6A A;  4L63 B;  3WOF A;  2L11 A;  3NWT A;  4IZ8 A;  1ZYR C;  2B2T A;  2G9H D;  4FNF A;  2E74 C;  2D2C C;  2BCO A;  1KLG D;  1LTG D;  1IHZ A;  1B9M A;  2LMC B;  4IUP A;  2K28 A;  5FLX L;  3OHX C;  2F0E A;  1B9N A;  1LTA D;  1B4O A;  1F9S A;  2AQ1 B;  2JEB I;  4IQZ A;  2HDM A;  5LL6 S;  3TZU A;  2R93 B;  4H13 C;  5I6W A;  3SEB A;  2KA7 A;  3I4N B;  1KNA A;  4DF7 A;  2EYO A;  3CQZ B;  1S5E D;  1I4H A;  1KDC A;  1XWE A;  4IUT A;  1HTP A;  2CQA A;  4IAL A;  2ZXP A;  2MHV A;  4QCL A;  1FYC A;  3KLR A;  2BE5 C;  4KKS A;  1V43 A;  2A74 C;  3R2T A;  1SEB D;  1H9R A;  1YNN D;  5EKK A;  1WTR A;  1OXT A;  1HA6 A;  2ZT9 C;  1LTR D;  1NUC A;  4DXF A;  3V05 A;  4BBR B;  2PO4 A;  1ENF A;  1MSH A;  3KLS X;  3Q6S A;  1QOH A;  1AZP A;  1JOR A;  4C1N K;  4LK1 C;  2ENB A;  5KNB A;  1OXS C;  2NBF A;  1T5X D;  4MIU A;  2VB3 X;  3GQB A;  3TP6 A;  2JXM B;  3M3Y B;  2A6H C;  4BY7 B;  4OL7 A;  3MFY A;  5EQ0 A;  3PIO 3;  1JOK A;  1VF5 C;  3H91 A;  1U4L A;  3OPO A;  3QOJ A;  5JVG 3;  2KUM A;  3BYT B;  2L9H A;  3S17 B;  3W3A A;  3H3V C;  4EGV A;  3TME A;  1G8Z D;  1SE3 A;  2XN9 C;  3FKI B;  4K8I A;  1Y1V B;  4WJW A;  3A54 A;  1EIG A;  1D5Z C;  5BN5 A;  3TP5 A;  3MWY W;  1IW7 D;  1MSG A;  2NVT B;  1CZG A;  1BUV T;  1ESR A;  3NUC A;  2F0G A;  2F0J A;  2TMP A;  5DEH A;  5CV6 A;  3NTK A;  1Y69 U;  1EZ6 A;  1X32 A;  4QB4 A;  3SK6 A;  2MUY A;  1HA5 A;  2K5W A;  1ZEQ X;  5CV7 A;  2LKV A;  4A3E B;  1SNO A;  1B53 A;  3J80 E;  4K5W A;  4KD3 A;  3NQI A;  2KQ3 A;  3J81 E;  3LWE A;  1SYB A;  4EQO A;  4OIJ A;  3RD4 A;  5CV5 A;  1EYC A;  3HRZ C;  1Y8P B;  4P2C B;  4XXE A;  1SBB B;  5IGF A;  1CZW A;  2QDB A;  1FD7 D;  2PCF B;  3K58 A;  5HGT A;  1K83 B;  1GUT A;  1TWH B;  2F0H A;  2RKS A;  3NHH A;  1X3Q A;  1HFG A;  1LAC A;  1SNQ A;  1SNC A;  1KNE A;  1L0Y B;  2B2W C;  3J7A V;  4PMB A;  2KED A;  1KAA A;  2B63 B;  3I4M B;  3KBX A;  3FPU B;  1EY6 A;  5E4W C;  1YNJ D;  3K5N A;  2NTT A;  1WCM B;  3VR2 A;  3T4A C;  2F0F A;  1LTT