1SSOA

Solution structure and dna-binding properties of a thermostable protein from the archaeon sulfolobus solfataricus
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
62
structure length
62
Chain Sequence
ATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and DNA-binding properties of a thermostable protein from the archaeon Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein
molecule keywords SSO7D
total genus 4
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1995-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ssoA00
4NW2A 2B2TC 2DY7A 1WD0A 1MI2A 2IL8A 3IL8A 1EOTA 4R9WA 1WTVA 2K1BA 2B2VA 2KEEA 4UAIA 1ESRA 2NZ1D 1AZPA 2XIWA 3DEPA 1Q3LA 1F9PA 1G2SA 1KNAA 1EIHA 2KOLA 1CA6A 1HA6A 4XDXA 4CJ0B 1DZ1A 2RSOA 4QUFA 1ICWA 1RJTA 1DOKA 2MPMA 1IKMA 4DN4M 2EOTA 1G6ZA 5D65A 4ZK9B 3N52A 1MSHA 1X32A 1X3PA 2L12A 1AP0A 2KECA 5T1IA 1B4OA 3I8ZA 2K05A 3D6WA 4R8IA 3KUPA 5T1GA 1O7ZA 2HCCA 1SSOA 3I91A 5EPKA 4CJ1B 1X3QA 2X6GA 1SDFA 1HFGA 3GV6A 4X3KA 2SDFA 4IUVA 1GUWA 2L1BA 1O7YA 5E4WC 5CORA 2K04A 5EQ0A 3MWYW 2J7ZA 1PFMA 1B53A 1NR4A 4HSVA 2Q8TA 1ILPA 1CM9A 3MTSA 1CA5A 3UI2A 2EE1A 2X69A 2FFKB 1F9QA 2NWGA 5AFWA 4ZLTF 2N55A 2L11A 3I3CA 2KVMA 1XYIA 2B2VC 2MP1A 2CVRA 3TN2A 1EIGA 1WVLA 2KEDA 5EKIA 1NAPA 2EPBA 3F2UA 3DM1A 3KBXA 2K03A 2RA4A 3Q6SA 1HFNA 1RODA 3H91A 3ONAB 2FINB 2H1EA 2FMMA 1JICA 2L9HA 2B2YA 3HP3A 1NCVA 1RTNA 5CBAE 1J9OA 4X3SA 1C8CA 1AZQA 2HDMA 2K28A 5EPJA 1J8IA 2BDNA 4RAUC 4IUUA 1WTQA 1HUMA 2RSNA 1U4MA 4RWSC 3FPUB 5CBEE 4O42A 2D9UA 4XT3B 1U4PA 4OIJA 1MGSA 3P7JA 4QUCA 1WTWA 1WTRA 1U4LA 1F2LA 3SVMA 1EL0A 1HHVA 4MN3A 1DONA 1A15A 2MJ8A 1VMCA 1M8AA 1PFNA 3I90A 5CMDA 1B3AA 1WTXA 1LV9A 1E0BA 1RTOA 1PLFA 1IKLA 1F9RA 2JYOA 2K01A 3GV3A 1JE4A 1QG7A 1TVXA 1G91A 2DY8A 3DEOA 2B2UA 2B2WA 1EQTA 4HCSA 2MGSA 2NYZD 5EJWA 5JJZA 1G2TA 5D14A 3FDTA 1MSGA 3QO2A 2HCIA 1RHPA 1XX8A 2VXWA 4MHEA 1HRJA 5DNFA 4ZKBB 4X3UA 2B2WC 4IUTA 3G7LA 1ML0D 1PFBA 1IL8A 1WTOA 2RVLA 1S4ZA 1BBXC 1BNZA 5E4XA 2HUGA 1B50A 2JP1A 2HDLA 3IFDA 4XT1B 1NR2A 4U68A 4X3TA 2B2UC 2L4NA 3LWEA 2X6LA 5COYA 2B2TA 1BF4A 1HUNA 1WTPA 5EPLA 4IUPA 1QE6A 1O80A 1U4RA 4ZAIA 2R3ZA 1ILQA 4ZKCB 4HAEA 4HEDA 2Q8RE 4OIKA 2M2LA 1B2TA 2B2YC 1VMPA 2FHTA 2N88A 4IURA 4IUQA 4RA8A 1SAPA 2FJ2A 2KUMA 3R93A 1F9SA 4CJ2C 1WD1A 4LMQD 3TZDA 1DOLA 1ZXTA 1BO0A 1PDQA 1KNEA 1QNKA 1DOMA
chains in the Genus database with same CATH superfamily
5KIXA 4A3JG 4H13C 2IWHA 4BS9A 1Z47A 3I4MH 4WJ4A 3Q0AA 1JR0D 3HKZB 1G2SA 5KYIA 1EIHA 3QOLA 2B8GA 1PTOF 4CJ0B 5C44H 1ENAA 1A8VA 1ICWA 5A2QL 2OTJA 2R92B 3GQBA 5T1IA 2K05A 2E2HH 4N9PA 5CV8A 2B29A 5IT9L 5HURA 4A93G 3HOYG 4JI6L 3PIO3 3RZDB 4DV2Q 5KRUA 1LM0A 1IYUA 3PSIA 2VUMH 1TWGH 1K0RA 2QF7A 5TSSA 4DNTB 1PV4A 4JI7L 1GM5A 3J81i 3I7FA 3LNNA 3MC0B 3KLWA 5IP7H 5M3FB 2MP1A 2CVRA 2YTYA 3GTGH 1KABA 4DR5L 1LABA 1CHPD 2C35B 4JYAL 4K5WA 2C5CA 2GA4B 4WJWA 4LFCQ 3A5ZB 1Y1WG 2L9HA 1EY7A 4JI8Q 1I3QH 3M7GA 2F0MA 2JA8H 4OO1G 3RN5A 2R7ZB 1NJIC 4X66Q 1SROA 5CBEE 3UE1A 3U50C 4ZCKA 2RCNA 4YWMA 4BWGB 1WTWA 1N32Q 2F0PA 4DR4L 1EL0A 1K9MC 2A69C 1R9TH 4YCWA 3FVQA 1VQ4A 2EY5A 3E9IA 2I07B 3DWPA 4DNIA 4WJ3M 3A56A 5CV4A 2CHBD 5IYDG 5IYCH 2L5TA 2ZT9C 1JT8A 3DXJC 3PO3B 3CMAA 4NXML 3OW2A 4OWWB 1HNWL 3EBEA 1QB5D 3HFZB 5LMUQ 2I5HA 1WJJA 2VY3A 4UHVA 2RQXA 3T1HL 2PYKA 4DU9A 1Q7YC 3ND8A 2E75C 2JA5B 3S16H 2WIIB 2XRQD 3DMUA 2EYJA 3STBC 4DR6Q 4M1UB 4XQJA 2F52A 3ERSX 3AFPA 4A3MG 5M5YB 2FXQA 4LF5Q 1F9SA 5DLQE 1MJCA 3ULJA 1AE2A 1LUZA 1DOMA 3FKIG 2DY7A 5CC4A 5IGBA 4A3BB 1SYFA 2R93H 2XIWA 1PTOB 1I6HH 4C3IH 2K75A 5K36G 2IW3A 1B7YB 1K0SA 2KOLA 2NZOA 3HGBA 4XYQA 5C4JH 4DN4M 1VQJA 4A3FH 4DV1Q 4DV3L 1HZBA 4NP5A 3S15H 4CJ1B 2G5DA 3K8AA 4DNRB 3H0GB 3S1NH 4K5VA 1SNCA 3MWYW 4LK1C 1B53A 2JQOA 1OXUA 1NE3A 2HQLA 3CPFA 2YTVA 5KNDA 2ZXRA 4A3GH 3S2DH 4JI4Q 3F2UA 3DM1A 2TMPA 3EA6A 1GO3E 1Q46A 4DAYA 1XMOL 1HH2P 2XNAC 5FLXE 1WYDA 3ONAB 3LGJA 1IXRA 1C8CA 2AUJD 3L2PA 2WACA 1Y1VG 1WTQA 2RSNA 1YNNC 1T9HA 4KY7A 2RHSB 2D9UA 1U4PA 4FF2A 1PXUA 2J0TD 4KHPL 3BDOA 3VYTA 1MD2D 1OO9B 3BYTB 3GV3A 1WFQA 3P75A 4DV4Q 1HXYD 1Q90A 3TRZA 3U9SA 1RHPA 4TSSA 3OIQA 1FNWA 1ML0D 2A68C 1TWCH 5FLMH 3KF6B 2R92G 4YHHL 2E76C 2HUGA 1Y14B 1KIXA 3TS0A 4QGUA 1S5DD 5EKLA 2EYLA 3PUZA 4MIUA 2EVBA 1U5KA 1EYGA 4F8MA 4ZAIA 1MKHA 1ILQA 4DV7L 1EOVA 3JAMi 2WB1G 1Y69U 1S72A 2HIXA 2KUMA 3TP6A 3PIPA 1SYDA 2XTIA 1CTMA 2A6ED 1B1ZA 3VA5A 1FVIA 4JI2L 2E2JH 5DM63 1D2BA 1XPOA 1CQVA 1LTAD 4ALPA 3V2TA 2ICEC 4WORA 1W3SA 2K5WA 1PH2A 3MXPA 4KD3A 3NTIA 3STBD 3TMEA 4AYBG 5IIFA 4C3HB 4BBSH 2ZTEA 2JA6B 1SNDA 4OELB 1IZ6A 4IZ8A 4R4OA 2PNHA 1SYCA 4IJHA 5CORA 3FKIH 1UEBA 3CRLC 4RMFA 4RKBA 1PTOD 3U4VA 3A74A 1DJRD 3PUWA 3S17H 1IW7D 5BR8L 3G48A 4KKUA 4CGYB 1I94Q 3K80C 2V1CC 1EFWA 1GOZA 5A35A 2XVSA 1JJCB 3TQYA 3QG1A 1SRUA 2SNSA 1UAPA 2NBFA 1SNOA 4A3LH 4IQZA 4OHJA 2UU9L 4X6AH 1RTNA 3GTJB 2F3IA 4X3SA 4JV5Q 1AZQA 1JOKA 1EU4A 1NSNS 3WOEA 1GHJA 2BDNA 5C0XI 3OOCA 5CR3A 2B8FA 3P7JA 3I70A 5EGTA 4IPHA 4H0LC 3SVMA 4GLXA 5C3EG 5IWAL 1DONA 1Q1BA 5FO9B 1PLFA 2K52A 1KL9A 4BY1H 2K4KA 2RKSA 2PO4A 1SMYC 4RGOS 3UDIA 5JEAH 3OIPA 2QA4A 4L63B 3RN2A 3QO2A 4UP9A 3BYYB 4JI3L 4DV0Q 2Z6BA 2F0NA 4DXGA 1RDPD 1KXLA 3J81L 4FDBA 3NXWA 4DK0A 4EX5A 2RVLA 3F2DA 1S3OA 4PG3A 4A3DB 1PTOC 2R61A 3IFDA 2PI2E 4M8AA 1Y1WH 1EYDA 2NVYH 4QB4A 1XMQQ 4GS3A 2CWPA 4LF8L 1VCIA 3D31A 1STYA 4IUNA 2QDBA 3HOXH 1I4XA 5CV5A 5IYBH 4DXFA 1WD1A 3AYHB 2OWOA 3L0OA 3K7UC 2VB3X 1I4PA 2Z4HA 4R4IA 4GOPA 4A3FG 2E2DC 1V1PB 3DEPA 4OONA 1BR9A 2CQAA 5M5XB 3CU7A 1BXTA 3QB3A 5E1FA 1PMRA 3VYRA 5C3EH 2GN5A 1G8ZD 4C3IG 1TT2A 4BA2I 1RIPA 1STNA 3HOVG 3S1MB 2KECA 1VF5C 4AIMA 3IAYA 1QNUA 1SE3A 2E8GA 2X6GA 1HZ9A 4CDEC 1CSPA 2A68D 2JXMB 4KN7C 4A93B 4X3KA 4RHSA 4IUVA 3I4NH 1EY9A 5KNBA 2LSSA 3OW7A 4NPSA 5K5PA 2EE1A 1D1IA 2FFKB 3MAQA 1K8GA 3PF5A 5E3FA 5I6WA 2LXJA 1EIGA 2KEDA 3D0FA 4JBJA 1YBYA 2E2HB 1STBA 1BKBA 1MBYA 3K59A 4NDXA 1HCZA 2Q8IB 4KLKA 4B3TQ 1B8AA 1J9OA 3OPOA 1I50H 4EQPA 3OYYA 1TWGB 1O78A 3GDEA 2FMCA 1MIUA 4P74A 1ENCA 2F0KA 3URYA 3F2CA 4HIDA 4MN3A 5M3FH 1CK1A 2EQSA 4QIWB 4B3RL 1XNRQ 4ME3A 2DY8A 4P71A 3J80c 2JA6G 3GTOB 5EJWA 1XPUA 1PYSB 3W1GA 2JN4A 5FO8B 1VQIA 4K8JA 1II3A 1VDZA 1XTCD 1XX8A 3K7AH 4GN3B 1O7IA 1I3QB 2Y0SB 2JA7B 2F0HA 1IL8A 3DM3A 4DV0L 4AYBE 3HOWB 1D8LA 1S4ZA 3ULPA 1IBMQ 1IBLL 2K32A 3G4SA 2E5LL 1NR2A 4X3TA 3C46A 2Q2HA 3GTLB 3LWEA 1BF4A 4FO2A 1GUNA 1J5EL 3BG3A 1Y8NB 1K3BC 1SBBB 5DEHA 1TWFB 2KJXA 2B2YC 3GTKH 1PRTD 3PO3H 1PZJD 4XTCS 1LO5D 3EFXD 1E1TA 2B2TC 1EU3A 4I65A 3SHLA 3EVQA 2NZ1D 1GD7A 1LLRD 4BY7G 1STHA 1XJVA 4DV5Q 1JC7A 3B6YA 3S16B 4DAVA 3F2BA 4MTKA 2IX3A 4X62Q 5BR8Q 4MNOA 2K6AA 3MXGA 3TBIB 2AKWB 1YEZA 5M5YH 3KUPA 3I91A 2A19A 3M4YA 4J8QA 1EY0A 4J1MA 4TQUS 4KJOA 1EZ8A 4P73A 1ENFA 2MQHA 4OO1H 2R93B 3H0GG 1I6HB 1A3UA 4C3IB 2JE6I 1CZWA 5D3IB 4HSPA 1LT4D 1V9PA 2UUBL 2X69A 5AFWA 5C4JB 3E0EA 2OXPA 1TWAB 4A3FB 4F88A 1E3PA 3ER0A 3SK4A 2K03A 4RH6A 3Q6SA 4HJ8A 1L0XB 2YU9H 2KA7A 1N9WA 4R4QA 2ES2A 5FLXL 1L0WA 3T1HQ 4G7HC 1QVCA 3RZOH 1J8IA 5EKKA 4KMUC 4RAUC 3PMFA 4IPCA 3V96A 4KKSA 4JI8L 1HNZL 3NWTA 3CC2A 4QUCA 1N34L 1AN8A 1F2LA 4R1JA 3M85A 2A73B 4A3GB 2F0VA 1A3VA 4DA2A 3E3XA 1LT6D 2F0JA 3S14H 5CV6A 2CKZB 1YNND 1PH3A 4A3GG 5IP9G 3HKSA 1H9SA 1AH9A 2VW9A 1D6EC 3SEBA 1LTLA 3DUZA 2RDGA 3K57A 4BBRH 5E4XA 1CSQA 1QZGA 4DV2L 2K5NA 4CKEA 1I4RA 4AQYL 4C2MB 3SDZA 4JBKA 2VQFQ 3VR3A 2J4XA 2FHTA 1ILPA 1LTSD 2CQOA 1K8MA 1ZXTA 4JOIC 4UP7A 1I5FA 3NWSA 5C3WA 2I0QA 3M7NA 4GZYC 1V8QA 3HOVH 3VR5A 3BVMA 2V4DA 2OTLA 1STEA 2CH4A 1EIYB 3GO5A 3I4MG 3H3VC 3CP0A 3KJPA 4QCLA 1P8LA 3I8ZA 2H4OA 2K14A 4LJZC 2YYZA 1E1OA 1UWVA 3K5OA 1SFOB 1SLJA 2JJQA 5M5WH 1EQQA 4B3SQ 3RD4A 4HMJA 5IY0A 4YY3Q 1D1KA 1R4QB 4X66L 2MO1A 2NWGA 2M9VA 2NVTH 3J7AF 1FJGQ 4IFDJ 1Q12A 1UE7A 4R4TA 4P72A 3PUXA 2LS01 2PZWA 3MXNA 1KTKA 1PYWD 4LFAQ 5ELFA 2A69D 5CBAE 5ELNA 1TS2A 3TP7A 1HNXL 4LF4Q 4K0KL 4K8IA 4DKAC 4DR3L 4DPGA 4RG1A 4IUUA 1H9SB 1VQ5A 3FPUB 2A6EC 4A3IH 3KYHC 2A1AA 4WFN3 3FPPA 3TS2A 1JCKB 2QCPX 2Y0SE 1B3AA 2MFIA 2HHHQ 4K6DA 2B2WA 4HCSA 5BN3A 4FF3A 3V05A 2Z8LA 3J80E 2ZJQA 3RNUA 5C4XB 2HCIA 1A3TA 5GADC 1O7LA 4A4IA 4DUYQ 1K83B 4X3UA 2B2WC 1SN8A 3BZKA 1WTOA 4DUYL 2K5QA 1BNZA 4POFA 2WP8J 2KCNA 2HDLA 2SEBD 3T13A 1E22A 2AMCB 3CQZB 4XIGS 1LT5D 5LMNW 1A62A 1Y8OB 4J6HA 3HOUH 4JI1L 4FNFA 3CC4A 1X3FA 1S40A 3NPPA 1N34Q 2IPKD 2JK8A 4OIKA 4CDFC 3IKJA 4QF4A 2FJ2A 1S5ED 4K5XA 4DR6L 1DOLA 3EIVA 2F0GA 3D6CA 3SR1A 4A3DH 4N9TA 3CCJA 2D0PA 1F9PA 2K33A 4OWXB 1H9JA 4YWKA 1M90C 3C1FA 4A3IG 3F8TA 4OWTB 5D65A 4ZK9B 3HOWG 