1SSOA

Solution structure and dna-binding properties of a thermostable protein from the archaeon sulfolobus solfataricus
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
62
structure length
62
Chain Sequence
b'ATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SSO7D
molecule tags Dna binding protein
source organism Sulfolobus solfataricus
publication title Solution structure and DNA-binding properties of a thermostable protein from the archaeon Sulfolobus solfataricus.
pubmed doi rcsb
total genus 4
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1995-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ssoA00
1JE4A 1NCVA 2B2WC 2X6LA 4HSVA 1JICA 2FFKB 2XIWA 1G91A 2HUGA 1KNEA 1E0BA 2B2UA 2K28A 1CM9A 1Q3LA 2X6GA 4IUUA 2H1EA 3DEOA 2L1BA 1EL0A 2EOTA 1MSGA 1WTXA 1BBXC 1QE6A 1HFGA 5CORA 4IUQA 3H91A 1GUWA 4IUPA 1HHVA 1B3AA 2HDMA 4RA8A 3KUPA 3Q6SA 5CMDA 2B2VC 1G6ZA 3R93A 1ZXTA 1DOMA 3IFDA 4U68A 5T1GA 4NW2A 4ZLTF 2BDNA 2HDLA 2RSNA 4RAUC 3GV6A 2Q8TA 2Q8RE 1BF4A 1RODA 1B50A 1HRJA 1NAPA 1O7YA 2IL8A 2L9HA 2NYZD 4XT1B 5EKIA 1B53A 1WTQA 2JP1A 4CJ2C 2L4NA 2N55A 3N52A 4IURA 2FINB 4X3TA 2B2WA 5DNFA 2X69A 4QUFA 3G7LA 1SAPA 3FPUB 4MHEA 5EPKA 1B4OA 1KNAA 1PFMA 5EPLA 2HCCA 2KEEA 1J9OA 3TZDA 2R3ZA 1TVXA 1AP0A 4ZKBB 1ILQA 2N88A 5COYA 2FHTA 1C8CA 2M2LA 1WD1A 1CA6A 1ILPA 3HP3A 2KUMA 1ML0D 2SDFA 1WTOA 2K03A 4HCSA 3D6WA 1PDQA 3I8ZA 2EE1A 2K1BA 4IUVA 1F9PA 5D65A 1PLFA 1X32A 2RVLA 3GV3A 4CJ0B 2MP1A 4OIKA 2D9UA 1EQTA 2RSOA 1U4MA 1PFNA 2B2TC 1U4RA 2MJ8A 1HFNA 3TN2A 3KBXA 2B2YC 4HEDA 1S4ZA 1LV9A 3IL8A 2JYOA 4ZAIA 5D14A 2FJ2A 1IKLA 4QUCA 3LWEA 1WD0A 3P7JA 1G2TA 4R9WA 4X3UA 1VMPA 1EIHA 1NR4A 1F9RA 4XDXA 2L11A 1IKMA 1QNKA 1CA5A 4DN4M 2CVRA 1XX8A 1EIGA 2DY7A 1F9SA 5AFWA 4OIJA 1HA6A 2RA4A 2MGSA 5T1IA 1HUMA 1SSOA 1U4LA 5E4XA 1MSHA 4X3SA 1PFBA 1WVLA 1XYIA 1WTRA 1AZQA 1DZ1A 4O42A 5CBAE 3SVMA 2DY8A 2B2TA 1BO0A 1M8AA 2KECA 1EOTA 3MWYW 4LMQD 2B2YA 1MI2A 5CBEE 1BNZA 2HCIA 1RHPA 1X3PA 3ONAB 2KVMA 1DOKA 1ESRA 1X3QA 3I90A 1B2TA 2K04A 1WTVA 3DM1A 5EPJA 1DONA 3UI2A 2B2UC 1AZPA 2FMMA 5E4WC 4IUTA 1RJTA 3MTSA 5JJZA 1U4PA 1J8IA 2J7ZA 1HUNA 1A15A 2KEDA 1IL8A 3DEPA 1WTPA 1O7ZA 4ZKCB 2NZ1D 1G2SA 2VXWA 3F2UA 3I91A 3QO2A 2B2VA 2K05A 3I3CA 1O80A 1QG7A 2NWGA 2L12A 1WTWA 1DOLA 1F2LA 1ICWA 4MN3A 1RTNA 1SDFA 1NR2A 4UAIA 4X3KA 5EQ0A 1F9QA 4CJ1B 1VMCA 4R8IA 4HAEA 1RTOA 2KOLA 4XT3B 5EJWA 2EPBA 3FDTA 2K01A 4RWSC 1MGSA 4ZK9B 2MPMA
chains in the Genus database with same CATH superfamily