D;  3BZD B;  4F8M A;  3D6C A;  3I72 A;  2DNC A;  1A3U A;  1IYV A;  4HN7 A;  4HED A;  4G7H C;  4R9W A;  2WV6 D;  5ELC A;  1FR3 A;  1DD2 A;  3HS0 C;  3OIP A;  5A2Q E;  4ME5 A;  3ND8 A;  2B8F A;  1WTQ A;  1EY5 A;  1T5E A;  3OW7 A;  1X3P A;  3DUZ A;  4DK0 A;  3QOL A;  5A2Q L;  1GXD C;  2F1M A;  3VYR A;  3K57 A;  5KIX A;  4HCS A;  1BR9 A;  1EY7 A;  4UDU C;  1KTK A;  1CI3 M;  3SK4 A;  3Q22 A;  1IYU A;  3GP7 A;  3GV3 A;  3J81 L;  2ICI A;  2AWO A;  3RZD B;  1A3V A;  4ID6 A;  5J39 A;  2B2Y A;  2NWG A;  4B08 A;  5EBC A;  1BCP B;  3G7L A;  1F2Z A;  1F77 A;  3R2I A;  3VYU A;  5ELF A;  3M7G A;  1CQV A;  3AMU A;  4BS9 A;  3K6O A;  2HCC A;  5JEA G;  3RUZ A;  4FYD A;  2O5I C;  2E2H B;  4KHV A;  1PLF A;  3BVM A;  1PFM A;  3M7N A;  1SJH D;  2J0T D;  3FVQ A;  3T53 B;  3D31 A;  1SYC A;  1QNK A;  4LJZ C;  3NTI A;  4M8A A;  3IFD A;  5DAU A;  5G3L F;  1EU4 A;  2JYO A;  4K6L A;  1ONL A;  3A8J E;  2B2V A;  3VA7 A;  5C44 B;  4WFN 3;  3MZ5 A;  1D1I A;  4XT1 B;  2IWH A;  2A5H A;  5C3E B;  2RDH A;  5AFW A;  3NWS A;  3ERQ A;  3VYT A;  2D5D A;  1K8M A;  3LWU A;  1S4Z A;  2E76 C;  1VDZ A;  5KND A;  3MXN A;  2TSS A;  1BBX C;  2EYF A;  2X6L A;  3CKI B;  1F2Y A;  1GHK A;  3DMU A;  5CBA E;  3A7L A;  2ZXR A;  2WAC A;  1QNU A;  1DOK A;  2A6H D;  1V1O A;  2ICE C;  3SK5 A;  4RH6 A;  2PMZ B;  5ISR A;  1BO0 A;  2WKD A;  2FFK B;  4RGN A;  4JK1 C;  1RD9 D;  5ELE A;  3SHL A;  2BOS A;  5IGG A;  1C8C A;  3Q23 A;  1JCK B;  1S5C D;  1MBY A;  3F2U A;  1F2M A;  2ID0 A;  3CU7 A;  1RTN A;  4DFA A;  1D5M C;  1D1K A;  4RKL A;  2IPK D;  4ZK9 B;  1SYF A;  1JB3 A;  1LO5 D;  2H4O A;  1FNU A;  2PQE A;  2O5J C;  2JP1 A;  3NE5 B;  3N6R A;  2DN8 A;  4K14 A;  3HG9 A;  4ZAI A;  2LS0 1;  1HUN A;  2B2W A;  1CTM A;  5JJZ A;  3DXJ C;  4V19 0;  2Q8T A;  3KUP A;  2IW3 A;  2NN6 I;  3V96 A;  4B9X A;  1JE4 A;  3HOV B;  2EY1 A;  4CJ2 C;  1CQF A;  2Y0S B;  5E1F A;  1GHJ A;  2A68 D;  4C3I G;  4KTA A;  1GUG A;  4NW2 A;  3BS1 A;  2BDN A;  2B2V C;  5M9O A;  