2UUBQ 1X6OA 2K50A 1JOOA 4R8IA 3J80i 5ELDA 5EPKA 3NE5B 3CCMA 1SDFA 3I72A 3GV6A 3W3AA 2SNMA 4HJ9A 1IBKQ 2XSCA 3A7LA 3G6JB 4L5RC 5M5XH 5G3LF 2Q8TA 4XYOA 4LF7Q 4KTAA 4ME5A 5IT9c 5C3EB 1QUQA 3BVZA 4A3EG 1EUJA 1VQAA 2MO0A 3AFQA 2NN6G 1HA5A 3TN2A 1QZHA 3KDFA 1C0AA 3S1MH 4LFCL 4DV5L 1BUVT 3X3NA 2RA4A 3E6ZX 1GHKA 4IOAA 1X3GA 3T53B 1QCBD 4HJ5A 3I4NB 1K8OA 2Z6KC 3GTPB 3GTQH 2F0QA 3M3YH 3C3LA 3W2DA 4K0KQ 1I4GA 5M9OA 1HZCA 4RFBA 5C0XH 3RMHA 5FKAC 5JJKA 5LMNQ 2AWNA 2WKDA 1RTOA 1F9RA 4FXKC 1Q81C 1JE4A 1G91A 4HR7B 4GLAC 1STAA 1X55A 4AQYQ 1PRTB 4DR2L 3FDTA 3HOUG 2D0OA 3CCRA 1I50B 5DNFA 4C56C 1MJEA 1DYQA 4ODGA 2JA8G 4CDCC 4IFDI 1A63A 2ZXPA 1VS0A 3AU7A 4DAYB 1JB3A 4DK6C 3T1YQ 1PRTF 3K5LA 5IT9E 3J81c 3W5OA 4HEDA 1PHJA 4DV6Q 5EAYA 1QOHA 4XQNA 3S1QH 3VR4A 4A3EB 3CKIB 5IYCG 3T1YL 3HOWH 2CFMA 4I7AA 3JAME 4UAIA 1UUPA 3BDLA 4AYBB 1XNQQ 4CDDC 3GTLH 2RDHA 3H94A 3KK7A 4KHZA 4KHVA 4XDXA 1Z7TA 3MEFA 3NUCA 5BN5A 1Q8KA 2Z4IA 3N52A 1X32A 2VS1A 3EROA 3VYSA 1TWFH 1ZEQX 5KEEA 1TS4A 3PUVA 3Q24A 3KFUA 4QQBX 3L9AX 2UUAL 1RL2A 1VQNA 2SDFA 4A3MH 3VR6A 2AUKA 2L1BA 1A0IA 4FYDA 2K04A 3KLSA 1N8RC 2L55A 1VQLA 1KAWA 3MTSA 1KDAA 1SE4A 2LXKA 1QILA 3S24A 1HJPA 3HKZG 1FNVA 2ZXOA 5I2YA 3PO2G 3Q8DA 2EPBA 2F0EA 5KYLA 3BZCA 3QR8A 2EXDA 1XNQL 1HFNA 4GKKL 4JI1Q 3H91A 1R4PB 2WAQE 3L3OC 5IGCA 2WAQG 2KCMA 1UE1A 3FMCA 2HDMA 1WCMH 3JAML 4RGNA 3MEHA 3HZXA 3H3VH 3AMUA 1YHBA 4O42A 3DWQA 2D5DA 1IYVA 5ELEA 2ALYB 4DF7A 1IBKL 2EYPA 3J81E 1A15A 4UP8A 5CMDA 3CW2C 1QG7A 4PQXA 1QVGA 2MGSA 2NYZD 1DD2A 3K0YA 2YU9B 2F4VQ 3G71A 1HRJA 4IUTA 1GVPA 1HTPA 2AQ3B 5HGTA 3J80L 3KLSX 1Y1VB 3HOZH 2AWOA 1Y8PB 4JVZA 4L8JA 2NVXH 4V190 4U68A 1PH5A 2KQ3A 2NB0A 3BDCA 4JI0Q 2QDLA 4H44C 4IUPA 4DV1L 3M4OB 3S14B 1BDOA 1TWHH 3KOJA 1NMGA 4PZ8A 1B2TA 2M2LA 2K5VA 1BCPD 4IUQA 4N8X1 4RA8A 3NBHA 3CC7A 1A2UA 2XWJB 4JI5Q 1ET6A 3TREA 2HIVA 1PYBA 2WAQB 2ZJRA 4G4KA 4LF6Q 3HKZE 3BS1A 1E2WA 2VB2X 1ESRA 2KHJA 2Z9HA 1M1KC 2Q2IA 1YITA 4TRDA 4GKJQ 1ASYA 1A2TA 1HA6A 1DM0B 1ZKOA 2VUMB 1G6ZA 3M4QA 2NVQH 1VQEA 3GD7A 5I6YA 3M4PA 4LAAA 5JVG3 4LF9L 5JJIA 3D6WA 1OTCA 1PH6A 1L1OA 3I4MB 1E24A 3KF8B 1X3QA 2Q2TA 2NTTA 1HFGA 4E6IA 2JEAI 3GTGB 1L2FA 4H02A 1K8AC 3SK8A 4Z9CB 4ZRZA 2R92H 1OXXK 3K0XA 3TP8A 3NBHB 5CYUA 4LF6L 1TKWB 1F9QA 3LWUA 3S2HB 2N55A 3HOXG 2QEXA 1SNQA 4OEMB 3RLOA 2KCTA 2YV5A 1PRTC 1RODA 3HG9A 1UEAB 4IOCA 2B2YA 1FJGL 2EJMA 4BXXH 3UDGA 1UE6A 1U0LA 5J3BA 1VQ7A 1EY8A 2R7DA 2JEBI 1SR3A 1L1OB 2BH2A 4L5SA 1VMCA 1M8AA 5L37A 5JPMC 3P20A 3MFGA 2K01A 2EY1A 1TVXA 4F7XA 2JA8B 4YCVA 4K14A 3MFYA 1S5FD 2Y0SG 1VQCA 3MZ5A 2JA5H 3GTMB 1YZ6A 2Z0SA 4JI7Q 3U4ZA 1GUSA 3F1ZA 1RF2D 2PMZE 3OTOL 1PH8A 1YHQA 4Y7NH 5GROA 2OEOA 1BBXC 2F3VA 4JI2Q 1EQRA 4YIJA 4ABNA 4IFDG 4JI6Q 4DR1L 3WWVA 5GAGC 4DV4L 1EWCA 4APVA 5ELCA 1TR5A 4A3BH 5EPLA 5KGUA 3OWFA 5BN4A 2N88A 2VQEQ 5FK9C 4EGVA 5IGDA 1WI5A 1PDQA 3UE0A 1SJED 5IP9H 1PZKD 4JC0A 3PUYA 2A6HD 3QJYA 2KEEA 1Z6HA 3S15B 5I2XA 2UUAQ 1VQBA 1B9NA 2QW7A 3NTHA 2HT1A 1HZAA 1IL2A 1CA6A 4JK1C 3HOUB 1XXGA 3ZYYX 3U58A 1LTBD 2L12A 1F77A 4NKLA 2O4XA 1ZYRC 4WRDA 2JA7G 4IPGA 1XTDA 2D2CC 4A3LG 1G291 2F0WA 3X3MA 3S2DB 1IBLQ 1D5ZC 1QWYA 1FGBD 5E4WC 3PIP3 4B3MQ 3MHBA 3H6MA 1UNSA 1LT3D 4PMCA 3EN2A 2IHEA 1SEBD 3J7YW 2OF1A 3I3CA 1QVFA 2KVMA 3ND9A 4DR2Q 2QEJC 2IX0A 1G51A 3H0GH 3NK9A 3R8BA 5JJLA 3WOFA 3UDFA 1ICFB 2H1EA 5JVH3 1VQ8A 3HOYH 4GNXC 5EPJA 5IGGA 1LTTD 1YIJA 4JBMA 2QILA 5C5MA 4JOIA 2IY5B 2N49A 5JPNC 5M3FG 1TU2B 4C3HG 4OIJA 3KBGA 2GVBA 2KHIA 1DGSA 1U4LA 3CCQA 4K2KA 1YJ9A 4JI3Q 1TWCB 2N78A 1E0BA 2K5HA 1BCPC 2EJFC 3CCLA 1NBWA 3DEOA 1ZYRD 3JC66 1HR0L 1G2TA 4QIWE 2E2IB 3HEJA 1UE5A 2I5LX 4A3JH 1K73C 2F0SA 2F1MA 2VXWA 1C48A 3N6RA 1VF7A 4DUZL 3G7LA 1Q8IA 4HJ7A 4LUOA 1FD7D 3JAMc 4X65Q 2DN8A 1PVOA 1KC8C 2B63H 3R2IA 1HR0Q 2HHHL 2L4NA 5COYA 3VR2A 5M3MH 1PH1A 1QE6A 2ICIA 1O80A 1U4RA 3QWNA 1KRSA 4G57A 2R7FA 4KN4C 2PNRC 1W6KA 4R8NA 4ZKCB 3J7AV 3P1HA 1EEID 2KHSA 3EQLC 1CT1D 1X65A 1WTHA 4C3JG 3J7A5 1BO0A 3HS0C 4LF7L 2NUCA 4K2LA 4BY7H 1ET9A 1GKHA 2L15A 3CCUA 5LMUL 3RUZA 3CRKC 3J7ZC 1X54A 2B3GA 3A8JE 2CCZA 4BBSB 4L5QA 1DOKA 4PV1C 2RHQB 2VZAA 1J6QA 3S1QB 5GQOA 2HCCA 2HQEA 2BA0A 3NENA 2E2JB 1SE8A 2CW0C 3MXNB 3K5MA 4DR4Q 1JWSD 1SJHD 5E7NA 4HJAA 1K3RA 3PO2H 4P2CB 5FLXc 1XYIA 1PZID 2B63G 4B3TL 1BBUA 4QL5A 2JA6H 3KBXA 2F0UA 2RCFA 1TXYA 1GUTA 4H7BA 1XMQL 2FMMA 1JICA 3AB9A 2RF4A 4LNQA 4IFDH 3VDYA 2F0FA 2RBMA 4O0AA 2IX1A 1RD9D 1EY6A 1AE3A 3NSWA 4Q5VA 3K5NA 4BY1G 4OL7A 4OXPA 4RWSC 1PH9A 2CWAA 4DUZQ 3OMGA 2K5DA 1WTRA 2JA5G 5EBDA 5K36H 1PFNA 3GTJH 4X64L 5D3DA 1AW7A 3HRZC 4RGTA 4J15A 1SYGA 5M3MG 5JAVA 5G3LD 4MHEA 2EDGA 1LYLA 1YVCA 4A3DG 1JORA 1WCMB 3IRBA 4OGQC 1M4VA 3I4NG 2EYFA 1IYJB 3RLFA 5AJ3L 2EZVA 4ZUIA 2WB1E 2B2TA 5EBCA 3TSSA 2IHFA 4P75A 2R7ZG 4HN7A 4ZYSA 5IP7G 4YCUA 4IALA 2XRSD 4IURA 4JG2A 3R93A 2O5IC 1QJOA 2BE5C 3T56B 1Y1WB 4UY8C 1CZGA 1YNJC 4A3CG 3T4AC 1BOSA 5JOBA 1STGA 2SOBA 2UUCL 1AZPA 1SE2A 3D3RA 4IO9A 1Q3LA 1OXTA 3D8GA 3FRPB 4A93H 1U9RA 3A8KE 4DFAA 1IKMA 2VL6A 3A54A 1V1QA 3CF5A 4PMWA 3Q22A 3VA7A 3E5SA 3D4RA 2H5XA 2AHOB 3KDFB 1XNRL 1EQVA 3NTKA 4HIMA 3ITPA 4AH6A 1HQMC 2PQAB 2WFWA 4HTHA 2M00A 2XN9C 5EQ0A 3BJUA 4JBWA 1PH4A 4NXMQ 3BU2A 4LWCA 1JWMD 1CA5A 1JWUD 1GUOA 4JPBW 4LFBQ 1HQRD 3MVVA 4MTNA 1YJWA 5EKIA 3CMEA 4UPAA 4FVMA 4KHPQ 2FINB 2IT1A 3CCSA 3HP3A 1NCVA 3PCOB 1H9KA 1NMFA 2ZJPA 1EFID 1HPCA 2KBNA 3S1RH 3GTOH 3SK6A 3UDXA 1HUMA 1TS5A 1HNWQ 2F3WA 1B9MA 3OTOQ 4XT3B 1XPRA 3K7AB 1Q1EA 3A5UA 3FP9A 4C3JB 1KD1C 3S2HH 1HHVA 2ZTCA 4IPDA 2JA7H 1B3QA 4A76A 5LL6S 1IKLA 3A8IE 4JYAQ 1JOQA 3D4DA 5AJ3Q 1C9OA 1WOCA 4KY6A 4PZ7A 4RCOA 3GP7A 1TQOA 4DK3C 4ZKBB 1SXTA 5CV9A 5JEAJ 1VQKA 4YY3L 2F03A 2N8NA 1VQPA 3GTKB 5LHY1 2RDFA 1PH7A 3I4OA 4LF4L 1VQMA 4A3KG 2X6LA 3CD6A 1HUNA 4BA1I 4O2DA 5I9PA 1KQSA 4KJNA 3OWEB 1KDCA 4CKCA 1NNXA 4JI4L 2VUMG 2R6GA 4FXDA 3GTMH 4F87A 4DV7Q 4LF8Q 4N8FA 2A5HA 2CW0D 3CHBD 1EYAA 1MI2A 4Y7NB 3BZDB 2PW5A 2PCFB 5GAHC 2EJGC 3VYUA 4NXNL 3C1EA 5IODA 4KKTA 1RKNA 4LF9Q 1EIFA 2CH4W 2PQEA 4EQNA 2KCCA 3FEWX 1E7ZA 3E9HA 3NEMA 1JB7A 2E5LQ 4GKJL 3C2PA 1TWAH 1JJGA 4EQOA 4DAPA 2TSSA 2EYOA 4OX9Q 1S5BD 4HSVA 4Q0FA 1F2ZA 1CHQD 1SMYD 2N3SA 3UI2A 1NY4A 4A3KH 4KI0A 4FF4A 4KD4A 1BVSA 4L5TA 5A2QE 1EZ6A 3EJIA 1EY5A 4CHTB 1F2MA 4JI0L 4A75A 1EEFD 2D62A 2XWBB 4ID6A 2F0DA 4DGZA 4KK7A 4DAMA 2AQ2B 2K28A 4DR1Q 3CCEA 1B70B 1NUCA 3A0JA 4UDUC 1Z9FA 2VNUD 4EVOA 1MGSA 2UXCQ 1JMCA 1JJ2A 4HMIA 2F4IA 1LV9A 3H15A 1IW7C 4CBVA 3DWAA 1N36Q 3RZOB 1EYCA 2B2UA 5JJZA 2BE5D 4POGA 1CFMA 5CGKA 4B3RQ 4C2MH 4FP5D 1YJNA 3HOYB 1YNJD 2B39A 4GN4B 2A8VA 2MUYA 4KY5A 4LW1A 1GXDC 5FO7B 1HNZQ 4S3SA 2EYHA 2OT2A 2UXDQ 2DUDA 4IJLA 1OXVA 4XXEA 5C44B 3K58A 3HOVB 4RGMA 3NHHA 2R3ZA 2VQEL 2E2IH 2Q8RE 4A3JB 3A55A 4BBRB 1VMPA 1T5EA 4LFBL 4DR7L 4ULLA 4DK1A 1SMXA 2ID0A 5DAUA 2Q2UA 1KNEA 1QNKA 3RZDH 1WD0A 5C6AA 3QIAA 1EOTA 2ENBA 2JA9A 2OCEA 2DJGC 2UU9Q 2PW7A 3KF8A 2HD3A 2B63B 3H09A 5C0XG 1SFOH 3H3VI 5M3MB 2LKVA 2BA1A 2BH8A 2RSOA 3MXUA 4MZ9A 4QUFA 3PF4A 1DZ1A 2EOTA 1GJXA 1BBWA 1MSHA 1X3EA 5C3XA 1AP0A 1CKNA 1B4OA 3NQTA 4L6TB 2C9OA 2QGQA 3PO3G 1N36L 1W6JA 5FJ8G 4BY7B 1FL0A 2PZUA 2MNAA 1CKOA 2R7ZH 3I2ZA 1H95A 4JW0A 2F0OA 2A74C 4RCNA 4PNYA 2B2VC 1R9TB 3KF6A 4TKOB 4DV6L 5M5WB 1HTLD 2F0IA 3RR5A 4FXGC 1J5EQ 1XMOQ 2GVAA 4LUZA 3SGIA 1FR3A 2PQAA 5C0XJ 2A6HC 1N33Q 1VQHA 2NVTB 2DGYA 4O1NA 5JEAG 1U4MA 5F2DA 5C4XH 5I9OA 4JV5L 3PO2B 1S5CD 5C4HA 2F4VL 3DHQA 1LACA 2MHVA 3RLNA 1VQDA 3S9WA 4U673 1AEXA 5ISRA 1MSGA 1I94L 4A3IB 1V1PA 1PA6A 1BCPF 4Y52H 3K81C 2ASBA 4GN5A 3M9BA 1KHIA 3ULLA 1PTOH 2B2UC 5IYBG 1OXSC 2LY7A 4NB3A 1WTPA 3CAMA 2WKCA 1K83H 2Z6KA 4GKKQ 5DM73 1A6XA 1DXMA 1BCPB 5LL6X 4DR7Q 1AFPA 4HAEA 1PFSA 1V43A 4GOPC 1I6VC 3U9OA 4BBSG 4CJ2C 2NTSA 1P16A 1W2BA 3WDNA 4KV6A 3CQZH 2I46A 3QOJA 4G7OC 3IL8A 4GNXA 1WTVA 5IOCA 2ZM6L 3S1NB 2B2VA 1VQ9A 1FGUA 3PV0A 4LFAL 5C5LA 3ERQA 1SNPA 1B44D 1H9RA 1MHWC 2OQ0A 3BVGA 1KNAA 4DR5Q 1RJTA 2MPMA 1DCZA 3CPWA 2BCOA 3I55A 1CKMA 2WV6D 3NQIA 5GAEC 4GOPB 2NZHA 5IE8A 1O7ZA 2P5ZX 1KLGD 1GUGA 4B9XA 1CI3M 1TY2A 3I56A 1GUWA 4CKBA 4IN3A 3HOZG 1N32L 1K28A 1L1OC 1PFMA 2EY2A 1CM9A 3OSOA 3DLLA 2BDOA 2OQKA 1KAAA 4ZLTF 3NELA 1F2YA 3GTQB 3M3YB 4HIOA 2UXBL 1NAPA 5KNCA 4JCVE 4YWLA 2O2LD 1E2VA 4TVAB 5IWAQ 3L7ZC 2F0LA 2EY6A 3TZUA 1H9MA 4XQQA 4YHHQ 2F0TA 1JQYD 1N33L 3OHXC 1WCMG 5J1ZA 1C4QA 3R2TA 4OX9L 1CKNB 1ONLA 1YI2A 2LMCB 2MJ8A 3I90A 1WTXA 2ATWA 3SXHA 3PIOA 1EQTA 3GTPH 2UXDL 5D14A 1KDBA 1SYBA 4V0BA 4X62L 4RHRA 4B3ML 3SE0A 3S1RB 1PFBA 4LUVA 3ICEA 3CXCA 4NXNQ 1LTRD 1Q86C 4DR3Q 2PZTA 4BXXG 1EY4A 5FLMG 4A3EH 