2VQEL 4HJ7A 2NTSA 2JA8B 1BUVT 1LTID 3Q8DA 3KJPA 4IO9A 3K7AH 5DAUA 3CPWA 3EVQA 2SEBD 3BDCA 5CR3A 1TXYA 3H91A 4EGVA 4IUPA 2OT2A 1PH3A 1V9PA 2UUCQ 2TMPA 1C4QA 3KF6B 5C6AA 4JW0A 1Y1VG 1G6ZA 2BDOA 3CCQA 1HJPA 1D8LA 5IT9L 1CHQD 2RSNA 4GKJL 1BKBA 3U58A 1RODA 2BOSA 1PVOA 3J81L 4XQNA 2IJ0A 3K5LA 1N36L 2K5DA 4PZ6A 3HG9A 2FINB 5DNFA 2B2WA 1SAPA 4EQ5A 1Q12A 4GKJQ 1X56A 3TDQA 2NN6G 4AQYQ 5LL6S 2M2LA 3A5ZB 4C3HG 3I8ZA 1TS3A 4X6AH 2CWPA 4ID6A 2RVLA 1SE3A 1Z9FA 3NHHA 4LUOA 1XMOL 3HOXH 4X64Q 2XRQD 4K6DA 3K80C 1HFNA 4FXKC 1JB3A 1I6HB 1CHPD 4UDUC 4X3UA 3PSIA 1MIUA 4HIOA 2CQOA 1CSPA 1NR4A 4R4QA 1DGSA 5NUCA 4BY1G 1F9SA 4OIJA 3HOWB 1FNWA 1TWFH 4BBRB 5GAHC 4FF2A 5E7NA 1QVFA 3EQLC 4N8X1 4FNFA 3ULPA 4PMWA 3HOWG 2LXKA 3MWYW 1GKHA 5FJ8G 2C9OA 1PYWD 4L6TB 1K83B 1TS4A 1NBWA 4IZ8A 1NE3A 2QEJC 1JWUD 2B2UC 3VYUA 3BS1A 3K5NA 1SFOB 3GTKH 4DUZL 5M3MH 1WTPA 1IL8A 3I2ZA 3G71A 3K5OA 1XNQQ 3BZDB 1YNXA 2EXZA 2L12A 3M4PA 4FVMA 2ES2A 5KYIA 3PIP3 5EJWA 2B8FA 2Y0SB 2BE5C 2FFKB 3TSSA 1IYJB 3J80i 1N34Q 3S16H 3CXCA 3PQIA 2ICEC 3P20A 1OXUA 3AMUA 2PMZE 1GXDC 2D0PA 1SYBA 4YWKA 1B3AA 1IBKQ 3EFXD 4RGMA 1QOHA 3KUPA 1D6EC 5DEHA 1ENFA 5C3XA 2CKZB 4ODGA 3S1MB 4ZLTF 3M3YH 3KDFB 4C3IB 1I4RA 1SNQA 4CDCC 1O78A 2A69C 3QR8A 4KD4A 4BS9A 1E22A 5IT9c 4DAYA 4A3JH 5IE8A 2UUCL 4A75A 2K5QA 4MIUA 3QG1A 3Q23A 3N52A 1LLRD 4WORA 1AW7A 5IWAL 1TWCB 5IYCG 2IX1A 2KENA 4KJNA 3MXGA 4A3MH 4A3GB 1KNAA 2K5HA 1HR0L 1WYDA 2EYMA 4P75A 4JV5L 4NXML 4DK1A 3T16A 1EY0A 1EUJA 1RIPA 4L63B 3ERSX 3CRKC 2QEXA 5D65A 4DR7L 1PH4A 2D9UA 5GAGC 3S2HH 4R1JA 4A3CG 2F0EA 2ID0A 1I3QB 2JA7B 5JEAH 5JPMC 1VDZA 4DAYB 3NENA 2WAQB 2XVSA 3NQTA 4DR1Q 4X64L 4OONA 1VQNA 2WFWA 2L11A 1Y14B 4LFBQ 2OF1A 2ZXPA 1IHZA 3O13A 2AQ3B 4QY7A 3VA5A 1SNPA 3OTOQ 4AYBB 2MGSA 4K14A 5D3DA 4XXEA 2WB1E 4ME3A 1PYSB 1KHIA 1Y8OB 4GN3B 3S9WA 2EZVA 5M3MB 4JYAQ 1PRTD 4AYBG 3SVMA 1BOSA 3J80L 3NBIA 1X3PA 4LF8L 3I90A 2A19A 5ELNA 3J7ZC 4PG3A 3K7UC 3NEMA 5M3FH 4LF8Q 4I7ZC 2JA6B 1RJTA 4LF6L 4DNTB 1J6QA 1YZ6A 3AFPA 1PH7A 4DV2L 4K2KA 4CDEC 4B3RL 2JJQA 4UP8A 1STAA 1L1OC 2NZHA 4LAAA 5EQ0A 5IODA 2Q2UA 2HQLA 4JI5L 1WI5A 1K0RA 5KNDA 3FDTA 3VR2A 2NB0A 5M5XH 3GTOB 4WRDA 1HQRD 4NPSA 4OWWB 4DU9A 3RZDH 4HJ5A 2IX0A 4DR1L 3RMHA 2G9HD 4OHJA 1HHVA 1TWHB 3H6MA 4RA8A 3K81C 4DR2Q 1KQSA 4HSPA 3PIO3 1EOVA 2PI2E 3U4VA 2L55A 3VR4A 2E76C 4B9XA 2Q8RE 4C1NK 1B9MA 2RDHA 1Z7TA 2I46A 3STBD 3VA7A 4JI7Q 4CKBA 4NXNQ 4FF4A 3W3AA 5BN4A 1J9OA 4B3TL 1EY8A 4JC0A 2UUBL 3KBGA 1ILQA 3FEWX 1V43A 3DXJC 2KUMA 4DV0Q 2SDFA 4IUVA 2F3WA 1IBMQ 3HOYB 2R7ZB 3V96A 3H3VI 2MNAA 1A3TA 3MAQA 4F87A 5IGFA 1HR0W 1ET6A 5FOBB 2JA9A 2FJ2A 1GUTA 3P7JA 4X65L 4DNRB 1IBML 3T1YL 4LWCA 4H13C 1STBA 4GKKL 5AJ3Q 1R9TB 1Y1WG 4GLAC 4HJ8A 4K0KQ 4HTHA 2I0QA 3OHXC 1BCPB 1GUOA 