2JA5 B;  2A6E C;  2NN6 G;  2F0D A;  4J6H A;  5EGT A;  1Q8I A;  2XVS A;  4H7B A;  4KD4 A;  2IL8 A;  4CGY B;  4IFD J;  4ZQ3 A;  4PMW A;  1FGB D;  1PTO H;  3W2D A;  3GV6 A;  2LY7 A;  1QB5 D;  1KAB A;  1OO9 B;  3MFG A;  1Y8O B;  2XWJ B;  2SDF A;  1PTO B;  3D3R A;  2NTS A;  2NVX B;  1DOM A;  2NB0 A;  2AQ3 B;  2F0S A;  1PDQ A;  1EY8 A;  1PRT B;  4R8N A;  3TBI B;  1PZJ D;  1LAB A;  2BE5 D;  2B2Y C;  1U4R A;  5C4X B;  3C1E A;  3SXH A;  1V8Q A;  1WTV A;  2O4X A;  2QKI C;  3GD7 A;  1E2Z A;  3IKJ A;  1PRT C;  4OHJ A;  2E2D C;  4F7X A;  2WP8 J;  1CM9 A;  1STG A;  3DWP A;  5CR3 A;  4L6T B;  2AWN A;  2SEB D;  1HHV A;  3ZYY X;  5ELD A;  1SYG A;  3QJY A;  2WII B;  1TWG B;  3RMH A;  4XTC S;  1HRJ A;  2EDG A;  1STE A;  3M4Y A;  2PZW A;  1F9R A;  3VA5 A;  1Z6H A;  3LX0 A;  4U67 3;  2IJ0 A;  3HOU B;  1OXV A;  4ODG A;  5C5M A;  4DA2 A;  1EYD A;  1STA A;  2R3Z A;  5IGD A;  2EYJ A;  4ZKC B;  1WVL A;  3V2T A;  3Q0A A;  1A2U A;  4IN3 A;  4EVO A;  1H9S A;  1UNS A;  5J1Z A;  5CMD A;  3M85 A;  1TR5 A;  4QF4 A;  3OOC A;  2HDL A;  3PV0 A;  2JSO A;  1NR2 A;  2DY7 A;  4HR7 B;  2B2U A;  1LLR D;  2EY2 A;  1NAP A;  2KEC A;  4KY5 A;  1H9M A;  1STH A;  3S2D B;  5I6Y A;  4A3M B;  1HQM C;  3NK9 A;  1ZYR D;  3SE0 A;  3TP7 A;  3U9O A;  3URY A;  5CYU A;  1R9T B;  5LL6 X;  1RDP D;  4IFD G;  1NR4 A;  3DEP A;  4RGO S;  1I4Q A;  1EOT A;  1BCP C;  4HSP A;  4A3K B;  4TQU S;  3H94 A;  1VMC A;  4HMI A;  2IX1 A;  2R7Z B;  1U9R A;  5EBD A;  3DWQ A;  2Q8R E;  4DN4 M;  4A3I B;  1EY0 A;  4C2M B;  5E3F A;  1AN8 A;  2N55 A;  3VR3 A;  2PW5 A;  4MHE A;  4KI0 A;  2M00 A;  3NXW A;  1ICW A;  1GUN A;  2L55 A;  1ILP A;  2Z8L A;  2F0N A;  1ZXT A;  3GTL B;  1CK1 A;  5M5W B;  2EXZ A;  2FMM A;  3WOE A;  3R8B A;  4FF4 A;  2PZT A;  1I4R A;  2KCC A;  5KYI A;  4K2K A;  5CV4 A;  5D14 A;  1TS5 A;  5FOB B;  1BXT A;  5HUR A;  4FXD A;  3QIA A;  3C1F A;  1TWF B;  4XQQ A;  5K36 H;  3BVZ A;  3I91 A;  2K05 A;  4RCN A;  3FRP B;  2A73 B;  3MAQ A;  1AEX A;  2RQX