2UUCQ 4C3JH 1LTGD 2WINB 4BBRG 4DV3Q 1VQOA 2XGTA 2UXCL 3NP8A 4JI5L 3I4LA 2UXBQ 4C1NK 4PMBA 1YHAA 1BQQT 5FOBB 1YNXA 4G7ZC 4LMQD 1LTID 3AEVA 1EWHA 4QMGA 1TY0A 3Q23A 4NW2A 4C3HH 1T5XD 1HR0W 2IL8A 3I73A 4R9WA 2K1BA 5J39A 2BOSA 2Z1CA 4NMZA 3KLRA 4RKLA 1SNMA 3FKIB 1FYCA 4ILWA 1IHZA 4A3CH 1KLUD 2I5MX 3S17B 4OO1I 4A3MB 4HIKA 3TDQA 2PI2A 1D5XC 3KJOA 1X3PA 2LFNA 3O13A 5HY6A 2JSOA 5C4ZA 3OMCA 5J22A 2R93G 3G6EA 4FF1A 5T1GA 1SSOA 3PGZA 4C1NI 1Q82C 4HCEA 2DNEA 1VQGA 4GNXB 1SYEA 5HGQA 1NTGA 4X65L 1V1OA 2K7VA 1ESFA 3IFTA 1O7YA 1FNUA 2EXZA 2J7ZA 1NR4A 1QUQB 4PZ6A 2NN6H 5ELOA 2IJ0A 5H1SE 3R3OA 3PQIA 5ELBA 4LF5L 2L11A 2NN6I 2ZTDA 3CCVA 3K6OA 1WVLA 1X9NA 4BY1B 2PPBC 1CUKA 1I4QA 1I4HA 2EYMA 4B9WA 2G9HD 3D4WA 3T16A 2VQFL 4K6LA 2QKIC 1E2ZA 1JE5A 1C7YA 1XWEA 3TP5A 3FHWA 3SK5A 5C44G 2YTXA 1HNXQ 3E0JA 4QY7A 1VQ6A 4A3KB 1D5MC 1TIID 2NVYB 5C4XG 4I7ZC 2JYOA 3LX0A 1Y1VH 2PMZB 3TEHB 3HOZB 3T51B 3HOXB 4EQ5A 2G9DA 2DNCA 4B08A 1ASZA 1IBML 4ZQ3A 3J81j 1TS3A 2DJFC 4R4CA 1CQFA 3M4OH 1TWHB 2L0CA 4QJFA 1VQFA 4B3SL 1KRTA 1B50A 2JP1A 3W1BA 2KENA 1D7QA 4XT1B 2ZM6Q 1RCVD 3AQQA 4ZUJA 4X64Q 1L0YB 5CV7A 3A7AB 5LMNL 2EIFA 5IYDH 5NUCA 4A3BG 1G6PA 2AQ1B 1X56A 2E74C 5IGFA 5FJ8H 1SAPA 3NBIA 5I4DA 4GLVB 3TZDA 3ZJYC 3MA2B 2O5JC 5IGEA 2NVXB 2NVQB 2WB1B 1EWIA
chains in the Genus database with same CATH topology
5KIXA 4H13C 2IWHA 4BS9A 1Z47A 3Q0AA 1JR0D 3HKZB 1G2SA 5KYIA 1EIHA 3QOLA 2B8GA 1PTOF 4CJ0B 1ENAA 1ICWA 5A2QL 2R92B 3GQBA 5T1IA 2K05A 4N9PA 5CV8A 5IT9L 5HURA 3PIO3 3RZDB 5KRUA 1IYUA 2QF7A 5TSSA 4DNTB 3LNNA 3MC0B 5M3FB 2MP1A 2CVRA 1KABA 1LABA 1CHPD 4K5WA 2C5CA 2GA4B 4WJWA 2L9HA 1EY7A 3M7GA 2F0MA 4OO1G 2R7ZB 5CBEE 4BWGB 1WTWA 2F0PA 1EL0A 2A69C 3FVQA 2EY5A 2I07B 3DWPA 3A56A 5CV4A 2CHBD 2L5TA 2ZT9C 3DXJC 3PO3B 1QB5D 2RQXA 2PYKA 4DU9A 3ND8A 2E75C 2JA5B 2WIIB 2XRQD 3DMUA 2EYJA 4M1UB 4XQJA 5M5YB 1F9SA 1DOMA 2DY7A 5CC4A 5IGBA 4A3BB 1SYFA 2XIWA 1PTOB 5K36G 2IW3A 2KOLA 3HGBA 4XYQA 4DN4M 4NP5A 4CJ1B 4DNRB 3H0GB 4K5VA 1SNCA 3MWYW 4LK1C 1B53A 1OXUA 5KNDA 2ZXRA 3F2UA 3DM1A 2TMPA 3EA6A 4DAYA 2XNAC 5FLXE 3ONAB 1C8CA 2AUJD 2WACA 1WTQA 2RSNA 1YNNC 4KY7A 2D9UA 1U4PA 4FF2A 1PXUA 2J0TD 3BDOA 3VYTA 1MD2D 1OO9B 3BYTB 3GV3A 3P75A 1HXYD 1Q90A 3U9SA 1RHPA 4TSSA 3OIQA 1FNWA 1ML0D 2A68C 2E76C 2HUGA 1S5DD 5EKLA 2EYLA 3PUZA 4MIUA 2EVBA 4F8MA 4ZAIA 1ILQA 1Y69U 2KUMA 3TP6A 1SYDA 1CTMA 2A6ED 1B1ZA 3VA5A 5DM63 1D2BA 1CQVA 1LTAD 3V2TA 2ICEC 4WORA 2K5WA 3MXPA 4KD3A 3NTIA 3TMEA 5IIFA 4C3HB 2JA6B 1SNDA 4IZ8A 1SYCA 5CORA 3CRLC 4RKBA 1PTOD 1DJRD 3PUWA 1IW7D 4KKUA 4CGYB 1GOZA 5A35A 2XVSA 3QG1A 2SNSA 1UAPA 2NBFA 1SNOA 4IQZA 4OHJA 1RTNA 3GTJB 4X3SA 1AZQA 1JOKA 1EU4A 1NSNS 3WOEA 1GHJA 2BDNA 5C0XI 3OOCA 5CR3A 2B8FA 3P7JA 3I70A 5EGTA 4H0LC 3SVMA 1DONA 1Q1BA 5FO9B 1PLFA 2RKSA 4RGOS 2PO4A 1SMYC 5JEAH 3OIPA 4L63B 3QO2A 3BYYB 2F0NA 4DXGA 1RDPD 3J81L 3NXWA 4DK0A 2RVLA 4A3DB 1PTOC 2R61A 3IFDA 4M8AA 1EYDA 4QB4A 1VCIA 3D31A 1STYA 4IUNA 2QDBA 1I4XA 5CV5A 4DXFA 1WD1A 2VB3X 1I4PA 2Z4HA 2E2DC 1V1PB 3DEPA 1BR9A 2CQAA 5M5XB 3CU7A 1BXTA 3QB3A 5E1FA 1PMRA 3VYRA 1G8ZD 4C3IG 1TT2A 4BA2I 1STNA 3S1MB 2KECA 1VF5C 3IAYA 1QNUA 1SE3A 2X6GA 2A68D 2JXMB 4KN7C 4A93B 4X3KA 4RHSA 4IUVA 1EY9A 5KNBA 3OW7A 5K5PA 2EE1A 1D1IA 2FFKB 3MAQA 5E3FA 5I6WA 1EIGA 2KEDA 2E2HB 1STBA 1MBYA 3K59A 4NDXA 1HCZA 2Q8IB 1J9OA 3OPOA 4EQPA 1TWGB 1O78A 2FMCA 1ENCA 2F0KA 3URYA 4MN3A 1CK1A 4QIWB 2DY8A 3GTOB 5EJWA 5FO8B 4K8JA 1II3A 1VDZA 1XTCD 1XX8A 1I3QB 2Y0SB 2JA7B 2F0HA 1IL8A 3HOWB 1S4ZA 2K32A 1NR2A 4X3TA 3C46A 3GTLB 3LWEA 1BF4A 4FO2A 1GUNA 3BG3A 1Y8NB 1SBBB 5DEHA 1TWFB 2KJXA 2B2YC 1PRTD 1PZJD 4XTCS 1LO5D 3EFXD 2B2TC 1EU3A 4I65A 3SHLA 3EVQA 2NZ1D 1LLRD 1STHA 1JC7A 3S16B 4DAVA 2IX3A 2K6AA 3MXGA 3TBIB 3KUPA 3I91A 3M4YA 4J8QA 1EY0A 4J1MA 4TQUS 4KJOA 1EZ8A 1ENFA 4OO1H 2R93B 1I6HB 1A3UA 4C3IB 2JE6I 1CZWA 5D3IB 4HSPA 1LT4D 2X69A 5AFWA 5C4JB 2OXPA 1TWAB 4A3FB 4F88A 3SK4A 2K03A 4RH6A 3Q6SA 1L0XB 2KA7A 5FLXL 4G7HC 1J8IA 5EKKA 4KMUC 4RAUC 3PMFA 3V96A 4KKSA 3NWTA 4QUCA 1AN8A 1F2LA 3M85A 2A73B 4A3GB 2F0VA 1A3VA 4DA2A 1LT6D 2F0JA 5CV6A 1YNND 1H9SA 1D6EC 3SEBA 3DUZA 2RDGA 3K57A 5E4XA 4CKEA 1I4RA 4C2MB 3SDZA 3VR3A 2J4XA 2FHTA 1ILPA 1LTSD 1K8MA 1ZXTA 3NWSA 5C3WA 3M7NA 4GZYC 1V8QA 3VR5A 3BVMA 2V4DA 1STEA 3GO5A 3H3VC 4QCLA 3I8ZA 2H4OA 4LJZC 2YYZA 3K5OA 1SFOB 3RD4A 4HMJA 1D1KA 1R4QB 2NWGA 2M9VA 3J7AF 4IFDJ 1Q12A 3PUXA 2LS01 2PZWA 3MXNA 1KTKA 1PYWD 5ELFA 2A69D 5CBAE 1TS2A 3TP7A 4K8IA 4IUUA 1H9SB 3FPUB 2A6EC 4WFN3 3FPPA 1JCKB 2QCPX 1B3AA 4K6DA 2B2WA 4HCSA 5BN3A 4FF3A 3V05A 2Z8LA 3J80E 5C4XB 2HCIA 1A3TA 1O7LA 1K83B 4X3UA 2B2WC 1WTOA 2K5QA 1BNZA 2WP8J 2KCNA 2HDLA 2SEBD 3T13A 3CQZB 4XIGS 1LT5D 1Y8OB 4J6HA 4FNFA 3NPPA 2IPKD 4OIKA 3IKJA 4QF4A 2FJ2A 1S5ED 4K5XA 1DOLA 2F0GA 3D6CA 3SR1A 4N9TA 1F9PA 2K33A 1H9JA 3C1FA 5D65A 4ZK9B 1JOOA 4R8IA 5ELDA 5EPKA 3NE5B 1SDFA 3I72A 3GV6A 3W3AA 2SNMA 2XSCA 3A7LA 3G6JB 5G3LF 2Q8TA 4XYOA 4KTAA 4ME5A 5C3EB 3BVZA 2NN6G 1HA5A 3TN2A 1BUVT 3X3NA 2RA4A 3E6ZX 1GHKA 3T53B 1QCBD 3I4NB 1K8OA 3GTPB 2F0QA 3C3LA 3W2DA 1I4GA 5M9OA 4RFBA 5C0XH 3RMHA 5FKAC 2AWNA 2WKDA 1RTOA 1F9RA 4FXKC 1JE4A 1G91A 4HR7B 1STAA 1PRTB 3FDTA 1I50B 5DNFA 4C56C 1DYQA 4ODGA 4IFDI 2ZXPA 3AU7A 1JB3A 1PRTF 3K5LA 5IT9E 4HEDA 1QOHA 4XQNA 3VR4A 4A3EB 3CKIB 3JAME 4UAIA 1UUPA 3BDLA 4AYBB 2RDHA 3H94A 3KK7A 4KHZA 4KHVA 4XDXA 1Z7TA 3NUCA 5BN5A 2Z4IA 3N52A 1X32A 3EROA 3VYSA 1ZEQX 5KEEA 1TS4A 3PUVA 3Q24A 3L9AX 2SDFA 3VR6A 2AUKA 2L1BA 4FYDA 2K04A 3KLSA 2L55A 3MTSA 1KDAA 1SE4A 1QILA 1FNVA 2ZXOA 5I2YA 2EPBA 2F0EA 5KYLA 1HFNA 3H91A 1R4PB 3L3OC 5IGCA 3FMCA 2HDMA 3JAML 4RGNA 3MEHA 3HZXA 3AMUA 4O42A 3DWQA 2D5DA 1IYVA 5ELEA 4DF7A 2EYPA 3J81E 1A15A 5CMDA 1QG7A 4PQXA 2MGSA 2NYZD 1DD2A 3K0YA 2YU9B 1HRJA 4IUTA 1HTPA 2AQ3B 5HGTA 3J80L 3KLSX 1Y1VB 2AWOA 1Y8PB 4L8JA 4V190 4U68A 2KQ3A 2NB0A 3BDCA 4H44C 4IUPA 3M4OB 3S14B 1BDOA 1B2TA 2M2LA 1BCPD 4IUQA 4RA8A 3NBHA 1A2UA 2XWJB 1ET6A 2WAQB 4G4KA 3BS1A 1E2WA 2VB2X 1ESRA 4TRDA 1A2TA 1HA6A 1DM0B 1ZKOA 2VUMB 1G6ZA 3GD7A 5I6YA 4LAAA 5JVG3 3D6WA 3I4MB 1X3QA 2NTTA 1HFGA 4E6IA 2JEAI 3GTGB 3SK8A 4Z9CB 4ZRZA 1OXXK 3TP8A 5CYUA 1TKWB 1F9QA 3LWUA 3S2HB 2N55A 1SNQA 1PRTC 1RODA 3HG9A 1UEAB 2B2YA 2EJMA 1EY8A 2JEBI 1VMCA 1M8AA 5JPMC 3P20A 3MFGA 2K01A 2EY1A 1TVXA 4F7XA 2JA8B 4K14A 3MFYA 1S5FD 3MZ5A 3GTMB 1GUSA 1RF2D 2OEOA 1BBXC 2F3VA 4YIJA 4ABNA 4IFDG 1EWCA 5ELCA 1TR5A 5EPLA 5KGUA 3OWFA 5BN4A 2N88A 5FK9C 4EGVA 5IGDA 1PDQA 1SJED 1PZKD 3PUYA 2A6HD 3QJYA 2KEEA 1Z6HA 3S15B 5I2XA 1B9NA 3NTHA 1CA6A 4JK1C 3HOUB 1XXGA 3ZYYX 1LTBD 2L12A 1F77A 4NKLA 2O4XA 1ZYRC 4WRDA 2D2CC 1G291 2F0WA 3X3MA 3S2DB 1D5ZC 1QWYA 1FGBD 5E4WC 3PIP3 3MHBA 3H6MA 1UNSA 1LT3D 4PMCA 1SEBD 3J7YW 2OF1A 3I3CA 2KVMA 3ND9A 2QEJC 2IX0A 3NK9A 3R8BA 3WOFA 2H1EA 5JVH3 5EPJA 5IGGA 1LTTD 2QILA 5C5MA 5JPNC 1TU2B 4C3HG 4OIJA 3KBGA 1U4LA 4K2KA 1TWCB 1E0BA 1BCPC 2EJFC 3DEOA 1ZYRD 1G2TA 2E2IB 3HEJA 2F0SA 2F1MA 2VXWA 1C48A 3N6RA 1VF7A 3G7LA 1Q8IA 1FD7D 2DN8A 3R2IA 2L4NA 5COYA 3VR2A 1QE6A 1O80A 1U4RA 2ICIA 2PNRC 3QWNA 4G57A 4KN4C 4R8NA 4ZKCB 1W6KA 3J7AV 3P1HA 1EEID 2KHSA 3EQLC 1CT1D 4C3JG 1BO0A 3HS0C 2NUCA 4K2LA 1ET9A 3RUZA 3CRKC 3A8JE 4BBSB 1DOKA 4PV1C 3S1QB 2HCCA 2HQEA 2BA0A 2E2JB 2CW0C 3K5MA 1JWSD 1SJHD 4P2CB 1XYIA 1PZID 3KBXA 2F0UA 1GUTA 4H7BA 2FMMA 1JICA 3AB9A 4IFDH 2F0FA 2RBMA 2IX1A 1RD9D 1EY6A 3NSWA 4Q5VA 3K5NA 4OL7A 4RWSC 3OMGA 2K5DA 1WTRA 5K36H 5EBDA 1PFNA 5D3DA 1AW7A 3HRZC 4RGTA 1SYGA 5JAVA 5G3LD 4MHEA 2EDGA 1JORA 1WCMB 4OGQC 1M4VA 2EYFA 3RLFA 2EZVA 4ZUIA 5EBCA 2B2TA 3TSSA 4HN7A 4ZYSA 4IALA 2XRSD 4IURA 2O5IC 3R93A 1QJOA 2BE5C 3T56B 1Y1WB 1CZGA 1YNJC 3T4AC 1BOSA 5JOBA 1STGA 2SOBA 1AZPA 1SE2A 3D3RA 1Q3LA 1OXTA 3D8GA 3FRPB 1U9RA 3A8KE 4DFAA 1IKMA 3A54A 4PMWA 3Q22A 3VA7A 3E5SA 3D4RA 1EQVA 3NTKA 3ITPA 1HQMC 4HTHA 2M00A 2XN9C 5EQ0A 4JBWA 1JWMD 1CA5A 1JWUD 1GUOA 1HQRD 3MVVA 5EKIA 4FVMA 2FINB 2IT1A 3HP3A 1NCVA 1H9KA 1EFID 1HPCA 3SK6A 1HUMA 1TS5A 2F3WA 1B9MA 4XT3B 3K7AB 1Q1EA 4C3JB 1HHVA 5LL6S 1IKLA 3A8IE 1JOQA 3D4DA 4KY6A 4RCOA 3GP7A 1TQOA 4ZKBB 1SXTA 5CV9A 5JEAJ 2F03A 3GTKB 5LHY1 2RDFA 2X6LA 1HUNA 4BA1I 5I9PA 4KJNA 3OWEB 1KDCA 4CKCA 2R6GA 4FXDA 4F87A 2A5HA 2CW0D 3CHBD 1EYAA 1MI2A 4Y7NB 3BZDB 2PW5A 2PCFB 2EJGC 3VYUA 3C1EA 5IODA 4KKTA 1RKNA 2PQEA 4EQNA 2KCCA 3FEWX 3C2PA 4EQOA 4DAPA 2TSSA 2EYOA 1S5BD 4HSVA 4Q0FA 1F2ZA 1SMYD 1CHQD 3UI2A 4KI0A 4FF4A 4KD4A 5A2QE 1EZ6A 3EJIA 1EY5A 4CHTB 1F2MA 1EEFD 2D62A 2XWBB 4ID6A 2F0DA 4DGZA 4KK7A 2AQ2B 2K28A 1NUCA 4UDUC 2VNUD 4EVOA 1MGSA 4HMIA 2F4IA 1LV9A 1IW7C 4CBVA 3DWAA 3RZOB 1EYCA 