2F0GA 4MTKA 1EWHA 2JA5B 3CHBD 1F2ZA 4A3IG 3HOVG 4IQZA 3TS2A 3AEVA 3D4DA 1IYVA 3A8IE 1HXYD 1JC7A 5IYCH 5A35A 3ERQA 5JJZA 4J15A 4HJ9A 2E2JH 1A15A 4DV3L 3DWQA 5IGBA 3S17B 2E2HH 2GVBA 4JI3Q 2YU9H 1EFWA 2NVTH 4KN7C 1MHWC 2PQAB 5LMUL 1BQQT 5I6YA 3TS0A 1VMCA 3CD6A 2FMCA 4B3RQ 1VQEA 4A3CH 5KYLA 1KNEA 4DUYL 2X6GA 4XIGS 1YHBA 2Z9HA 4NDXA 3TBIB 3E6ZX 5IP7G 2HDMA 4LF9Q 2MFIA 3QOLA 1EY5A 3HFZB 1MD2D 5C44G 1CK1A 5ELOA 1QUQB 4HIDA 2F0DA 1B50A 1NAPA 1TIID 4JI8L 2DJFC 3M4QA 1S5CD 2A73B 4IFDG 3HOVH 5M5XB 3NWSA 1LABA 4IUNA 1SYFA 4GLVB 1W3SA 3F1ZA 1NMFA 1PFMA 3TZDA 1C9OA 3HOXB 4CKCA 4G7OC 1BXTA 1HNXL 1WD1A 4GN4B 2PO4A 5EKLA 1U0LA 3K0YA 1QWYA 1WTOA 4G57A 3GTLB 3T53B 1PZKD 3D4RA 1N33Q 2KJXA 1LACA 1EIFA 1GD7A 3KBXA 4OO1H 2WACA 1ZYRD 4MNOA 2PNRC 5M9OA 2PCFB 5KIXA 1FGBD 2CW0D 2VQEQ 1E1OA 1CA5A 2EIFA 4JI2L 5AFWA 4DR5Q 1AE2A 5EBCA 3G48A 2WINB 3BVGA 4FXGC 4ZUJA 1WVLA 1H9SA 1Q86C 1Y1VB 1D5MC 1AH9A 3MXNB 5E3FA 1DJRD 1SFOH 5K36H 2JA8H 2R7ZH 1ET9A 5KEEA 5IGGA 4BBSB 1DONA 3BYTB 1KLUD 2AKWB 5JJIA 2NVYB 1STNA 1C0AA 4KY7A 5FLXL 1DYQA 3W1GA 2WP8J 1X3GA 4DR4Q 3KF8B 2NZ1D 3NTIA 1G6PA 5M3FG 2F0HA 3S15B 2D2CC 3H0GG 2R93B 4ULLA 1EFID 3NE5B 3ZYYX 3PIPA 3PUZA 2O5JC 2ENBA 1DD2A 3R2TA 4GZYC 3D6CA 3TMEA 1H9RA 1U9RA 2CHBD 2BH8A 1HQMC 5I9PA 5EGTA 1VQFA 4IUUA 5IIFA 1WOCA 2A6EC 3NBHB 2A68D 3DEOA 2L1BA 3MA2B 3BVMA 2AUKA 2QKIC 1GUWA 1YNND 1GUGA 4A3FB 2LFNA 1ZKOA 2DUDA 1FGUA 2NTTA 3KOJA 2KCCA 4RAUC 1I4HA 4WJ3M 4KHPL 1EY6A 1PZJD 3Q24A 3HZXA 1EQQA 4MHEA 3GTMB 1HCZA 5LL6X 1H9JA 3A54A 3VYSA 3T4AC 3AFQA 2DGYA 1KRTA 3SK4A 2EYHA 4E6IA 2GVAA 2ATWA 5HY6A 4DV7Q 3MHBA 2K75A 3VR3A 1DXMA 2RHSB 5CV6A 1WJJA 3FP9A 5CV7A 4DAPA 1PH2A 1U4MA 4DV6L 3ULLA 1U4RA 2EJGC 4R4OA 4POGA 2F0TA 4A3GH 1B1ZA 1EY7A 1H9KA 4JI5Q 4L5SA 1IYUA 1PZID 2ZM6Q 1WD0A 1Z6HA 2DJGC 2F0MA 1EWIA 4WFN3 4DV1Q 2A5HA 2F0SA 1ONLA 2OQ0A 2EYFA 2UU9Q 3NK9A 4JI7L 3KK7A 2WB1G 5ELEA 3S1MH 1TWFB 4J1MA 2DY7A 2V4DA 5JOBA 4DPGA 4GNXB 2UU9L 2ZTDA 1R9TH 1PFBA 2K4KA 4UY8C 1GM5A 4KHZA 2XNAC 3D31A 2EXDA 1VQIA 1K8GA 1M8AA 1PH5A 4C3IG 2KVMA 4O1NA 3OWEB 5CV5A 4AQYL 2IWHA 1QILA 3I70A 1Q7YC 4BY7G 4XTCS 5CC4A 1KTKA 3RD4A 3RZOH 2K33A 1N32Q 2J7ZA 4IPCA 4DV7L 1RCVD 3JAMi 2LMCB 4YWMA 5DLQE 1TWGB 4RGTA 3AB9A 4JI6Q 4N9TA 1TWAB 1A3VA 4BXXH 4GN5A 5J1ZA 5IP9H 1AEXA 2KOLA 2V1CC 4TSSA 1E2VA 4RWSC 3FVQA 1PH6A 1KDBA 1XYIA 2XWJB 2HUGA 3HKSA 4H44C 3CF5A 1SE4A 1S5DD 2NVYH 4DV4Q 5GROA 1BCPC 4LFAQ 1QE6A 2XRSD 5LMNL 2DN8A 1VQMA 5GQOA 3TREA 5JJKA 1ZXTA 3IFDA 1H9MA 1STHA 3ITPA 1M1KC 4A3LG 3GV6A 4M1UB 1KABA 4JOIA 1JWSD 1QB5D 1UE5A 5KNCA 4EQOA 3T56B 4A3FH 3I4NB 1K83H 1EYCA 1F2MA 3FKIH 4QIWE 2NZOA 