A;  3QG1 A;  2F3W A;  2LFN A;  3BDC A;  1A6X A;  3ERO A;  5BN4 A;  3MEH A;  2F3V A;  2NVQ B;  1CHP D;  4BBS B;  3MXP A;  2GA4 B;  4HTH A;  5C0X H;  2F0U A;  5T1I A;  3KK7 A;  4KY6 A;  4J1M A;  5EJW A;  3ONA B;  3OWE B;  4DXG A;  3OMC A;  2K1B A;  1M4V A;  4PMC A;  3NBI A;  4C3J B;  3SVM A;  1MGS A;  3A56 A;  1CT1 D;  4CKC A;  5DM6 3;  3OIQ A;  4LMQ D;  2A68 C;  3K5O A;  3CRL C;  3L3O C;  4PQX A;  1D6E C;  4Y7N B;  5FKA C;  4CJ1 B;  2WKC A;  3EA6 A;  2XRQ D;  5C0X J;  4TSS A;  5FO7 B;  4XIG S;  2PW7 A;  2K7V A;  3S2H B;  4RWS C;  2F0I A;  1XXG A;  5KYL A;  5LHY 1;  1Q1B A;  3C46 A;  1IL8 A;  1AW7 A;  2IX3 A;  1GJX A;  3FDT A;  5IGE A;  4FVM A;  2G9D A;  4PV1 C;  1HPC A;  1TS3 A;  2RVL A;  1O80 A;  2RDG A;  4GZY C;  5IT9 E;  1BCP D;  4Z9C B;  4C1N I;  1A2T A;  2KCN A;  3VYS A;  4PNY A;  2VB2 X;  1LV9 A;  1SFO B;  1CHQ D;  1ML0 D;  1Y8N B;  1B2T A;  4KJO A;  1G2S A;  1JQY D;  1I50 B;  4A3D B;  2RSN A;  4O42 A;  2QCP X;  1DM0 B;  1ROD A;  3GTO B;  4FXG C;  2O2L D;  1BQQ T;  2BA0 A;  3I73 A;  3CHB D;  3AU7 A;  2YU9 B;  2BDO A;  1G2T A;  1AP0 A;  2E2I B;  2WB1 B;  3VR4 A;  1EEF D;  3E5S A;  4RHS A;  3GTK B;  4C3H G;  4X3K A;  5EPK A;  3ITP A;  1I6V C;  4S3S A;  1C48 A;  2XSC A;  3P20 A;  2XWB B;  4AYB B;  2Z4I A;  3OSO A;  1UEA B;  3X3N A;  5I9P A;  4TKO B;  3BYY B;  4KV6 A;  1WTO A;  3HOY B;  5CV8 A;  1GUS A;  3T13 A;  4BWG B;  3AB9 A;  4C3I B;  2FMC A;  3S1M B;  3G6J B;  3PUV A;  4XDX A;  1HTL D;  3NTH A;  3TN2 A;  2HQE A;  2PPB C;  4TRD A;  3OWF A;  1SAP A;  1VF7 A;  2KEE A;  4QIW B;  1HUM A;  4KN4 C;  1ET9 A;  1SYE A;  2CVR A;  1PZK D;  4UAI A;  2F0L A;  3K0Y A;  2K01 A;  4Q0F A;  3PUW A;  3O13 A;  4IUQ A;  1PZI D;  2L12 A;  3X3M A;  3TSS A;  3S1N B;  4ZLT F;  5EKL A;  4QUF A;  1I3Q B;  1JOO A;  1R4P B;  2F0M A;  1MD2 D;  3MTS A;  5TSS A;  3D4D A;  3GTG B;  3VR6 A;  3DM1 A;  4CHT B;  4KKT A;  4OIK A;  1Z7T A;  5EPJ A;  4EQP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...