2B2UA 5JJZA 2BE5D 1CFMA 5CGKA 4FP5D 3HOYB 1YNJD 2B39A 2MUYA 4KY5A 1GXDC 5FO7B 4S3SA 2EYHA 2OT2A 1OXVA 4XXEA 5C44B 3K58A 3HOVB 4RGMA 3NHHA 2R3ZA 2Q8RE 4A3JB 3A55A 4BBRB 1VMPA 1T5EA 4ULLA 4DK1A 2ID0A 5DAUA 1KNEA 1QNKA 1WD0A 5C6AA 3QIAA 1EOTA 2ENBA 2PW7A 3KF8A 2B63B 3H09A 5C0XG 5M3MB 2LKVA 2BA1A 1DZ1A 2RSOA 3MXUA 4QUFA 2EOTA 1GJXA 1MSHA 5C3XA 1AP0A 1B4OA 3NQTA 4L6TB 2C9OA 1W6JA 4BY7B 2PZUA 2F0OA 2A74C 4RCNA 4PNYA 2B2VC 1R9TB 4TKOB 5M5WB 1HTLD 2F0IA 4FXGC 1FR3A 5C0XJ 2A6HC 2NVTB 4O1NA 5JEAG 1U4MA 5F2DA 5I9OA 3PO2B 1S5CD 5C4HA 3DHQA 1LACA 2MHVA 3S9WA 4U673 1AEXA 5ISRA 1MSGA 4A3IB 1V1PA 1BCPF 1PTOH 2B2UC 1OXSC 2LY7A 1WTPA 2WKCA 1AFPA 5DM73 1A6XA 5LL6X 1DXMA 1BCPB 4HAEA 1V43A 1I6VC 3U9OA 4CJ2C 2NTSA 3WDNA 4KV6A 2I46A 3QOJA 4G7OC 3IL8A 1WTVA 5IOCA 3S1NB 2B2VA 3PV0A 5C5LA 3ERQA 1SNPA 1B44D 1H9RA 3BVGA 1KNAA 1RJTA 2MPMA 1DCZA 2BCOA 2WV6D 3NQIA 1O7ZA 1KLGD 1GUGA 4B9XA 1CI3M 1TY2A 1GUWA 4CKBA 4IN3A 1PFMA 2EY2A 1CM9A 3OSOA 2BDOA 1KAAA 4ZLTF 1F2YA 3GTQB 3M3YB 1NAPA 5KNCA 2O2LD 1E2VA 3L7ZC 2F0LA 2EY6A 3TZUA 1H9MA 4XQQA 2F0TA 1JQYD 3OHXC 5J1ZA 1C4QA 3R2TA 1ONLA 2LMCB 2MJ8A 3I90A 1WTXA 3SXHA 1EQTA 5D14A 1KDBA 1SYBA 4V0BA 4RHRA 3SE0A 3S1RB 1PFBA 1LTRD 2PZTA 1EY4A 1LTGD 2WINB 3NP8A 3I4LA 4C1NK 4PMBA 1BQQT 5FOBB 4G7ZC 4LMQD 1LTID 1EWHA 4QMGA 1TY0A 3Q23A 4NW2A 1T5XD 2IL8A 3I73A 4R9WA 2K1BA 5J39A 2BOSA 2Z1CA 4NMZA 3KLRA 4RKLA 1SNMA 3FKIB 1FYCA 4ILWA 1IHZA 1KLUD 3S17B 4OO1I 4A3MB 3TDQA 1D5XC 1X3PA 2LFNA 5J22A 3O13A 2JSOA 5C4ZA 3OMCA 4FF1A 5T1GA 1SSOA 4C1NI 4HCEA 2DNEA 1SYEA 1V1OA 2K7VA 1ESFA 3IFTA 1O7YA 1FNUA 2EXZA 2J7ZA 1NR4A 2NN6H 2IJ0A 3R3OA 5ELBA 2L11A 2NN6I 3K6OA 1WVLA 4BY1B 2PPBC 1I4QA 1I4HA 2EYMA 4B9WA 2G9HD 3D4WA 3T16A 4K6LA 2QKIC 1E2ZA 1XWEA 3TP5A 3SK5A 3E0JA 4A3KB 1D5MC 1TIID 2NVYB 4I7ZC 2JYOA 3LX0A 2PMZB 3HOZB 3T51B 3HOXB 2G9DA 2DNCA 4B08A 4ZQ3A 1TS3A 1CQFA 1TWHB 2L0CA 1B50A 2JP1A 4XT1B 1RCVD 4ZUJA 1L0YB 5CV7A 3A7AB 5NUCA 2AQ1B 2E74C 5IGFA 1SAPA 3NBIA 5I4DA 2O5JC 3TZDA 2NVXB 3MA2B 5IGEA 2NVQB 2WB1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NW2 A;  2B2T C;  2DY7 A;  1WD0 A;  1MI2 A;  2IL8 A;  3IL8 A;  1EOT A;  4R9W A;  1WTV A;  2K1B A;  2B2V A;  2KEE A;  4UAI A;  1ESR A;  2NZ1 D;  1AZP A;  2XIW A;  3DEP A;  1Q3L A;  1F9P A;  1G2S A;  1KNA A;  1EIH A;  2KOL A;  1CA6 A;  1HA6 A;  4XDX A;  4CJ0 B;  1DZ1 A;  2RSO A;  4QUF A;  1ICW A;  1RJT A;  1DOK A;  2MPM A;  1IKM A;  4DN4 M;  2EOT A;  1G6Z A;  5D65 A;  4ZK9 B;  3N52 A;  1MSH A;  1X32 A;  1X3P A;  2L12 A;  1AP0 A;  2KEC A;  5T1I A;  1B4O A;  3I8Z A;  2K05 A;  3D6W A;  4R8I A;  3KUP A;  5T1G A;  1O7Z A;  2HCC A;  1SSO A;  3I91 A;  5EPK A;  4CJ1 B;  1X3Q A;  2X6G A;  1SDF A;  1HFG A;  3GV6 A;  4X3K A;  2SDF A;  4IUV A;  1GUW A;  2L1B A;  1O7Y A;  5E4W C;  5COR A;  2K04 A;  5EQ0 A;  3MWY W;  2J7Z A;  1PFM A;  1B53 A;  1NR4 A;  4HSV A;  2Q8T A;  1ILP A;  1CM9 A;  3MTS A;  1CA5 A;  3UI2 A;  2EE1 A;  2X69 A;  2FFK B;  1F9Q A;  2NWG A;  5AFW A;  4ZLT F;  2N55 A;  2L11 A;  3I3C A;  2KVM A;  1XYI A;  2B2V C;  2MP1 A;  2CVR A;  3TN2 A;  1EIG A;  1WVL A;  2KED A;  5EKI A;  1NAP A;  2EPB A;  3F2U A;  3DM1 A;  3KBX A;  2K03 A;  2RA4 A;  3Q6S A;  1HFN A;  1ROD A;  3H91 A;  3ONA B;  2FIN B;  2H1E A;  2FMM A;  1JIC A;  2L9H A;  2B2Y A;  3HP3 A;  1NCV A;  1RTN A;  5CBA E;  1J9O A;  4X3S A;  1C8C A;  1AZQ A;  2HDM A;  2K28 A;  5EPJ A;  1J8I A;  2BDN A;  4RAU C;  4IUU A;  1WTQ A;  1HUM A;  2RSN A;  1U4M A;  4RWS C;  3FPU B;  5CBE E;  4O42 A;  2D9U A;  4XT3 B;  1U4P A;  4OIJ A;  1MGS A;  3P7J A;  4QUC A;  1WTW A;  1WTR A;  1U4L A;  1F2L A;  3SVM A;  1EL0 A;  1HHV A;  4MN3 A;  1DON A;  1A15 A;  2MJ8 A;  1VMC A;  1M8A A;  1PFN A;  3I90 A;  5CMD A;  1B3A A;  1WTX A;  1LV9 A;  1E0B A;  1RTO A;  1PLF A;  1IKL A;  1F9R A;  2JYO A;  2K01 A;  3GV3 A;  1JE4 A;  1QG7 A;  1TVX A;  1G91 A;  2DY8 A;  3DEO A;  2B2U A;  2B2W A;  1EQT A;  4HCS A;  2MGS A;  2NYZ D;  5EJW A;  5JJZ A;  1G2T A;  5D14 A;  3FDT A;  1MSG A;  3QO2 A;  2HCI A;  1RHP A;  1XX8 A;  2VXW A;  4MHE A;  1HRJ A;  5DNF A;  4ZKB B;  4X3U A;  2B2W C;  4IUT A;  3G7L A;  1ML0 D;  1PFB A;  1IL8 A;  1WTO A;  2RVL A;  1S4Z A;  1BBX C;  1BNZ A;  5E4X A;  2HUG A;  1B50 A;  2JP1 A;  2HDL A;  3IFD A;  4XT1 B;  1NR2 A;  4U68 A;  4X3T A;  2B2U C;  2L4N A;  3LWE A;  2X6L A;  5COY A;  2B2T A;  1BF4 A;  1HUN A;  1WTP A;  5EPL A;  4IUP A;  1QE6 A;  1O80 A;  1U4R A;  4ZAI A;  2R3Z A;  1ILQ A;  4ZKC B;  4HAE A;  4HED A;  2Q8R E;  4OIK A;  2M2L A;  1B2T A;  2B2Y C;  1VMP A;  2FHT A;  2N88 A;  4IUR A;  4IUQ A;  4RA8 A;  1SAP A;  2FJ2 A;  2KUM A;  3R93 A;  1F9S A;  4CJ2 C;  1WD1 A;  4LMQ D;  3TZD A;  1DOL A;  1ZXT A;  1BO0 A;  1PDQ A;  1KNE A;  1QNK A;  1DOM A; 
#chains in the Genus database with same CATH topology
 5KIX A;  4A3J G;  4H13 C;  2IWH A;  4BS9 A;  1Z47 A;  3I4M H;  4WJ4 A;  3Q0A A;  1JR0 D;  3HKZ B;  1G2S A;  5KYI A;  1EIH A;  3QOL A;  2B8G A;  1PTO F;  4CJ0 B;  5C44 H;  1ENA A;  1A8V A;  1ICW A;  5A2Q L;  2OTJ A;  2R92 B;  3GQB A;  5T1I A;  2K05 A;  2E2H H;  4N9P A;  5CV8 A;  2B29 A;  5IT9 L;  5HUR A;  4A93 G;  3HOY G;  4JI6 L;  3PIO 3;  3RZD B;  4DV2 Q;  5KRU A;  1LM0 A;  1IYU A;  3PSI A;  2VUM H;  1TWG H;  1K0R A;  2QF7 A;  5TSS A;  4DNT B;  1PV4 A;  4JI7 L;  1GM5 A;  3J81 i;  3I7F A;  3LNN A;  3MC0 B;  3KLW A;  5IP7 H;  5M3F B;  2MP1 A;  2CVR A;  2YTY A;  3GTG H;  1KAB A;  4DR5 L;  1LAB A;  1CHP D;  2C35 B;  4JYA L;  4K5W A;  2C5C A;  2GA4 B;  4WJW A;  4LFC Q;  3A5Z B;  1Y1W G;  2L9H A;  1EY7 A;  4JI8 Q;  1I3Q H;  3M7G A;  2F0M A;  2JA8 H;  4OO1 G;  3RN5 A;  2R7Z B;  1NJI C;  4X66 Q;  1SRO A;  5CBE E;  3UE1 A;  3U50 C;  4ZCK A;  2RCN A;  4YWM A;  4BWG B;  1WTW A;  1N32 Q;  2F0P A;  4DR4 L;  1EL0 A;  1K9M C;  2A69 C;  1R9T H;  4YCW A;  3FVQ A;  1VQ4 A;  2EY5 A;  3E9I A;  2I07 B;  3DWP A;  4DNI A;  4WJ3 M;  3A56 A;  5CV4 A;  2CHB D;  5IYD G;  5IYC H;  2L5T A;  2ZT9 C;  1JT8 A;  3DXJ C;  3PO3 B;  3CMA A;  4NXM L;  3OW2 A;  4OWW B;  1HNW L;  3EBE A;  1QB5 D;  3HFZ B;  5LMU Q;  2I5H A;  1WJJ A;  2VY3 A;  4UHV A;  2RQX A;  3T1H L;  2PYK A;  4DU9 A;  1Q7Y C;  3ND8 A;  2E75 C;  2JA5 B;  3S16 H;  2WII B;  2XRQ D;  3DMU A;  2EYJ A;  3STB C;  4DR6 Q;  4M1U B;  4XQJ A;  2F52 A;  3ERS X;  3AFP A;  4A3M G;  5M5Y B;  2FXQ A;  4LF5 Q;  1F9S A;  5DLQ E;  1MJC A;  3ULJ A;  1AE2 A;  1LUZ A;  1DOM A;  3FKI G;  2DY7 A;  5CC4 A;  5IGB A;  4A3B B;  1SYF A;  2R93 H;  2XIW A;  1PTO B;  1I6H H;  4C3I H;  2K75 A;  5K36 G;  2IW3 A;  1B7Y B;  1K0S A;  2KOL A;  2NZO A;  3HGB A;  4XYQ A;  5C4J H;  4DN4 M;  1VQJ A;  4A3F H;  4DV1 Q;  4DV3 L;  1HZB A;  4NP5 A;  3S15 H;  4CJ1 B;  2G5D A;  3K8A A;  4DNR B;  3H0G B;  3S1N H;  4K5V A;  1SNC A;  3MWY W;  4LK1 C;  1B53 A;  2JQO A;  1OXU A;  1NE3 A;  2HQL A;  3CPF A;  2YTV A;  5KND A;  2ZXR A;  4A3G H;  3S2D H;  4JI4 Q;  3F2U A;  3DM1 A;  2TMP A;  3EA6 A;  1GO3 E;  1Q46 A;  4DAY A;  1XMO L;  1HH2 P;  2XNA C;  5FLX E;  1WYD A;  3ONA B;  3LGJ A;  1IXR A;  1C8C A;  2AUJ D;  3L2P A;  2WAC A;  1Y1V G;  1WTQ A;  2RSN A;  1YNN C;  1T9H A;  4KY7 A;  2RHS B;  2D9U A;  1U4P A;  4FF2 A;  1PXU A;  2J0T D;  4KHP L;  3BDO A;  3VYT A;  1MD2 D;  1OO9 B;  3BYT B;  3GV3 A;  1WFQ A;  3P75 A;  4DV4 Q;  1HXY D;  1Q90 A;  3TRZ A;  3U9S A;  1RHP A;  4TSS A;  3OIQ A;  1FNW A;  1ML0 D;  2A68 C;  1TWC H;  5FLM H;  3KF6 B;  2R92 G;  4YHH L;  2E76 C;  2HUG A;  1Y14 B;  1KIX A;  3TS0 A;  4QGU A;  1S5D D;  5EKL A;  2EYL A;  3PUZ A;  4MIU A;  2EVB A;  1U5K A;  1EYG A;  4F8M A;  4ZAI A;  1MKH A;  1ILQ A;  4DV7 L;  1EOV A;  3JAM i;  2WB1 G;  1Y69 U;  1S72 A;  2HIX A;  2KUM A;  3TP6 A;  3PIP A;  1SYD A;  2XTI A;  1CTM A;  2A6E D;  1B1Z A;  3VA5 A;  1FVI A;  4JI2 L;  2E2J H;  5DM6 3;  1D2B A;  1XPO A;  1CQV A;  1LTA D;  4ALP A;  3V2T A;  2ICE C;  4WOR A;  1W3S A;  2K5W A;  1PH2 A;  3MXP A;  4KD3 A;  3NTI A;  3STB D;  3TME A;  4AYB G;  5IIF A;  4C3H B;  4BBS H;  2ZTE A;  2JA6 B;  1SND A;  4OEL B;  1IZ6 A;  4IZ8 A;  4R4O A;  2PNH A;  1SYC A;  4IJH A;  5COR A;  3FKI H;  1UEB A;  3CRL C;  4RMF A;  4RKB A;  1PTO D;  3U4V A;  3A74 A;  1DJR D;  3PUW A;  3S17 H;  1IW7 D;  5BR8 L;  3G48 A;  4KKU A;  4CGY B;  1I94 Q;  3K80 C;  2V1C C;  1EFW A;  1GOZ A;  5A35 A;  2XVS A;  1JJC B;  3TQY A;  3QG1 A;  1SRU A;  2SNS A;  1UAP A;  2NBF A;  1SNO A;  4A3L H;  4IQZ A;  4OHJ A;  2UU9 L;  4X6A H;  1RTN A;  3GTJ B;  2F3I A;  4X3S A;  4JV5 Q;  1AZQ A;  1JOK A;  