4EX5A 3F2DA 4R8NA 2JE6I 1JCKB 4C56C 2FHTA 1YNJC 4JPBW 3HOYG 2A6HC 3Q22A 1N34L 2EY2A 1Q1EA 2SOBA 1QVCA 3U9OA 1EYGA 4K6LA 1PTOC 4H0LC 2B3GA 2RSOA 2JA5H 4HR7B 5C0XJ 2ICIA 2RCNA 2D62A 5KNBA 3CRLC 1K9MC 4R9WA 1JOOA 1T5EA 2JA6H 1TWHH 2MHVA 1F9RA 3R2IA 4GLXA 1PXUA 3H0GH 3CMEA 3GTPH 2NUCA 1XX8A 5A2QE 2QDBA 4ZUIA 4JI6L 3M4YA 5C4XB 2OTLA 4M8AA 3CCEA 3MEHA 1DZ1A 4DAMA 2DY8A 2B2TA 2KECA 2ZT9C 1LTTD 4ZCKA 1B3QA 1TY2A 3UDIA 2EJMA 1B2TA 4BWGB 2NVXH 2R6GA 1UEBA 4DV4L 3ZJYC 3F2CA 1GHKA 1FNVA 1W6JA 4JG2A 1N8RC 4YY3L 1XMQQ 4NXNL 4IUTA 2Y0SG 3NUCA 4L5TA 1FVIA 1HPCA 2NN6H 3CCUA 1N9WA 5ELBA 2NWGA 3PO2B 3ND8A 4MN3A 1F2YA 4ILWA 3W1BA 1QNUA 2PZUA 5ELFA 4OX9Q 2SNSA 2VNUD 3RLOA 2NVQH 3S1QH 2B2WC 2Z6BA 1LTLA 1NSNS 2GA4B 1IXRA 2E2DC 2B63G 2EDGA 1STEA 2PI2A 1VQ5A 2VW9A 3CCSA 2OQKA 4HMIA 3BJUA 4A3EG 5IWAQ 1E3PA 4DKAC 2FXQA 5IYBG 4NMZA 1HRJA 1BBWA 1HA5A 2D5DA 5IP7H 3SGIA 4DF7A 2JP1A 4CJ2C 1JORA 4JI4Q 1Q1BA 2X69A 3FPUB 3H94A 2KEEA 4PV1C 4Z9CB 2JQOA 3K59A 4IOAA 2EJFC 3JAML 2N88A 3LNNA 4J8QA 1PRTF 1C8CA 2E74C 5I4DA 3BDLA 4JI0L 1MJEA 2K03A 1VQ8A 2UXCQ 2G5DA 4LF7L 4WJ4A 1Z47A 1MJCA 1K8MA 2B2YC 3I4MH 3M3YB 1JT8A 1XPRA 4KY6A 1EY4A 4MZ9A 3NPPA 1OXTA 1HNWQ 2N49A 3I73A 1XTDA 4B3SQ 4A93G 2IT1A 2HHHL 1X3FA 3IFTA 3S14B 5IT9E 1S5FD 2KCNA 3IKJA 5HGTA 4LF5Q 2AQ1B 4KLKA 4DXGA 4LF4L 1RHPA 3I7FA 4R4IA 1ESRA 1JQYD 3FKIB 3J7AF 3QJYA 1L1OB 5E4WC 1PV4A 2F3IA 4KV6A 3FKIG 2ZM6L 3KLWA 1NNXA 3K8AA 3MTSA 1U4PA 3CC4A 1V1PB 1JWMD 3I91A 4QL5A 3PUXA 3G6EA 1F2LA 3NQIA 1RTNA 1NR2A 1CKNA 2VUMB 2OWOA 1VF5C 1JJCB 2ZXRA 4C2MB 1SLJA 4MTNA 1HNZL 1PTOF 4JV5Q 1SE8A 2Z6KA 5M5WB 4GOPC 3BZCA 1JICA 4RHRA 4TRDA 1G91A 5J22A 1D1KA 3L2PA 1EWCA 4OX9L 1TWAH 2CH4A 4JI1Q 1NTGA 2M9VA 3RUZA 1MBYA 4U673 4A3LH 3MVVA 4LNQA 1XNRL 2SNMA 5GADC 4KN4C 2CCZA 1SYGA 2O5IC 2K14A 1IBKL 1G51A 3TZUA 1Q8IA 1OTCA 1UWVA 4DV5L 5I6WA 3D8GA 1LT3D 4IPHA 2WKCA 2I5HA 4DR5L 3FPPA 3J7A5 3I56A 1WTHA 4HCSA 1M4VA 1X55A 3A0JA 2EY5A 1F9PA 4K5VA 2R61A 1B9NA 4V0BA 3PO3H 1GJXA 4OIKA 1EYAA 1EQTA 4KKSA 2LS01 1S4ZA 4FF1A 4ZAIA 5D14A 5L37A 3LWEA 1XPOA 2ALYB 2ZTEA 1SBBB 4A3IB 3PMFA 4A3DH 3HOUH 3K5MA 4NXMQ 1ASYA 4P74A 1ZEQX 1A63A 2IY5B 1SSOA 4LFBL 1H9SB 4RHSA 1IBLQ 3I4MB 3BG3A 4X62Q 2P5ZX 1VQ4A 3RZOB 2B29A 1E7ZA 1BNZA 5ELDA 3SEBA 5JVG3 4IFDH 2PZTA 3RLFA 3EBEA 4LUZA 2PQAA 2Q2TA 5EPJA 3S1NB 3OMGA 1MKHA 4FYDA 1SMYC 3TP6A 1EU3A 2EYPA 2VS1A 4P2CB 4I7AA 2KEDA 3LGJA 3A7AB 4YWLA 4KY5A 3SXHA 5IYBH 4A3JG 1ENAA 1QG7A 1XMOQ 1TY0A 3OIQA 2OCEA 1HZ9A 1SDFA 2F4VL 1J5EL 4R8IA 3E5SA 1W2BA 3MXUA 1UUPA 3GTJH 2K01A 4JBWA 1JE4A 4DV6Q 1KL9A 5EAYA 2TSSA 2XIWA 2B2UA 1TKWB 3PUVA 1S40A 2WAQG 1MSGA 