1EU4 A;  1NSN S;  3WOE A;  1GHJ A;  2BDN A;  5C0X I;  3OOC A;  5CR3 A;  2B8F A;  3P7J A;  3I70 A;  5EGT A;  4IPH A;  4H0L C;  3SVM A;  4GLX A;  5C3E G;  5IWA L;  1DON A;  1Q1B A;  5FO9 B;  1PLF A;  2K52 A;  1KL9 A;  4BY1 H;  2K4K A;  2RKS A;  2PO4 A;  1SMY C;  4RGO S;  3UDI A;  5JEA H;  3OIP A;  2QA4 A;  4L63 B;  3RN2 A;  3QO2 A;  4UP9 A;  3BYY B;  4JI3 L;  4DV0 Q;  2Z6B A;  2F0N A;  4DXG A;  1RDP D;  1KXL A;  3J81 L;  4FDB A;  3NXW A;  4DK0 A;  4EX5 A;  2RVL A;  3F2D A;  1S3O A;  4PG3 A;  4A3D B;  1PTO C;  2R61 A;  3IFD A;  2PI2 E;  4M8A A;  1Y1W H;  1EYD A;  2NVY H;  4QB4 A;  1XMQ Q;  4GS3 A;  2CWP A;  4LF8 L;  1VCI A;  3D31 A;  1STY A;  4IUN A;  2QDB A;  3HOX H;  1I4X A;  5CV5 A;  5IYB H;  4DXF A;  1WD1 A;  3AYH B;  2OWO A;  3L0O A;  3K7U C;  2VB3 X;  1I4P A;  2Z4H A;  4R4I A;  4GOP A;  4A3F G;  2E2D C;  1V1P B;  3DEP A;  4OON A;  1BR9 A;  2CQA A;  5M5X B;  3CU7 A;  1BXT A;  3QB3 A;  5E1F A;  1PMR A;  3VYR A;  5C3E H;  2GN5 A;  1G8Z D;  4C3I G;  1TT2 A;  4BA2 I;  1RIP A;  1STN A;  3HOV G;  3S1M B;  2KEC A;  1VF5 C;  4AIM A;  3IAY A;  1QNU A;  1SE3 A;  2E8G A;  2X6G A;  1HZ9 A;  4CDE C;  1CSP A;  2A68 D;  2JXM B;  4KN7 C;  4A93 B;  4X3K A;  4RHS A;  4IUV A;  3I4N H;  1EY9 A;  5KNB A;  2LSS A;  3OW7 A;  4NPS A;  5K5P A;  2EE1 A;  1D1I A;  2FFK B;  3MAQ A;  1K8G A;  3PF5 A;  5E3F A;  5I6W A;  2LXJ A;  1EIG A;  2KED A;  3D0F A;  4JBJ A;  1YBY A;  2E2H B;  1STB A;  1BKB A;  1MBY A;  3K59 A;  4NDX A;  1HCZ A;  2Q8I B;  4KLK A;  4B3T Q;  1B8A A;  1J9O A;  3OPO A;  1I50 H;  4EQP A;  3OYY A;  1TWG B;  1O78 A;  3GDE A;  2FMC A;  1MIU A;  4P74 A;  1ENC A;  2F0K A;  3URY A;  3F2C A;  4HID A;  4MN3 A;  5M3F H;  1CK1 A;  2EQS A;  4QIW B;  4B3R L;  1XNR Q;  4ME3 A;  2DY8 A;  4P71 A;  3J80 c;  2JA6 G;  3GTO B;  5EJW A;  1XPU A;  1PYS B;  3W1G A;  2JN4 A;  5FO8 B;  1VQI A;  4K8J A;  1II3 A;  1VDZ A;  1XTC D;  1XX8 A;  3K7A H;  4GN3 B;  1O7I A;  1I3Q B;  2Y0S B;  2JA7 B;  2F0H A;  1IL8 A;  3DM3 A;  4DV0 L;  4AYB E;  3HOW B;  1D8L A;  1S4Z A;  3ULP A;  1IBM Q;  1IBL L;  2K32 A;  3G4S A;  2E5L L;  1NR2 A;  4X3T A;  3C46 A;  2Q2H A;  3GTL B;  3LWE A;  1BF4 A;  4FO2 A;  1GUN A;  1J5E L;  3BG3 A;  1Y8N B;  1K3B C;  1SBB B;  5DEH A;  1TWF B;  2KJX A;  2B2Y C;  3GTK H;  1PRT D;  3PO3 H;  1PZJ D;  4XTC S;  1LO5 D;  3EFX D;  1E1T A;  2B2T C;  1EU3 A;  4I65 A;  3SHL A;  3EVQ A;  2NZ1 D;  1GD7 A;  1LLR D;  4BY7 G;  1STH A;  1XJV A;  4DV5 Q;  1JC7 A;  3B6Y A;  3S16 B;  4DAV A;  3F2B A;  4MTK A;  2IX3 A;  4X62 Q;  5BR8 Q;  4MNO A;  2K6A A;  3MXG A;  3TBI B;  2AKW B;  1YEZ A;  5M5Y H;  3KUP A;  3I91 A;  2A19 A;  3M4Y A;  4J8Q A;  1EY0 A;  4J1M A;  4TQU S;  4KJO A;  1EZ8 A;  4P73 A;  1ENF A;  2MQH A;  4OO1 H;  2R93 B;  3H0G G;  1I6H B;  1A3U A;  4C3I B;  2JE6 I;  1CZW A;  5D3I B;  4HSP A;  1LT4 D;  1V9P A;  2UUB L;  2X69 A;  5AFW A;  5C4J B;  3E0E A;  2OXP A;  1TWA B;  4A3F B;  4F88 A;  1E3P A;  3ER0 A;  3SK4 A;  2K03 A;  4RH6 A;  3Q6S A;  4HJ8 A;  1L0X B;  2YU9 H;  2KA7 A;  1N9W A;  4R4Q A;  2ES2 A;  5FLX L;  1L0W A;  3T1H Q;  4G7H C;  1QVC A;  3RZO H;  1J8I A;  5EKK A;  4KMU C;  4RAU C;  3PMF A;  4IPC A;  3V96 A;  4KKS A;  4JI8 L;  1HNZ L;  3NWT A;  3CC2 A;  4QUC A;  1N34 L;  1AN8 A;  1F2L A;  4R1J A;  3M85 A;  2A73 B;  4A3G B;  2F0V A;  1A3V A;  4DA2 A;  3E3X A;  1LT6 D;  2F0J A;  3S14 H;  5CV6 A;  2CKZ B;  1YNN D;  1PH3 A;  4A3G G;  5IP9 G;  3HKS A;  1H9S A;  1AH9 A;  2VW9 A;  1D6E C;  3SEB A;  1LTL A;  3DUZ A;  2RDG A;  3K57 A;  4BBR H;  5E4X A;  1CSQ A;  1QZG A;  4DV2 L;  2K5N A;  4CKE A;  1I4R A;  4AQY L;  4C2M B;  3SDZ A;  4JBK A;  2VQF Q;  3VR3 A;  2J4X A;  2FHT A;  1ILP A;  1LTS D;  2CQO A;  1K8M A;  1ZXT A;  4JOI C;  4UP7 A;  1I5F A;  3NWS A;  5C3W A;  2I0Q A;  3M7N A;  4GZY C;  1V8Q A;  3HOV H;  3VR5 A;  3BVM A;  2V4D A;  2OTL A;  1STE A;  2CH4 A;  1EIY B;  3GO5 A;  3I4M G;  3H3V C;  3CP0 A;  3KJP A;  4QCL A;  1P8L A;  3I8Z A;  2H4O A;  2K14 A;  4LJZ C;  2YYZ A;  1E1O A;  1UWV A;  3K5O A;  1SFO B;  1SLJ A;  2JJQ A;  5M5W H;  1EQQ A;  4B3S Q;  3RD4 A;  4HMJ A;  5IY0 A;  4YY3 Q;  1D1K A;  1R4Q B;  4X66 L;  2MO1 A;  2NWG A;  2M9V A;  2NVT H;  3J7A F;  1FJG Q;  4IFD J;  1Q12 A;  1UE7 A;  4R4T A;  4P72 A;  3PUX A;  2LS0 1;  2PZW A;  3MXN A;  1KTK A;  1PYW D;  4LFA Q;  5ELF A;  2A69 D;  5CBA E;  5ELN A;  1TS2 A;  3TP7 A;  1HNX L;  4LF4 Q;  4K0K L;  4K8I A;  4DKA C;  4DR3 L;  4DPG A;  4RG1 A;  4IUU A;  1H9S B;  1VQ5 A;  3FPU B;  2A6E C;  4A3I H;  3KYH C;  2A1A A;  4WFN 3;  3FPP A;  3TS2 A;  1JCK B;  2QCP X;  2Y0S E;  1B3A A;  2MFI A;  2HHH Q;  4K6D A;  2B2W A;  4HCS A;  5BN3 A;  4FF3 A;  3V05 A;  2Z8L A;  3J80 E;  2ZJQ A;  3RNU A;  5C4X B;  2HCI A;  1A3T A;  5GAD C;  1O7L A;  4A4I A;  4DUY Q;  1K83 B;  4X3U A;  2B2W C;  1SN8 A;  3BZK A;  1WTO A;  4DUY L;  2K5Q A;  1BNZ A;  4POF A;  2WP8 J;  2KCN A;  2HDL A;  2SEB D;  3T13 A;  1E22 A;  2AMC B;  3CQZ B;  4XIG S;  1LT5 D;  5LMN W;  1A62 A;  1Y8O B;  4J6H A;  3HOU H;  4JI1 L;  4FNF A;  3CC4 A;  1X3F A;  1S40 A;  3NPP A;  1N34 Q;  2IPK D;  2JK8 A;  4OIK A;  4CDF C;  3IKJ A;  4QF4 A;  2FJ2 A;  1S5E D;  4K5X A;  4DR6 L;  1DOL A;  3EIV A;  2F0G A;  3D6C A;  3SR1 A;  4A3D H;  4N9T A;  3CCJ A;  2D0P A;  1F9P A;  2K33 A;  4OWX B;  1H9J A;  4YWK A;  1M90 C;  3C1F A;  4A3I G;  3F8T A;  4OWT B;  5D65 A;  4ZK9 B;  3HOW G;  2UUB Q;  1X6O A;  2K50 A;  1JOO A;  4R8I A;  3J80 i;  5ELD A;  5EPK A;  3NE5 B;  3CCM A;  1SDF A;  3I72 A;  3GV6 A;  3W3A A;  2SNM A;  4HJ9 A;  1IBK Q;  2XSC A;  3A7L A;  3G6J B;  4L5R C;  5M5X H;  5G3L F;  2Q8T A;  4XYO A;  4LF7 Q;  4KTA A;  4ME5 A;  5IT9 c;  5C3E B;  1QUQ A;  3BVZ A;  4A3E G;  1EUJ A;  1VQA A;  2MO0 A;  3AFQ A;  2NN6 G;  1HA5 A;  3TN2 A;  1QZH A;  3KDF A;  1C0A A;  3S1M H;  4LFC L;  4DV5 L;  1BUV T;  3X3N A;  2RA4 A;  3E6Z X;  1GHK A;  4IOA A;  1X3G A;  3T53 B;  1QCB D;  4HJ5 A;  3I4N B;  1K8O A;  2Z6K C;  3GTP B;  3GTQ H;  2F0Q A;  3M3Y H;  3C3L A;  3W2D A;  4K0K Q;  1I4G A;  5M9O A;  1HZC A;  4RFB A;  5C0X H;  3RMH A;  5FKA C;  5JJK A;  5LMN Q;  2AWN A;  2WKD A;  1RTO A;  1F9R A;  4FXK C;  1Q81 C;  1JE4 A;  1G91 A;  4HR7 B;  4GLA C;  1STA A;  1X55 A;  4AQY Q;  1PRT B;  4DR2 L;  3FDT A;  3HOU G;  2D0O A;  3CCR A;  1I50 B;  5DNF A;  4C56 C;  1MJE A;  1DYQ A;  4ODG A;  2JA8 G;  4CDC C;  4IFD I;  1A63 A;  2ZXP A;  1VS0 A;  3AU7 A;  4DAY B;  1JB3 A;  4DK6 C;  3T1Y Q;  1PRT F;  3K5L A;  5IT9 E;  3J81 c;  3W5O A;  4HED A;  1PHJ A;  4DV6 Q;  5EAY A;  1QOH A;  4XQN A;  3S1Q H;  3VR4 A;  4A3E B;  3CKI B;  5IYC G;  3T1Y L;  3HOW H;  2CFM A;  4I7A A;  3JAM E;  4UAI A;  1UUP A;  3BDL A;  4AYB B;  1XNQ Q;  4CDD C;  3GTL H;  2RDH A;  3H94 A;  3KK7 A;  4KHZ A;  4KHV A;  4XDX A;  1Z7T A;  3MEF A;  3NUC A;  5BN5 A;  1Q8K A;  2Z4I A;  3N52 A;  1X32 A;  2VS1 A;  3ERO A;  3VYS A;  1TWF H;  1ZEQ X;  5KEE A;  1TS4 A;  3PUV A;  3Q24 A;  3KFU A;  4QQB X;  3L9A X;  2UUA L;  1RL2 A;  1VQN A;  2SDF A;  4A3M H;  3VR6 A;  2AUK A;  2L1B A;  1A0I A;  4FYD A;  2K04 A;  3KLS A;  1N8R C;  2L55 A;  1VQL A;  1KAW A;  3MTS A;  1KDA A;  1SE4 A;  2LXK A;  1QIL A;  3S24 A;  1HJP A;  3HKZ G;  1FNV A;  2ZXO A;  5I2Y A;  3PO2 G;  3Q8D A;  2EPB A;  2F0E A;  5KYL A;  3BZC A;  3QR8 A;  2EXD A;  1XNQ L;  1HFN A;  4GKK L;  4JI1 Q;  3H91 A;  1R4P B;  2WAQ E;  3L3O C;  5IGC A;  2WAQ G;  2KCM A;  1UE1 A;  3FMC A;  2HDM A;  1WCM H;  3JAM L;  4RGN A;  3MEH A;  3HZX A;  3H3V H;  3AMU A;  1YHB A;  4O42 A;  3DWQ A;  2D5D A;  1IYV A;  5ELE A;  2ALY B;  4DF7 A;  1IBK L;  2EYP A;  3J81 E;  1A15 A;  4UP8 A;  5CMD A;  3CW2 C;  1QG7 A;  4PQX A;  1QVG A;  2MGS A;  2NYZ D;  1DD2 A;  3K0Y A;  2YU9 B;  2F4V Q;  3G71 A;  1HRJ A;  4IUT A;  1GVP A;  1HTP A;  2AQ3 B;  5HGT A;  3J80 L;  3KLS X;  1Y1V B;  3HOZ H;  2AWO A;  1Y8P B;  4JVZ A;  4L8J A;  2NVX H;  4V19 0;  4U68 A;  1PH5 A;  2KQ3 A;  2NB0 A;  3BDC A;  4JI0 Q;  2QDL A;  4H44 C;  4IUP A;  4DV1 L;  3M4O B;  3S14 B;  1BDO A;  1TWH H;  3KOJ A;  1NMG A;  4PZ8 A;  1B2T A;  2M2L A;  2K5V A;  1BCP D;  4IUQ A;  4N8X 1;  4RA8 A;  3NBH A;  3CC7 A;  1A2U A;  2XWJ B;  4JI5 Q;  1ET6 A;  3TRE A;  2HIV A;  1PYB A;  2WAQ B;  2ZJR A;  4G4K A;  4LF6 Q;  3HKZ E;  3BS1 A;  1E2W A;  2VB2 X;  1ESR A;  2KHJ A;  2Z9H A;  1M1K C;  2Q2I A;  1YIT A;  4TRD A;  4GKJ Q;  1ASY A;  1A2T A;  1HA6 A;  1DM0 B;  1ZKO A;  2VUM B;  1G6Z A;  3M4Q A;  2NVQ H;  1VQE A;  3GD7 A;  5I6Y A;  3M4P A;  4LAA A;  5JVG 3;  4LF9 L;  5JJI A;  3D6W A;  1OTC A;  1PH6 A;  1L1O A;  3I4M B;  1E24 A;  3KF8 B;  1X3Q A;  2Q2T A;  2NTT A;  1HFG A;  4E6I A;  2JEA I;  3GTG B;  1L2F A;  4H02 A;  1K8A C;  3SK8 A;  4Z9C B;  4ZRZ A;  2R92 H;  1OXX K;  3K0X A;  3TP8 A;  3NBH B;  5CYU A;  4LF6 L;  1TKW B;  1F9Q A;  3LWU A;  3S2H B;  2N55 A;  3HOX G;  2QEX A;  1SNQ A;  4OEM B;  3RLO A;  2KCT A;  2YV5 A;  1PRT C;  1ROD A;  3HG9 A;  1UEA B;  4IOC A;  2B2Y A;  1FJG L;  2EJM A;  4BXX H;  3UDG A;  1UE6 A;  1U0L A;  5J3B A;  1VQ7 A;  1EY8 A;  2R7D A;  2JEB I;  1SR3 A;  1L1O B;  2BH2 A;  4L5S A;  1VMC A;  1M8A A;  5L37 A;  5JPM C;  3P20 A;  3MFG A;  2K01 A;  2EY1 A;  1TVX A;  4F7X A;  2JA8 B;  4YCV A;  4K14 A;  3MFY A;  1S5F D;  2Y0S G;  1VQC A;  3MZ5 A;  2JA5 H;  3GTM B;  1YZ6 A;  2Z0S A;  4JI7 Q;  3U4Z A;  1GUS A;  3F1Z A;  1RF2 D;  2PMZ E;  3OTO L;  1PH8 A;  1YHQ A;  4Y7N H;  5GRO A;  2OEO A;  1BBX C;  2F3V A;  4JI2 Q;  1EQR A;  4YIJ A;  4ABN A;  4IFD G;  4JI6 Q;  4DR1 L;  3WWV A;  5GAG C;  4DV4 L;  1EWC A;  4APV A;  5ELC A;  1TR5 A;  4A3B H;  5EPL A;  5KGU A;  3OWF A;  5BN4 A;  2N88 A;  2VQE Q;  5FK9 C;  4EGV A;  5IGD A;  1WI5 A;  1PDQ A;  3UE0 A;  1SJE D;  5IP9 H;  1PZK D;  4JC0 A;  3PUY A;  2A6H D;  3QJY A;  2KEE A;  1Z6H A;  3S15 B;  5I2X A;  2UUA Q;  1VQB A;  1B9N A;  2QW7 A;  3NTH A;  2HT1 A;  1HZA A;  1IL2 A;  1CA6 A;  4JK1 C;  3HOU B;  1XXG A;  3ZYY X;  3U58 A;  1LTB D;  2L12 A;  1F77 A;  4NKL A;  2O4X A;  1ZYR C;  4WRD A;  2JA7 G;  4IPG A;  1XTD A;  2D2C C;  4A3L G;  1G29 1;  2F0W A;  3X3M A;  3S2D B;  1IBL Q;  1D5Z C;  1QWY A;  1FGB D;  5E4W C;  3PIP 3;  4B3M Q;  3MHB A;  3H6M A;  1UNS A;  1LT3 D;  4PMC A;  3EN2 A;  2IHE A;  1SEB D;  3J7Y W;  2OF1 A;  3I3C A;  1QVF A;  2KVM A;  3ND9 A;  4DR2 Q;  2QEJ C;  2IX0 A;  1G51 A;  3H0G H;  3NK9 A;  3R8B A;  5JJL A;  3WOF A;  3UDF A;  1ICF B;  2H1E A;  5JVH 3;  1VQ8 A;  3HOY H;  4GNX C;  5EPJ A;  5IGG A;  1LTT D;  1YIJ A;  4JBM A;  2QIL A;  5C5M A;  4JOI A;  2IY5 B;  2N49 A;  5JPN C;  5M3F G;  1TU2 B;  4C3H G;  4OIJ A;  3KBG A;  2GVB A;  2KHI A;  1DGS A;  1U4L A;  3CCQ A;  4K2K A;  1YJ9 A;  4JI3 Q;  1TWC B;  2N78 A;  1E0B A;  2K5H A;  1BCP C;  2EJF C;  3CCL A;  1NBW A;  3DEO A;  1ZYR D;  3JC6 6;  1HR0 L;  1G2T A;  4QIW E;  2E2I B;  3HEJ A;  1UE5 A;  2I5L X;  4A3J H;  1K73 C;  2F0S A;  2F1M A;  2VXW A;  1C48 A;  3N6R A;  1VF7 A;  4DUZ L;  3G7L A;  1Q8I A;  4HJ7 A;  4LUO A;  1FD7 D;  3JAM c;  4X65 Q;  2DN8 A;  1PVO A;  1KC8 C;  2B63 H;  3R2I A;  1HR0 Q;  2HHH L;  2L4N A;  5COY A;  3VR2 A;  5M3M H;  1PH1 A;  1QE6 A;  2ICI A;  1O80 A;  1U4R A;  3QWN A;  1KRS A;  4G57 A;  2R7F A;  4KN4 C;  2PNR C;  1W6K A;  4R8N A;  4ZKC B;  3J7A V;  3P1H A;  1EEI D;  2KHS A;  3EQL C;  1CT1 D;  1X65 A;  1WTH A;  4C3J G;  3J7A 5;  1BO0 A;  3HS0 C;  4LF7 L;  2NUC A;  4K2L A;  4BY7 H;  1ET9 A;  1GKH A;  2L15 A;  3CCU A;  5LMU L;  3RUZ A;  3CRK C;  3J7Z C;  1X54 A;  2B3G A;  3A8J E;  2CCZ A;  4BBS B;  4L5Q A;  1DOK A;  4PV1 C;  2RHQ B;  2VZA A;  1J6Q A;  3S1Q B;  5GQO A;  2HCC A;  2HQE A;  2BA0 A;  3NEN A;  2E2J B;  1SE8 A;  2CW0 C;  3MXN B;  3K5M A;  4DR4 Q;  1JWS D;  1SJH D;  5E7N A;  4HJA A;  1K3R A;  3PO2 H;  4P2C B;  5FLX c;  1XYI A;  1PZI D;  2B63 G;  4B3T L;  1BBU A;  4QL5 A;  2JA6 H;  3KBX A;  2F0U A;  2RCF A;  1TXY A;  1GUT A;  4H7B A;  1XMQ L;  2FMM A;  1JIC A;  3AB9 A;  2RF4 A;  4LNQ A;  4IFD H;  3VDY A;  2F0F A;  2RBM A;  4O0A A;  2IX1 A;  1RD9 D;  1EY6 A;  1AE3 A;  3NSW A;  4Q5V A;  3K5N A;  4BY1 G;  4OL7 A;  4OXP A;  4RWS C;  1PH9 A;  2CWA A;  4DUZ Q;  3OMG A;  2K5D A;  1WTR A;  2JA5 G;  5EBD A;  5K36 H;  1PFN A;  3GTJ H;  4X64 L;  5D3D A;  1AW7 A;  3HRZ C;  4RGT A;  4J15 A;  1SYG A;  5M3M G;  5JAV A;  5G3L D;  4MHE A;  2EDG A;  1LYL A;  1YVC A;  4A3D G;  1JOR A;  1WCM B;  3IRB A;  4OGQ C;  1M4V A;  3I4N G;  2EYF A;  1IYJ B;  3RLF A;  5AJ3 L;  2EZV A;  4ZUI A;  2WB1 E;  2B2T A;  5EBC A;  3TSS A;  2IHF A;  4P75 A;  2R7Z G;  4HN7 A;  4ZYS A;  5IP7 G;  4YCU A;  4IAL A;  2XRS D;  4IUR A;  4JG2 A;  3R93 A;  2O5I C;  1QJO A;  2BE5 C;  3T56 B;  1Y1W B;  4UY8 C;  1CZG A;  1YNJ C;  4A3C G;  3T4A C;  1BOS A;  5JOB A;  1STG A;  2SOB A;  2UUC L;  1AZP A;  1SE2 A;  3D3R A;  4IO9 A;  1Q3L A;  1OXT A;  3D8G A;  3FRP B;  4A93 H;  1U9R A;  3A8K E;  4DFA A;  1IKM A;  2VL6 A;  3A54 A;  1V1Q A;  3CF5 A;  4PMW A;  3Q22 A;  3VA7 A;  3E5S A;  3D4R A;  2H5X A;  2AHO B;  3KDF B;  1XNR L;  1EQV A;  3NTK A;  4HIM A;  3ITP A;  4AH6 A;  1HQM C;  2PQA B;  2WFW A;  4HTH A;  2M00 A;  2XN9 C;  5EQ0 A;  3BJU A;  4JBW A;  1PH4 A;  4NXM Q;  3BU2 A;  4LWC A;  1JWM D;  1CA5 A;  1JWU D;  1GUO A;  4JPB W;  4LFB Q;  1HQR D;  3MVV A;  4MTN A;  1YJW A;  5EKI A;  3CME A;  4UPA A;  4FVM A;  4KHP Q;  2FIN B;  2IT1 A;  3CCS A;  3HP3 A;  1NCV A;  3PCO B;  1H9K A;  1NMF A;  2ZJP A;  1EFI D;  1HPC A;  2KBN A;  3S1R H;  3GTO H;  3SK6 A;  3UDX A;  1HUM A;  1TS5 A;  1HNW Q;  2F3W A;  1B9M A;  3OTO Q;  4XT3 B;  1XPR A;  3K7A B;  1Q1E A;  3A5U A;  3FP9 A;  4C3J B;  1KD1 C;  3S2H H;  1HHV A;  2ZTC A;  4IPD A;  2JA7 H;  1B3Q A;  4A76 A;  5LL6 S;  1IKL A;  3A8I E;  4JYA Q;  1JOQ A;  3D4D A;  5AJ3 Q;  1C9O A;  1WOC A;  4KY6 A;  4PZ7 A;  4RCO A;  3GP7 A;  1TQO A;  4DK3 C;  4ZKB B;  1SXT A;  5CV9 A;  5JEA J;  1VQK A;  4YY3 L;  2F03 A;  2N8N A;  1VQP A;  3GTK B;  5LHY 1;  2RDF A;  1PH7 A;  3I4O A;  4LF4 L;  1VQM A;  4A3K G;  2X6L A;  3CD6 A;  1HUN A;  4BA1 I;  4O2D A;  5I9P A;  1KQS A;  4KJN A;  3OWE B;  1KDC A;  4CKC A;  1NNX A;  4JI4 L;  2VUM G;  2R6G A;  4FXD A;  3GTM H;  4F87 A;  4DV7 Q;  4LF8 Q;  4N8F A;  2A5H A;  2CW0 D;  3CHB D;  1EYA A;  1MI2 A;  4Y7N B;  3BZD B;  2PW5 A;  2PCF B;  5GAH C;  2EJG C;  3VYU A;  4NXN L;  3C1E A;  5IOD A;  4KKT A;  1RKN A;  4LF9 Q;  1EIF A;  2CH4 W;  2PQE A;  4EQN A;  2KCC A;  3FEW X;  1E7Z A;  3E9H A;  3NEM A;  1JB7 A;  2E5L Q;  4GKJ L;  3C2P A;  1TWA H;  1JJG A;  4EQO A;  4DAP A;  2TSS A;  2EYO A;  4OX9 Q;  1S5B D;  4HSV A;  4Q0F A;  1F2Z A;  1CHQ D;  1SMY D;  2N3S A;  3UI2 A;  1NY4 A;  4A3K H;  4KI0 A;  4FF4 A;  4KD4 A;  1BVS A;  4L5T A;  5A2Q E;  1EZ6 A;  3EJI A;  1EY5 A;  4CHT B;  1F2M A;  4JI0 L;  4A75 A;  1EEF D;  2D62 A;  2XWB B;  4ID6 A;  2F0D A;  4DGZ A;  4KK7 A;  4DAM A;  2AQ2 B;  2K28 A;  4DR1 Q;  3CCE A;  1B70 B;  1NUC A;  3A0J A;  4UDU C;  1Z9F A;  2VNU D;  4EVO A;  1MGS A;  2UXC Q;  1JMC A;  1JJ2 A;  4HMI A;  2F4I A;  1LV9 A;  3H15 A;  1IW7 C;  4CBV A;  3DWA A;  1N36 Q;  3RZO B;  1EYC A;  2B2U A;  5JJZ A;  2BE5 D;  4POG A;  1CFM A;  5CGK A;  4B3R Q;  4C2M H;  4FP5 D;  1YJN A;  3HOY B;  1YNJ D;  2B39 A;  4GN4 B;  2A8V A;  2MUY A;  4KY5 A;  4LW1 A;  1GXD C;  5FO7 B;  1HNZ Q;  4S3S A;  2EYH A;  2OT2 A;  2UXD Q;  2DUD A;  4IJL A;  1OXV A;  4XXE A;  5C44 B;  3K58 A;  3HOV B;  4RGM A;  3NHH A;  2R3Z A;  2VQE L;  2E2I H;  2Q8R E;  4A3J B;  3A55 A;  4BBR B;  1VMP A;  1T5E A;  4LFB L;  4DR7 L;  4ULL A;  4DK1 A;  1SMX A;  2ID0 A;  5DAU A;  2Q2U A;  1KNE A;  1QNK A;  3RZD H;  1WD0 A;  5C6A A;  3QIA A;  1EOT A;  2ENB A;  2JA9 A;  2OCE A;  2DJG C;  2UU9 Q;  2PW7 A;  3KF8 A;  2HD3 A;  2B63 B;  3H09 A;  5C0X G;  1SFO H;  3H3V I;  5M3M B;  2LKV A;  2BA1 A;  2BH8 A;  2RSO A;  3MXU A;  4MZ9 A;  4QUF A;  3PF4 A;  1DZ1 A;  2EOT A;  1GJX A;  1BBW A;  1MSH A;  1X3E A;  5C3X A;  1AP0 A;  1CKN A;  1B4O A;  3NQT A;  4L6T B;  2C9O A;  2QGQ A;  3PO3 G;  1N36 L;  1W6J A;  5FJ8 G;  4BY7 B;  1FL0 A;  2PZU A;  2MNA A;  1CKO A;  2R7Z H;  3I2Z A;  1H95 A;  4JW0 A;  2F0O A;  2A74 C;  4RCN A;  4PNY A;  2B2V C;  1R9T B;  3KF6 A;  4TKO B;  4DV6 L;  5M5W B;  1HTL D;  2F0I A;  3RR5 A;  4FXG C;  1J5E Q;  1XMO Q;  2GVA A;  4LUZ A;  3SGI A;  1FR3 A;  2PQA A;  5C0X J;  2A6H C;  1N33 Q;  1VQH A;  2NVT B;  2DGY A;  4O1N A;  5JEA G;  1U4M A;  5F2D A;  5C4X H;  5I9O A;  4JV5 L;  3PO2 B;  1S5C D;  5C4H A;  2F4V L;  3DHQ A;  1LAC A;  2MHV A;  3RLN A;  1VQD A;  3S9W A;  4U67 3;  1AEX A;  5ISR A;  1MSG A;  1I94 L;  4A3I B;  1V1P A;  1PA6 A;  1BCP F;  4Y52 H;  3K81 C;  2ASB A;  4GN5 A;  3M9B A;  1KHI A;  3ULL A;  1PTO H;  2B2U C;  5IYB G;  1OXS C;  2LY7 A;  4NB3 A;  1WTP A;  3CAM A;  2WKC A;  1K83 H;  2Z6K A;  4GKK Q;  5DM7 3;  1A6X A;  1DXM A;  1BCP B;  5LL6 X;  4DR7 Q;  1AFP A;  4HAE A;  1PFS A;  1V43 A;  4GOP C;  1I6V C;  3U9O A;  4BBS G;  4CJ2 C;  2NTS A;  1P16 A;  1W2B A;  3WDN A;  4KV6 A;  3CQZ H;  2I46 A;  3QOJ A;  