4OXPA 2JEAI 2K6AA 4IFDI 4BA2I 4K0KL 1KAAA 2GN5A 3EA6A 4QCLA 4BA1I 1P16A 1SMXA 3VYTA 1GOZA 1YBYA 3OSOA 5F2DA 4HMJA 1XNQL 2K52A 4BBRG 3G6JB 3DWAA 3UE0A 2B8GA 1B53A 4PZ8A 2OEOA 1FL0A 3QWNA 1TR5A 1WTQA 1B44D 1WCMG 2N55A 3A8JE 2IX3A 3HOZB 5IYDH 1B4OA 4A3BB 2CH4W 2QW7A 4DR4L 3PCOB 3TEHB 3HOZG 1AP0A 1ILPA 1T5XD 1ML0D 4LFCL 5IGEA 1JB7A 3D6WA 1PDQA 4JI1L 2H5XA 2EE1A 2K1BA 2E8GA 2PMZB 3RN2A 5LMNW 3NP8A 1YIJA 1VQHA 1X3EA 1VQ6A 3CW2C 3H0GB 2R93G 3HOYH 1Q46A 2A74C 5FJ8H 4BY1H 4DV0L 1Q81C 1UAPA 1VQKA 4DUYQ 1EIHA 1R4PB 4ALPA 4QQBX 4XDXA 3L7ZC 3VR5A 2R7FA 4A3BH 2BH2A 4BBSG 3D0FA 4JK1C 4Y52H 2Q8IB 5I9OA 4A93H 1U4LA 4UHVA 1AZQA 1I4XA 2Q2IA 1G8ZD 3J80E 2A8VA 1SNDA 1JR0D 1E1TA 2EY6A 3ULJA 1LUZA 1E2WA 4R4CA 4G4KA 4B3ML 2I5LX 2LKVA 3X3NA 4DK6C 3UI2A 4DNIA 1S72A 3I4NG 4JBJA 1GUSA 3NBHA 1CKMA 4UP7A 1HUNA 2KHSA 4GNXA 3DEPA 4F7XA 4RKBA 3F8TA 2F0OA 4KTAA 2E2JB 3E0JA 2C5CA 4BY7H 4X3KA 1I94Q 2RBMA 3EIVA 1SNOA 2ZJQA 2MO1A 5K5PA 4JYAL 1I94L 4RGNA 2X6LA 2CFMA 2R92G 2K28A 2KA7A 4YCVA 1CUKA 2ZXOA 4KHPQ 2RHQB 1TWGH 1PH1A 4J6HA 4Y7NH 1LO5D 1TQOA 4C3JG 1BCPD 3M9BA 3WOFA 3T1HL 1TU2B 3RN5A 4DV5Q 2Q8TA 3SK6A 1XTCD 2QA4A 5G3LF 4C3JB 5BN3A 4A3DG 3OW7A 2L4NA 1YNNC 3G7LA 5EPKA 4LJZC 3UDGA 5K36G 2L15A 2Z4HA 2A6ED 1Y1WH 4A3DB 1OXXK 4LW1A 4DAVA 3HKZG 1HZAA 1D7QA 2A68C 2YV5A 1I4GA 4LF9L 1XPUA 1STYA 2A1AA 3IAYA 1JOQA 1SJED 4IOCA 1IZ6A 1IBLL 1XXGA 5BR8Q 2ZTCA 2EY1A 3TN2A 4HEDA 1K8AC 3C46A 1NJIC 3OMCA 3IL8A 3PO3G 1V8QA 2E2IB 2AWOA 2KCMA 4X66L 4GS3A 5JEAJ 4K8JA 2PW5A 5H1SE 4DR6L 1V1QA 3ND9A 4JVZA 1V1OA 1CKNB 3H09A 4CGYB 2VQFQ 3SR1A 5C4XH 5JEAG 3PGZA 5C3EH 3HOUG 1SYDA 4ABNA 4KK7A 2JA7G 2MQHA 1A8VA 2UUAQ 1PYBA 1SRUA 4C3JH 2Y0SE 2AHOB 3R3OA 1X65A 2JA6G 2YYZA 2HT1A 4XYOA 1JJ2A 3GP7A 4JI2Q 4LF6Q 1ENCA 2HCIA 1AFPA 2IHEA 3AQQA 1TT2A 4A3GG 3GTPB 3SK5A 4LUVA 4K8IA 1D2BA 1EZ6A 3UE1A 1D1IA 2F3VA 5M5WH 3MFYA 3GTMH 1G2SA 2VUMG 2F0UA 4IPDA 1O80A 1VQOA 3E9HA 2UXCL 1F9QA 4CJ1B 3CMAA 3QIAA 2EVBA 4FF3A 1II3A 1K28A 1MGSA 4PMBA 4DV1L 3PIOA 2ASBA 2EYJA 1PTOD 2CW0C 5KRUA 1CM9A 2H1EA 4B9WA 1VQCA 1X6OA 1UEAB 2CQAA 1PRTC 1S5BD 3NELA 5J3BA 2B2VC 1KRSA 2N3SA 5M3MG 5BR8L 5HURA 3PF5A 4NKLA 1DM0B 2QGQA 2LXJA 3U9SA 4P73A 3HOZH 4KHVA 2M00A 2F0LA 1PTOB 3PUWA 4QJFA 1TVXA 1IW7C 1I50B 1CA6A 1TS5A 2BA0A 2XTIA 4UP9A 4K5XA 4A76A 4F8MA 2IPKD 1A0IA 3MXPA 1PLFA 1Q8KA 3DHQA 4CJ0B 4RH6A 5JVH3 1Y1WB 3PO2G 1Y1VH 4LK1C 3STBC 1S5ED 3J81E 1L2FA 1N32L 2PZWA 2K50A 4A3KG 3KJOA 3FMCA 4KD3A 2YTYA 3U4ZA 1VQLA 3EN2A 3S2HB 1LYLA 1QNKA 3PV0A 2CVRA 1A2UA 1SNCA 3I4MG 4A3KB 3FHWA 3DMUA 5FLXE 2BA1A 5IP9G 1Y8NB 1JJGA 2L0CA 3C2PA 4IPGA 2EQSA 3K6OA 5C4HA 1L1OA 