4G7O C;  3IL8 A;  4GNX A;  1WTV A;  5IOC A;  2ZM6 L;  3S1N B;  2B2V A;  1VQ9 A;  1FGU A;  3PV0 A;  4LFA L;  5C5L A;  3ERQ A;  1SNP A;  1B44 D;  1H9R A;  1MHW C;  2OQ0 A;  3BVG A;  1KNA A;  4DR5 Q;  1RJT A;  2MPM A;  1DCZ A;  3CPW A;  2BCO A;  3I55 A;  1CKM A;  2WV6 D;  3NQI A;  5GAE C;  4GOP B;  2NZH A;  5IE8 A;  1O7Z A;  2P5Z X;  1KLG D;  1GUG A;  4B9X A;  1CI3 M;  1TY2 A;  3I56 A;  1GUW A;  4CKB A;  4IN3 A;  3HOZ G;  1N32 L;  1K28 A;  1L1O C;  1PFM A;  2EY2 A;  1CM9 A;  3OSO A;  3DLL A;  2BDO A;  2OQK A;  1KAA A;  4ZLT F;  3NEL A;  1F2Y A;  3GTQ B;  3M3Y B;  4HIO A;  2UXB L;  1NAP A;  5KNC A;  4JCV E;  4YWL A;  2O2L D;  1E2V A;  4TVA B;  5IWA Q;  3L7Z C;  2F0L A;  2EY6 A;  3TZU A;  1H9M A;  4XQQ A;  4YHH Q;  2F0T A;  1JQY D;  1N33 L;  3OHX C;  1WCM G;  5J1Z A;  1C4Q A;  3R2T A;  4OX9 L;  1CKN B;  1ONL A;  1YI2 A;  2LMC B;  2MJ8 A;  3I90 A;  1WTX A;  2ATW A;  3SXH A;  3PIO A;  1EQT A;  3GTP H;  2UXD L;  5D14 A;  1KDB A;  1SYB A;  4V0B A;  4X62 L;  4RHR A;  4B3M L;  3SE0 A;  3S1R B;  1PFB A;  4LUV A;  3ICE A;  3CXC A;  4NXN Q;  1LTR D;  1Q86 C;  4DR3 Q;  2PZT A;  4BXX G;  1EY4 A;  5FLM G;  4A3E H;  2UUC Q;  4C3J H;  1LTG D;  2WIN B;  4BBR G;  4DV3 Q;  1VQO A;  2XGT A;  2UXC L;  3NP8 A;  4JI5 L;  3I4L A;  2UXB Q;  4C1N K;  4PMB A;  1YHA A;  1BQQ T;  5FOB B;  1YNX A;  4G7Z C;  4LMQ D;  1LTI D;  3AEV A;  1EWH A;  4QMG A;  1TY0 A;  3Q23 A;  4NW2 A;  4C3H H;  1T5X D;  1HR0 W;  2IL8 A;  3I73 A;  4R9W A;  2K1B A;  5J39 A;  2BOS A;  2Z1C A;  4NMZ A;  3KLR A;  4RKL A;  1SNM A;  3FKI B;  1FYC A;  4ILW A;  1IHZ A;  4A3C H;  1KLU D;  2I5M X;  3S17 B;  4OO1 I;  4A3M B;  4HIK A;  3TDQ A;  2PI2 A;  1D5X C;  3KJO A;  1X3P A;  2LFN A;  3O13 A;  5HY6 A;  2JSO A;  5C4Z A;  3OMC A;  5J22 A;  2R93 G;  3G6E A;  4FF1 A;  5T1G A;  1SSO A;  3PGZ A;  4C1N I;  1Q82 C;  4HCE A;  2DNE A;  1VQG A;  4GNX B;  1SYE A;  5HGQ A;  1NTG A;  4X65 L;  1V1O A;  2K7V A;  1ESF A;  3IFT A;  1O7Y A;  1FNU A;  2EXZ A;  2J7Z A;  1NR4 A;  1QUQ B;  4PZ6 A;  2NN6 H;  5ELO A;  2IJ0 A;  5H1S E;  3R3O A;  3PQI A;  5ELB A;  4LF5 L;  2L11 A;  2NN6 I;  2ZTD A;  3CCV A;  3K6O A;  1WVL A;  1X9N A;  4BY1 B;  2PPB C;  1CUK A;  1I4Q A;  1I4H A;  2EYM A;  4B9W A;  2G9H D;  3D4W A;  3T16 A;  2VQF L;  4K6L A;  2QKI C;  1E2Z A;  1JE5 A;  1C7Y A;  1XWE A;  3TP5 A;  3FHW A;  3SK5 A;  5C44 G;  2YTX A;  1HNX Q;  3E0J A;  4QY7 A;  1VQ6 A;  4A3K B;  1D5M C;  1TII D;  2NVY B;  5C4X G;  4I7Z C;  2JYO A;  3LX0 A;  1Y1V H;  2PMZ B;  3TEH B;  3HOZ B;  3T51 B;  3HOX B;  4EQ5 A;  2G9D A;  2DNC A;  4B08 A;  1ASZ A;  1IBM L;  4ZQ3 A;  3J81 j;  1TS3 A;  2DJF C;  4R4C A;  1CQF A;  3M4O H;  1TWH B;  2L0C A;  4QJF A;  1VQF A;  4B3S L;  1KRT A;  1B50 A;  2JP1 A;  3W1B A;  2KEN A;  1D7Q A;  4XT1 B;  2ZM6 Q;  1RCV D;  3AQQ A;  4ZUJ A;  4X64 Q;  1L0Y B;  5CV7 A;  3A7A B;  5LMN L;  2EIF A;  5IYD H;  5NUC A;  4A3B G;  1G6P A;  2AQ1 B;  1X56 A;  2E74 C;  5IGF A;  5FJ8 H;  1SAP A;  3NBI A;  5I4D A;  4GLV B;  3TZD A;  3ZJY C;  3MA2 B;  2O5J C;  5IGE A;  2NVX B;  2NVQ B;  2WB1 B;  1EWI A; 
#chains in the Genus database with same CATH homology
 5KIX A;  4H13 C;  2IWH A;  4BS9 A;  1Z47 A;  3Q0A A;  1JR0 D;  3HKZ B;  1G2S A;  5KYI A;  1EIH A;  3QOL A;  2B8G A;  1PTO F;  4CJ0 B;  1ENA A;  1ICW A;  5A2Q L;  2R92 B;  3GQB A;  5T1I A;  2K05 A;  4N9P A;  5CV8 A;  5IT9 L;  5HUR A;  3PIO 3;  3RZD B;  5KRU A;  1IYU A;  2QF7 A;  5TSS A;  4DNT B;  3LNN A;  3MC0 B;  5M3F B;  2MP1 A;  2CVR A;  1KAB A;  1LAB A;  1CHP D;  4K5W A;  2C5C A;  2GA4 B;  4WJW A;  2L9H A;  1EY7 A;  3M7G A;  2F0M A;  4OO1 G;  2R7Z B;  5CBE E;  4BWG B;  1WTW A;  2F0P A;  1EL0 A;  2A69 C;  3FVQ A;  2EY5 A;  2I07 B;  3DWP A;  3A56 A;  5CV4 A;  2CHB D;  2L5T A;  2ZT9 C;  3DXJ C;  3PO3 B;  1QB5 D;  2RQX A;  2PYK A;  4DU9 A;  3ND8 A;  2E75 C;  2JA5 B;  2WII B;  2XRQ D;  3DMU A;  2EYJ A;  4M1U B;  4XQJ A;  5M5Y B;  1F9S A;  1DOM A;  2DY7 A;  5CC4 A;  5IGB A;  4A3B B;  1SYF A;  2XIW A;  1PTO B;  5K36 G;  2IW3 A;  2KOL A;  3HGB A;  4XYQ A;  4DN4 M;  4NP5 A;  4CJ1 B;  4DNR B;  3H0G B;  4K5V A;  1SNC A;  3MWY W;  4LK1 C;  1B53 A;  1OXU A;  5KND A;  2ZXR A;  3F2U A;  3DM1 A;  2TMP A;  3EA6 A;  4DAY A;  2XNA C;  5FLX E;  3ONA B;  1C8C A;  2AUJ D;  2WAC A;  1WTQ A;  2RSN A;  1YNN C;  4KY7 A;  2D9U A;  1U4P A;  4FF2 A;  1PXU A;  2J0T D;  3BDO A;  3VYT A;  1MD2 D;  1OO9 B;  3BYT B;  3GV3 A;  3P75 A;  1HXY D;  1Q90 A;  3U9S A;  1RHP A;  4TSS A;  3OIQ A;  1FNW A;  1ML0 D;  2A68 C;  2E76 C;  2HUG A;  1S5D D;  5EKL A;  2EYL A;  3PUZ A;  4MIU A;  2EVB A;  4F8M A;  4ZAI A;  1ILQ A;  1Y69 U;  2KUM A;  3TP6 A;  1SYD A;  1CTM A;  2A6E D;  1B1Z A;  3VA5 A;  5DM6 3;  1D2B A;  1CQV A;  1LTA D;  3V2T A;  2ICE C;  4WOR A;  2K5W A;  3MXP A;  4KD3 A;  3NTI A;  3TME A;  5IIF A;  4C3H B;  2JA6 B;  1SND A;  4IZ8 A;  1SYC A;  5COR A;  3CRL C;  4RKB A;  1PTO D;  1DJR D;  3PUW A;  1IW7 D;  4KKU A;  4CGY B;  1GOZ A;  5A35 A;  2XVS A;  3QG1 A;  2SNS A;  1UAP A;  2NBF A;  1SNO A;  4IQZ A;  4OHJ A;  1RTN A;  3GTJ B;  4X3S A;  1AZQ A;  1JOK A;  1EU4 A;  1NSN S;  3WOE A;  1GHJ A;  2BDN A;  5C0X I;  3OOC A;  5CR3 A;  2B8F A;  3P7J A;  3I70 A;  5EGT A;  4H0L C;  3SVM A;  1DON A;  1Q1B A;  5FO9 B;  1PLF A;  2RKS A;  4RGO S;  2PO4 A;  1SMY C;  5JEA H;  3OIP A;  4L63 B;  3QO2 A;  3BYY B;  2F0N A;  4DXG A;  1RDP D;  3J81 L;  3NXW A;  4DK0 A;  2RVL A;  4A3D B;  1PTO C;  2R61 A;  3IFD A;  4M8A A;  1EYD A;  4QB4 A;  1VCI A;  3D31 A;  1STY A;  4IUN A;  2QDB A;  1I4X A;  5CV5 A;  4DXF A;  1WD1 A;  2VB3 X;  1I4P A;  2Z4H A;  2E2D C;  1V1P B;  3DEP A;  1BR9 A;  2CQA A;  5M5X B;  3CU7 A;  1BXT A;  3QB3 A;  5E1F A;  1PMR A;  3VYR A;  1G8Z D;  4C3I G;  1TT2 A;  4BA2 I;  1STN A;  3S1M B;  2KEC A;  1VF5 C;  3IAY A;  1QNU A;  1SE3 A;  2X6G A;  2A68 D;  2JXM B;  4KN7 C;  4A93 B;  4X3K A;  4RHS A;  4IUV A;  1EY9 A;  5KNB A;  3OW7 A;  5K5P A;  2EE1 A;  1D1I A;  2FFK B;  3MAQ A;  5E3F A;  5I6W A;  1EIG A;  2KED A;  2E2H B;  1STB A;  1MBY A;  3K59 A;  4NDX A;  1HCZ A;  2Q8I B;  1J9O A;  3OPO A;  4EQP A;  1TWG B;  1O78 A;  2FMC A;  1ENC A;  2F0K A;  3URY A;  4MN3 A;  1CK1 A;  4QIW B;  2DY8 A;  3GTO B;  5EJW A;  5FO8 B;  4K8J A;  1II3 A;  1VDZ A;  1XTC D;  1XX8 A;  1I3Q B;  2Y0S B;  2JA7 B;  2F0H A;  1IL8 A;  3HOW B;  1S4Z A;  2K32 A;  1NR2 A;  4X3T A;  3C46 A;  3GTL B;  3LWE A;  1BF4 A;  4FO2 A;  1GUN A;  3BG3 A;  1Y8N B;  1SBB B;  5DEH A;  1TWF B;  2KJX A;  2B2Y C;  1PRT D;  1PZJ D;  4XTC S;  1LO5 D;  3EFX D;  2B2T C;  1EU3 A;  4I65 A;  3SHL A;  3EVQ A;  2NZ1 D;  1LLR D;  1STH A;  1JC7 A;  3S16 B;  4DAV A;  2IX3 A;  2K6A A;  3MXG A;  3TBI B;  3KUP A;  3I91 A;  3M4Y A;  4J8Q A;  1EY0 A;  4J1M A;  4TQU S;  4KJO A;  1EZ8 A;  1ENF A;  4OO1 H;  2R93 B;  1I6H B;  1A3U A;  4C3I B;  2JE6 I;  1CZW A;  5D3I B;  4HSP A;  1LT4 D;  2X69 A;  5AFW A;  5C4J B;  2OXP A;  1TWA B;  4A3F B;  4F88 A;  3SK4 A;  2K03 A;  4RH6 A;  3Q6S A;  1L0X B;  2KA7 A;  5FLX L;  4G7H C;  1J8I A;  5EKK A;  4KMU C;  4RAU C;  3PMF A;  3V96 A;  4KKS A;  3NWT A;  4QUC A;  1AN8 A;  1F2L A;  3M85 A;  2A73 B;  4A3G B;  2F0V A;  1A3V A;  4DA2 A;  1LT6 D;  2F0J A;  5CV6 A;  1YNN D;  1H9S A;  1D6E C;  3SEB A;  3DUZ A;  2RDG A;  3K57 A;  5E4X A;  4CKE A;  1I4R A;  4C2M B;  3SDZ A;  3VR3 A;  2J4X A;  2FHT A;  1ILP A;  1LTS D;  1K8M A;  1ZXT A;  3NWS A;  5C3W A;  3M7N A;  4GZY C;  1V8Q A;  3VR5 A;  3BVM A;  2V4D A;  1STE A;  3GO5 A;  3H3V C;  4QCL A;  3I8Z A;  2H4O A;  4LJZ C;  2YYZ A;  3K5O A;  1SFO B;  3RD4 A;  4HMJ A;  1D1K A;  1R4Q B;  2NWG A;  2M9V A;  3J7A F;  4IFD J;  1Q12 A;  3PUX A;  2LS0 1;  2PZW A;  3MXN A;  1KTK A;  1PYW D;  5ELF A;  2A69 D;  5CBA E;  1TS2 A;  3TP7 A;  4K8I A;  4IUU A;  1H9S B;  3FPU B;  2A6E C;  4WFN 3;  3FPP A;  1JCK B;  2QCP X;  1B3A A;  4K6D A;  2B2W A;  4HCS A;  5BN3 A;  4FF3 A;  3V05 A;  2Z8L A;  3J80 E;  5C4X B;  2HCI A;  1A3T A;  1O7L A;  1K83 B;  4X3U A;  2B2W C;  1WTO A;  2K5Q A;  1BNZ A;  2WP8 J;  2KCN A;  2HDL A;  2SEB D;  3T13 A;  3CQZ B;  4XIG S;  1LT5 D;  1Y8O B;  4J6H A;  4FNF A;  3NPP A;  2IPK D;  4OIK A;  3IKJ A;  4QF4 A;  2FJ2 A;  1S5E D;  4K5X A;  1DOL A;  2F0G A;  3D6C A;  3SR1 A;  4N9T A;  1F9P A;  2K33 A;  1H9J A;  3C1F A;  5D65 A;  4ZK9 B;  1JOO A;  4R8I A;  5ELD A;  5EPK A;  3NE5 B;  1SDF A;  3I72 A;  3GV6 A;  3W3A A;  2SNM A;  2XSC A;  3A7L A;  3G6J B;  5G3L F;  2Q8T A;  4XYO