1QJOA 4C3HH 5FLXc 4RG1A 5AJ3L 3N6RA 2A69D 2F0JA 1PH8A 1G291 1B70B 3J80c 4FXDA 1KLGD 1SE2A 4DA2A 4EQPA 4LFCQ 1GHJA 2DNCA 1K8OA 2OTJA 1J8IA 1SYCA 3HOVB 1VQDA 1JOKA 4OGQC 1I50H 1EU4A 2L5TA 1CT1D 3CC2A 3UDXA 3PO2H 4A3IH 1RTOA 2IW3A 3MXNA 1UE6A 3S1RB 4G7ZC 1NY4A 4EVOA 2CWAA 5C44H 3LX0A 5EKKA 2OXPA 3DLLA 1NMGA 3S2DH 2I5MX 3J81c 2R92H 2UXDL 5CORA 1LT4D 3HRZC 2NVXB 2NVTB 2RCFA 3HOWH 2YU9B 4RMFA 3M4OH 4U68A 4NW2A 2HDLA 4DV2Q 4L5RC 1ZYRC 1YNJD 3NTHA 5C4JB 1HNXQ 3OYYA 3A8KE 3BVZA 2PQEA 1JMCA 3GTOH 3DM3A 2D0OA 1I6HH 2MO0A 3K57A 3C1FA 1YVCA 4LF7Q 1WFQA 1AN8A 3MC0B 1GVPA 5EPLA 4OEMB 1FD7D 4PNYA 1L0WA 4JI8Q 3UDFA 4DUZQ 4DR3L 2F0QA 1UE7A 4WJWA 1GO3E 3BYYB 4X66Q 5C0XG 2DNEA 3Q0AA 5M3FB 2AMCB 3J7AV 1I4QA 4A3EH 5BN5A 1UE1A 2JA8G 2F4VQ 3TQYA 2KQ3A 2QCPX 2JK8A 2N8NA 1EYDA 3CCLA 2F4IA 1RDPD 1VCIA 3EROA 1VQGA 1HZCA 4DN4M 3WDNA 1J5EQ 5C3EB 4POFA 2HD3A 5FKAC 2VB2X 4DK3C 3J81j 5FLMH 1CKOA 5IOCA 2E75C 1DCZA 1QVGA 4YIJA 1Y69U 1EOTA 5CBEE 1C48A 1FYCA 4CDDC 1E24A 4GOPB 3DM1A 1WTVA 1AZPA 1RL2A 4L5QA 1EEID 2IHFA 4CKEA 3DWPA 1YHQA 4DR2L 3TP5A 3G4SA 2R7ZG 2UXBQ 2EYOA 5CV4A 1U5KA 2EYLA 1DOLA 2F0IA 4HIKA 1KD1C 1ICWA 1EIYB 4A3FG 3KLRA 5FO9B 3GTLH 2J0TD 4DXFA 5IY0A 4C1NI 1NCVA 4RCNA 4X62L 2PNHA 1HNWL 1RF2D 1Q3LA 3JAME 1C7YA 3AYHB 1IL2A 3OTOL 5FO8B 4H7BA 1D5ZC 4DR3Q 1LTGD 1SEBD 4IUQA 3M4OB 3I4OA 5CMDA 2JA5G 4LF5L 1XJVA 4V190 5C4JH 2BDNA 2N78A 3CQZB 2UUAL 3CPFA 4HJAA 3OW2A 4QMGA 3CCRA 4XT1B 2XGTA 4B3TQ 4PMCA 4QUFA 3HKZE 1OO9B 5C0XH 3A56A 1PFSA 2K7VA 1SXTA 2NN6I 3GD7A 2ZJPA 1TS2A 4BY7B 4P71A 4I65A 1FJGQ 1QCBD 2R7DA 4FO2A 1W6KA 3CAMA 1HTPA 3V05A 2BE5D 3A7LA 4UPAA 3J81i 3AU7A 2A6HD 3OWFA 1BR9A 2MP1A 2WIIB 3VR6A 4JOIC 2PPBC 5FK9C 4H02A 1LV9A 1IKLA 1FR3A 1VS0A 3U50C 3OOCA 4YHHL 1IKMA 2R92B 2JSOA 3GTGH 1D5XC 2G9DA 2K5VA 2B39A 2JEBI 4ZQ3A 1GUNA 2HIXA 1F77A 4QIWB 2LSSA 3I55A 5E4XA 4XQQA 2K5NA 3L9AX 5JJLA 4FP5D 5JAVA 4YCWA 4A3EB 1UNSA 3HS0C 1YEZA 3RLNA 1MI2A 3ONAB 1DOKA 3KFUA 4GOPA 1HZBA 2E2HB 2RF4A 2BCOA 4A3MG 2VY3A 1LTAD 3H3VH 3VYRA 5C3WA 4A3BG 3CU7A 3ER0A 2F0VA 2PYKA 2UUBQ 4C3IH 4A3MB 4QB4A 2HHHQ 4RCOA 1O7ZA 1FJGL 4ZKCB 3DUZA 1PMRA 2K05A 4Y7NB 4GKKQ 3C3LA 2H4OA 2F0PA 1I4PA 5I2XA 4X65Q 1KC8C 1LT6D 4HAEA 1SNMA 3HGBA 1SROA 3P1HA 2UXDQ 3K58A 4HSVA 4A4IA 4NP5A 3TP7A 2AUJD 1STGA 2F0WA 4DFAA 1YJWA 1CZGA 4JBKA 4B3MQ 3P75A 1WCMB 3S2DB 3S16B 3X3MA 4BBSH 1BBUA 4Q0FA 3J7YW 4OWTB 4JBMA 2I07B 3B6YA 2VB3X 5ELCA 1DOMA 4AIMA 5T1GA 3S1RH 2JXMB 2QDLA 4RGOS 3MEFA 3CCJA 1O7YA 2L9HA 3GTQB 4IJLA 5FLMG 4X3TA 5CGKA 1K3RA 4RFBA 2F0KA 1OXSC 3A55A 1AE3A 3S17H 1LTSD 3BZKA 4IFDJ 2K32A 3GO5A 4XYQA 2R3ZA 2Z4IA 4ZKBB 1PTOH 2Z0SA 4HCEA 4OWXB 3NXWA 3R8BA 3QOJA 1KDCA 3GV3A 3T1HQ 4RKLA 1VQ7A 2F0FA 4TKOB 4C3HB 1PFNA 5HGQA 4B08A 2JYOA 3S15H 2XN9C 1SYEA 4BBRH 4QUCA 1VMPA 2YTXA 4S3SA 3KLSX 3NTKA 4C2MH 5IYDG 1Q82C 3F2BA 4F88A 2HQEA 3CP0A 2QILA 2F0NA 3RZDB 3KF8A 4K2LA 5T1IA 1HUMA 4G7HC 3GTQH 1MSHA 3BDOA 4X3SA 3W5OA 5DM73 5EBDA 4BY1B 1XWEA 1I5FA 1Y8PB 1QUQA 1PH9A 1KXLA 4LMQD 1IW7D 1P8LA 2B2YA 2R93H 1X3QA 3H15A 4FDBA 1I3QH 3W2DA 2JA7H 2FMMA 4XQJA 4IJHA 1A62A 1CFMA 4YHHQ 5CV9A 3F2UA 1N33L 3JC66 1PA6A 4AYBE 1Q90A 4UAIA 4KJOA 3T13A 1E2ZA 2AWNA 1EZ8A 2F03A 4OELB 5DM63 5C0XI 1VQJA 2XWBB 3GTJB 1O7IA 1EL0A 1WTXA 1HFGA 1T9HA 5C5MA 1A6XA 2F1MA 5C4XG 3RR5A 5M5YH 3Q6SA 4Q5VA 3L3OC 3KDFA 2PW7A 2NBFA 1HH2P 3HKZB 3NWTA 4HN7A 2YTVA 2UXBL 3M7GA 2IL8A 1KIXA 3S24A 1I6VC 1VQPA 2RDGA 3D4WA 3CCMA 1A2TA 2B63H 5KGUA 1SMYD 3OIPA 4PZ7A 4ZYSA 3PO3B 5COYA 1N36Q 1YITA 3HP3A 4N9PA 5C4ZA 1TWCH 5LMNQ 3CC7A 1VQ9A 5GAEC 3WWVA 5M5YB 1X32A 3URYA 1RKNA 3CKIB 2K5WA 4A3JB 3HOUB 2B2TC 5JPNC 3JAMc 1SN8A 3HOXG 3I4NH 1YJ9A 4B3SL 2VZAA 1EQRA 1X54A 1H95A 3KF6A 2Z8LA 3M7NA 5G3LD 4GNXC 1SJHD 3ICEA 1EIGA 5C44B 1K3BC 2RA4A 1CQVA 3E3XA 1FNUA 1YHAA 5FO7B 1EQVA 1X9NA 5IGDA 1SR3A 2WKDA 1O7LA 2KHJA 4IN3A 4DK0A 3QB3A 4A93B 2K04A 3PF4A 3T1YQ 3EJIA 1PHJA 1HTLD 2JN4A 4CHTB 5D3IB 1S3OA 1L0YB 2QF7A 1HR0Q 4O0AA 3QO2A 5ISRA 4YCUA 3C1EA 1WTWA 4HIMA 2RQXA 1VQAA 3GQBA 3IRBA 4R4TA 1QZGA 1HNZQ 1WCMH 2MUYA 1BDOA 1PRTB 1LT5D 4JI4L 2XSCA 4XT3B 3SDZA 4NB3A 4ME5A 5E1FA 5C5LA 3A5UA 4LFAL 3WOEA 1KDAA 2WAQE 1E0BA 4A3KH 5CV8A 4KKUA 1VQBA 2EOTA 4TVAB 4ZRZA 1BBXC 4OO1I 4OL7A 1NUCA 3HEJA 1LTRD 1YJNA 3D3RA 4YY3Q 4DV3Q 1XMQL 3E9IA 3S14H 3R93A 4CDFC 2LY7A 3BU2A 2RDFA 5C3EG 2VUMH 2O4XA 3OPOA 1BF4A 2KCTA 3LWUA 2NYZD 4QF4A 5EKIA 4LF4Q 1YI2A 3S1QB 2NVQB 2E5LQ 4IURA 3T51B 5LMUQ 4APVA 1VF7A 2HIVA 1R4QB 3A74A 2HCCA 4P72A 1M90C 2E5LL 3H3VC 3GTKB 4JI3L 3TP8A 4OO1G 1LM0A 3KYHC 1RD9D 4CBVA 1OXVA 2E2IH 2O2LD 3K0XA 4QGUA 1A3UA 5LHY1 1B7YB 3GTGB 2AQ2B 2MJ8A 4JI0Q 3S1NH 2B63B 1ASZA 3NSWA 1CQFA 1CTMA 3KLSA 3GDEA 1G2TA 1CZWA 5TSSA 4K5WA 3MFGA 3MZ5A 4L8JA 3RNUA 1JE5A 1ICFB 3CQZH 4PQXA 1KAWA 3K7AB 1CI3M 3L0OA 4IALA 1HA6A 3TRZA 4BXXG 2VQFL 4KMUC 4TQUS 2ZJRA 2RKSA 1QZHA 4JCVE 3I4LA 1WTRA 4DR6Q 1XNRQ 4DR7Q 3PUYA 4O42A 5CBAE 2KBNA 1BO0A 2VL6A 3M85A 3CCVA 1L0XB 2Z6KC 2WB1B 2J4XA 4KKTA 3E0EA 3V2TA 4DGZA 4KI0A 5J39A 3FRPB 5I2YA 1K0SA 2Z1CA 1EEFD 1BVSA 1LTBD 1K73C 1EY9A 3SK8A 4AH6A 3SHLA 1V1PA 3I72A 2KHIA 4O2DA 2VXWA 1ESFA 5CYUA 1B8AA 1BCPF 2B2VA 3I3CA 2F52A 4EQNA 5A2QL 2WV6D 2Q2HA 1CSQA 2C35B 5IGCA 3SE0A 3VDYA 2EPBA 4N8FA 4ZK9B 2MPMA
chains in the Genus database with same CATH topology