A;  4KTA A;  4ME5 A;  5C3E B;  3BVZ A;  2NN6 G;  1HA5 A;  3TN2 A;  1BUV T;  3X3N A;  2RA4 A;  3E6Z X;  1GHK A;  3T53 B;  1QCB D;  3I4N B;  1K8O A;  3GTP B;  2F0Q A;  3C3L A;  3W2D A;  1I4G A;  5M9O A;  4RFB A;  5C0X H;  3RMH A;  5FKA C;  2AWN A;  2WKD A;  1RTO A;  1F9R A;  4FXK C;  1JE4 A;  1G91 A;  4HR7 B;  1STA A;  1PRT B;  3FDT A;  1I50 B;  5DNF A;  4C56 C;  1DYQ A;  4ODG A;  4IFD I;  2ZXP A;  3AU7 A;  1JB3 A;  1PRT F;  3K5L A;  5IT9 E;  4HED A;  1QOH A;  4XQN A;  3VR4 A;  4A3E B;  3CKI B;  3JAM E;  4UAI A;  1UUP A;  3BDL A;  4AYB B;  2RDH A;  3H94 A;  3KK7 A;  4KHZ A;  4KHV A;  4XDX A;  1Z7T A;  3NUC A;  5BN5 A;  2Z4I A;  3N52 A;  1X32 A;  3ERO A;  3VYS A;  1ZEQ X;  5KEE A;  1TS4 A;  3PUV A;  3Q24 A;  3L9A X;  2SDF A;  3VR6 A;  2AUK A;  2L1B A;  4FYD A;  2K04 A;  3KLS A;  2L55 A;  3MTS A;  1KDA A;  1SE4 A;  1QIL A;  1FNV A;  2ZXO A;  5I2Y A;  2EPB A;  2F0E A;  5KYL A;  1HFN A;  3H91 A;  1R4P B;  3L3O C;  5IGC A;  3FMC A;  2HDM A;  3JAM L;  4RGN A;  3MEH A;  3HZX A;  3AMU A;  4O42 A;  3DWQ A;  2D5D A;  1IYV A;  5ELE A;  4DF7 A;  2EYP A;  3J81 E;  1A15 A;  5CMD A;  1QG7 A;  4PQX A;  2MGS A;  2NYZ D;  1DD2 A;  3K0Y A;  2YU9 B;  1HRJ A;  4IUT A;  1HTP A;  2AQ3 B;  5HGT A;  3J80 L;  3KLS X;  1Y1V B;  2AWO A;  1Y8P B;  4L8J A;  4V19 0;  4U68 A;  2KQ3 A;  2NB0 A;  3BDC A;  4H44 C;  4IUP A;  3M4O B;  3S14 B;  1BDO A;  1B2T A;  2M2L A;  1BCP D;  4IUQ A;  4RA8 A;  3NBH A;  1A2U A;  2XWJ B;  1ET6 A;  2WAQ B;  4G4K A;  3BS1 A;  1E2W A;  2VB2 X;  1ESR A;  4TRD A;  1A2T A;  1HA6 A;  1DM0 B;  1ZKO A;  2VUM B;  1G6Z A;  3GD7 A;  5I6Y A;  4LAA A;  5JVG 3;  3D6W A;  3I4M B;  1X3Q A;  2NTT A;  1HFG A;  4E6I A;  2JEA I;  3GTG B;  3SK8 A;  4Z9C B;  4ZRZ A;  1OXX K;  3TP8 A;  5CYU A;  1TKW B;  1F9Q A;  3LWU A;  3S2H B;  2N55 A;  1SNQ A;  1PRT C;  1ROD A;  3HG9 A;  1UEA B;  2B2Y A;  2EJM A;  1EY8 A;  2JEB I;  1VMC A;  1M8A A;  5JPM C;  3P20 A;  3MFG A;  2K01 A;  2EY1 A;  1TVX A;  4F7X A;  2JA8 B;  4K14 A;  3MFY A;  1S5F D;  3MZ5 A;  3GTM B;  1GUS A;  1RF2 D;  2OEO A;  1BBX C;  2F3V A;  4YIJ A;  4ABN A;  4IFD G;  1EWC A;  5ELC A;  1TR5 A;  5EPL A;  5KGU A;  3OWF A;  5BN4 A;  2N88 A;  5FK9 C;  4EGV A;  5IGD A;  1PDQ A;  1SJE D;  1PZK D;  3PUY A;  2A6H D;  3QJY A;  2KEE A;  1Z6H A;  3S15 B;  5I2X A;  1B9N A;  3NTH A;  1CA6 A;  4JK1 C;  3HOU B;  1XXG A;  3ZYY X;  1LTB D;  2L12 A;  1F77 A;  4NKL A;  2O4X A;  1ZYR C;  4WRD A;  2D2C C;  1G29 1;  2F0W A;  3X3M A;  3S2D B;  1D5Z C;  1QWY A;  1FGB D;  5E4W C;  3PIP 3;  3MHB A;  3H6M A;  1UNS A;  1LT3 D;  4PMC A;  1SEB D;  3J7Y W;  2OF1 A;  3I3C A;  2KVM A;  3ND9 A;  2QEJ C;  2IX0 A;  3NK9 A;  3R8B A;  3WOF A;  2H1E A;  5JVH 3;  5EPJ A;  5IGG A;  1LTT D;  2QIL A;  5C5M A;  5JPN C;  1TU2 B;  4C3H G;  4OIJ A;  3KBG A;  1U4L A;  4K2K A;  1TWC B;  1E0B A;  1BCP C;  2EJF C;  3DEO A;  1ZYR D;  1G2T A;  2E2I B;  3HEJ A;  2F0S A;  2F1M A;  2VXW A;  1C48 A;  3N6R A;  1VF7 A;  3G7L A;  1Q8I A;  1FD7 D;  2DN8 A;  3R2I A;  2L4N A;  5COY A;  3VR2 A;  1QE6 A;  1O80 A;  1U4R A;  2ICI A;  2PNR C;  3QWN A;  4G57 A;  4KN4 C;  4R8N A;  4ZKC B;  1W6K A;  3J7A V;  3P1H A;  1EEI D;  2KHS A;  3EQL C;  1CT1 D;  4C3J G;  1BO0 A;  3HS0 C;  2NUC A;  4K2L A;  1ET9 A;  3RUZ A;  3CRK C;  3A8J E;  4BBS B;  1DOK A;  4PV1 C;  3S1Q B;  2HCC A;  2HQE A;  2BA0 A;  2E2J B;  2CW0 C;  3K5M A;  1JWS D;  1SJH D;  4P2C B;  1XYI A;  1PZI D;  3KBX A;  2F0U A;  1GUT A;  4H7B A;  2FMM A;  1JIC A;  3AB9 A;  4IFD H;  2F0F A;  2RBM A;  2IX1 A;  1RD9 D;  1EY6 A;  3NSW A;  4Q5V A;  3K5N A;  4OL7 A;  4RWS C;  3OMG A;  2K5D A;  1WTR A;  5K36 H;  5EBD A;  1PFN A;  5D3D A;  1AW7 A;  3HRZ C;  4RGT A;  1SYG A;  5JAV A;  5G3L D;  4MHE A;  2EDG A;  1JOR A;  1WCM B;  4OGQ C;  1M4V A;  2EYF A;  3RLF A;  2EZV A;  4ZUI A;  5EBC A;  2B2T A;  3TSS A;  4HN7 A;  4ZYS A;  4IAL A;  2XRS D;  4IUR A;  2O5I C;  3R93 A;  1QJO A;  2BE5 C;  3T56 B;  1Y1W B;  1CZG A;  1YNJ C;  3T4A C;  1BOS A;  5JOB A;  1STG A;  2SOB A;  1AZP A;  1SE2 A;  3D3R A;  1Q3L A;  1OXT A;  3D8G A;  3FRP B;  1U9R A;  3A8K E;  4DFA A;  1IKM A;  3A54 A;  4PMW A;  3Q22 A;  3VA7 A;  3E5S A;  3D4R A;  1EQV A;  3NTK A;  3ITP A;  1HQM C;  4HTH A;  2M00 A;  2XN9 C;  5EQ0 A;  4JBW A;  1JWM D;  1CA5 A;  1JWU D;  1GUO A;  1HQR D;  3MVV A;  5EKI A;  4FVM A;  2FIN B;  2IT1 A;  3HP3 A;  1NCV A;  1H9K A;  1EFI D;  1HPC A;  3SK6 A;  1HUM A;  1TS5 A;  2F3W A;  1B9M A;  4XT3 B;  3K7A B;  1Q1E A;  4C3J B;  1HHV A;  5LL6 S;  1IKL A;  3A8I E;  1JOQ A;  3D4D A;  4KY6 A;  4RCO A;  3GP7 A;  1TQO A;  4ZKB B;  1SXT A;  5CV9 A;  5JEA J;  2F03 A;  3GTK B;  5LHY 1;  2RDF A;  2X6L A;  1HUN A;  4BA1 I;  5I9P A;  4KJN A;  3OWE B;  1KDC A;  4CKC A;  2R6G A;  4FXD A;  4F87 A;  2A5H A;  2CW0 D;  3CHB D;  1EYA A;  1MI2 A;  4Y7N B;  3BZD B;  2PW5 A;  2PCF B;  2EJG C;  3VYU A;  3C1E A;  5IOD A;  4KKT A;  1RKN A;  2PQE A;  4EQN A;  2KCC A;  3FEW X;  3C2P A;  4EQO A;  4DAP A;  2TSS A;  2EYO A;  1S5B D;  4HSV A;  4Q0F A;  1F2Z A;  1SMY D;  1CHQ D;  3UI2 A;  4KI0 A;  4FF4 A;  4KD4 A;  5A2Q E;  1EZ6 A;  3EJI A;  1EY5 A;  4CHT B;  1F2M A;  1EEF D;  2D62 A;  2XWB B;  4ID6 A;  2F0D A;  4DGZ A;  4KK7 A;  2AQ2 B;  2K28 A;  1NUC A;  4UDU C;  2VNU D;  4EVO A;  1MGS A;  4HMI A;  2F4I A;  1LV9 A;  1IW7 C;  4CBV A;  3DWA A;  3RZO B;  1EYC A;  2B2U A;  5JJZ A;  2BE5 D;  1CFM A;  5CGK A;  4FP5 D;  3HOY B;  1YNJ D;  2B39 A;  2MUY A;  4KY5 A;  1GXD C;  5FO7 B;  4S3S A;  2EYH A;  2OT2 A;  1OXV A;  4XXE A;  5C44 B;  3K58 A;  3HOV B;  4RGM A;  3NHH A;  2R3Z A;  2Q8R E;  4A3J B;  3A55 A;  4BBR B;  1VMP A;  1T5E A;  4ULL A;  4DK1 A;  2ID0 A;  5DAU A;  1KNE A;  1QNK A;  1WD0 A;  5C6A A;  3QIA A;  1EOT A;  2ENB A;  2PW7 A;  3KF8 A;  2B63 B;  3H09 A;  5C0X G;  5M3M B;  2LKV A;  2BA1 A;  1DZ1 A;  2RSO A;  3MXU A;  4QUF A;  2EOT A;  1GJX A;  1MSH A;  5C3X A;  1AP0 A;  1B4O A;  3NQT A;  4L6T B;  2C9O A;  1W6J A;  4BY7 B;  2PZU A;  2F0O A;  2A74 C;  4RCN A;  4PNY A;  2B2V C;  1R9T B;  4TKO B;  5M5W B;  1HTL D;  2F0I A;  4FXG C;  1FR3 A;  5C0X J;  2A6H C;  2NVT B;  4O1N A;  5JEA G;  1U4M A;  5F2D A;  5I9O A;  3PO2 B;  1S5C D;  5C4H A;  3DHQ A;  1LAC A;  2MHV A;  3S9W A;  4U67 3;  1AEX A;  5ISR A;  1MSG A;  4A3I B;  1V1P A;  1BCP F;  1PTO H;  2B2U C;  1OXS C;  2LY7 A;  1WTP A;  2WKC A;  1AFP A;  5DM7 3;  1A6X A;  5LL6 X;  1DXM A;  1BCP B;  4HAE A;  1V43 A;  1I6V C;  3U9O A;  4CJ2 C;  2NTS A;  3WDN A;  4KV6 A;  2I46 A;  3QOJ A;  4G7O C;  3IL8 A;  1WTV A;  5IOC A;  3S1N B;  2B2V A;  3PV0 A;  5C5L A;  3ERQ A;  1SNP A;  1B44 D;  1H9R A;  3BVG A;  1KNA A;  1RJT A;  2MPM A;  1DCZ A;  2BCO A;  2WV6 D;  3NQI A;  1O7Z A;  1KLG D;  1GUG A;  4B9X A;  1CI3 M;  1TY2 A;  1GUW A;  4CKB A;  4IN3 A;  1PFM A;  2EY2 A;  1CM9 A;  3OSO A;  2BDO A;  1KAA A;  4ZLT F;  1F2Y A;  3GTQ B;  3M3Y B;  1NAP A;  5KNC A;  2O2L D;  1E2V A;  3L7Z C;  2F0L A;  2EY6 A;  3TZU A;  1H9M A;  4XQQ A;  2F0T A;  1JQY D;  3OHX C;  5J1Z A;  1C4Q A;  3R2T A;  1ONL A;  2LMC B;  2MJ8 A;  3I90 A;  1WTX A;  3SXH A;  1EQT A;  5D14 A;  1KDB A;  1SYB A;  4V0B A;  4RHR A;  3SE0 A;  3S1R B;  1PFB A;  1LTR D;  2PZT A;  1EY4 A;  1LTG D;  2WIN B;  3NP8 A;  3I4L A;  4C1N K;  4PMB A;  1BQQ T;  5FOB B;  4G7Z C;  4LMQ D;  1LTI D;  1EWH A;  4QMG A;  1TY0 A;  3Q23 A;  4NW2 A;  1T5X D;  2IL8 A;  3I73 A;  4R9W A;  2K1B A;  5J39 A;  2BOS A;  2Z1C A;  4NMZ A;  3KLR A;  4RKL A;  1SNM A;  3FKI B;  1FYC A;  4ILW A;  1IHZ A;  1KLU D;  3S17 B;  4OO1 I;  4A3M B;  3TDQ A;  1D5X C;  1X3P A;  2LFN A;  5J22 A;  3O13 A;  2JSO A;  5C4Z A;  3OMC A;  4FF1 A;  5T1G A;  1SSO A;  4C1N I;  4HCE A;  2DNE A;  1SYE A;  1V1O A;  2K7V A;  1ESF A;  3IFT A;  1O7Y A;  1FNU A;  2EXZ A;  2J7Z A;  1NR4 A;  2NN6 H;  2IJ0 A;  3R3O A;  5ELB A;  2L11 A;  2NN6 I;  3K6O A;  1WVL A;  4BY1 B;  2PPB C;  1I4Q A;  1I4H A;  2EYM A;  4B9W A;  2G9H D;  3D4W A;  3T16 A;  4K6L A;  2QKI C;  1E2Z A;  1XWE A;  3TP5 A;  3SK5 A;  3E0J A;  4A3K B;  1D5M C;  1TII D;  2NVY B;  4I7Z C;  2JYO A;  3LX0 A;  2PMZ B;  3HOZ B;  3T51 B;  3HOX B;  2G9D A;  2DNC A;  4B08 A;  4ZQ3 A;  1TS3 A;  1CQF A;  1TWH B;  2L0C A;  1B50 A;  2JP1 A;  4XT1 B;  1RCV D;  4ZUJ A;  1L0Y B;  5CV7 A;  3A7A B;  5NUC A;  2AQ1 B;  2E74 C;  5IGF A;  1SAP A;  3NBI A;  5I4D A;  2O5J C;  3TZD A;  2NVX B;  3MA2 B;  5IGE A;  2NVQ B;  2WB1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...