2NTSA 2JA8B 1BUVT 1LTID 5DAUA 3EVQA 2SEBD 3BDCA 5CR3A 3H91A 4EGVA 4IUPA 2OT2A 2TMPA 1C4QA 5C6AA 1G6ZA 2BDOA 5IT9L 1CHQD 2RSNA 1RODA 2BOSA 3J81L 4XQNA 2IJ0A 3K5LA 2K5DA 3HG9A 2FINB 5DNFA 2B2WA 1SAPA 1Q12A 3TDQA 2NN6G 5LL6S 2M2LA 4C3HG 3I8ZA 1TS3A 4ID6A 2RVLA 1SE3A 3NHHA 2XRQD 4K6DA 1HFNA 4FXKC 1JB3A 1I6HB 1CHPD 4UDUC 4X3UA 1NR4A 5NUCA 1F9SA 4OIJA 3HOWB 1FNWA 4BBRB 4FF2A 3EQLC 4FNFA 4PMWA 3MWYW 2C9OA 1PYWD 4L6TB 1K83B 1TS4A 4IZ8A 2QEJC 1JWUD 2B2UC 3VYUA 3BS1A 3K5NA 1SFOB 1WTPA 1IL8A 3K5OA 3BZDB 2EXZA 2L12A 4FVMA 5KYIA 3PIP3 5EJWA 2B8FA 2Y0SB 2BE5C 2FFKB 3TSSA 3AMUA 2ICEC 3P20A 1OXUA 1GXDC 1SYBA 1B3AA 3EFXD 4RGMA 1QOHA 3KUPA 1D6EC 5DEHA 1ENFA 5C3XA 4ODGA 3S1MB 4ZLTF 4C3IB 1I4RA 1SNQA 1O78A 2A69C 4KD4A 4BS9A 4DAYA 2K5QA 4MIUA 3QG1A 3Q23A 3N52A 1LLRD 4WORA 1AW7A 2IX1A 1TWCB 4KJNA 3MXGA 4A3GB 1KNAA 2EYMA 4DK1A 3T16A 1EY0A 4L63B 3CRKC 5D65A 2D9UA 2F0EA 2ID0A 1I3QB 2JA7B 5JEAH 5JPMC 1VDZA 2WAQB 2XVSA 3NQTA 2L11A 2OF1A 2ZXPA 1IHZA 3O13A 2AQ3B 3VA5A 1SNPA 4AYBB 2MGSA 4K14A 5D3DA 4XXEA 3S9WA 1Y8OB 2EZVA 5M3MB 1PRTD 3SVMA 1BOSA 3J80L 3NBIA 1X3PA 3I90A 4I7ZC 2JA6B 1RJTA 4DNTB 4K2KA 1STAA 4LAAA 5EQ0A 5IODA 5KNDA 3FDTA 3VR2A 2NB0A 3GTOB 4WRDA 1HQRD 4DU9A 2IX0A 3RMHA 2G9HD 4OHJA 1HHVA 1TWHB 3H6MA 4RA8A 4HSPA 3PIO3 2L55A 3VR4A 2E76C 4B9XA 2Q8RE 4C1NK 1B9MA 2RDHA 1Z7TA 2I46A 3VA7A 4CKBA 4FF4A 3W3AA 5BN4A 1J9OA 1EY8A 3KBGA 1ILQA 3FEWX 1V43A 3DXJC 2KUMA 2SDFA 4IUVA 2F3WA 3HOYB 2R7ZB 3V96A 1A3TA 3MAQA 4F87A 5IGFA 1ET6A 5FOBB 2FJ2A 1GUTA 3P7JA 4DNRB 4H13C 1STBA 1R9TB 4HTHA 3OHXC 1BCPB 1GUOA 2F0GA 1EWHA 2JA5B 3CHBD 1F2ZA 4IQZA 3D4DA 1IYVA 3A8IE 1HXYD 1JC7A 5A35A 3ERQA 5JJZA 1A15A 3DWQA 5IGBA 3S17B 4KN7C 1BQQT 5I6YA 1VMCA 2FMCA 5KYLA 1KNEA 2X6GA 4XIGS 4NDXA 3TBIB 3E6ZX 2HDMA 3QOLA 1EY5A 1MD2D 1CK1A 2F0DA 1B50A 1NAPA 1TIID 1S5CD 2A73B 4IFDG 5M5XB 3NWSA 1LABA 4IUNA 1SYFA 1PFMA 3TZDA 3HOXB 4CKCA 4G7OC 1BXTA 1WD1A 5EKLA 2PO4A 3K0YA 1QWYA 1WTOA 4G57A 3GTLB 3T53B 1PZKD 3D4RA 2KJXA 1LACA 4OO1H 3KBXA 2WACA 1ZYRD 2PNRC 5M9OA 2PCFB 5KIXA 1FGBD 2CW0D 1CA5A 5AFWA 5EBCA 2WINB 3BVGA 4FXGC 4ZUJA 1WVLA 1H9SA 1Y1VB 1D5MC 5E3FA 1DJRD 5K36H 1ET9A 5KEEA 5IGGA 4BBSB 1DONA 3BYTB 1KLUD 2NVYB 1STNA 4KY7A 5FLXL 1DYQA 2WP8J 2NZ1D 3NTIA 2F0HA 3S15B 2D2CC 2R93B 4ULLA 1EFID 3NE5B 3ZYYX 3PUZA 2O5JC 2ENBA 1DD2A 3R2TA 4GZYC 3D6CA 3TMEA 1H9RA 1U9RA 2CHBD 1HQMC 5I9PA 5EGTA 4IUUA 5IIFA 2A6EC 2A68D 3DEOA 2L1BA 3MA2B 3BVMA 2AUKA 2QKIC 1GUWA 1YNND 1GUGA 4A3FB 2LFNA 1ZKOA 2NTTA 2KCCA 4RAUC 1I4HA 1EY6A 1PZJD 3Q24A 3HZXA 4MHEA 3GTMB 1HCZA 5LL6X 1H9JA 3A54A 3VYSA 3T4AC 3SK4A 4E6IA 2EYHA 3MHBA 3VR3A 1DXMA 5CV6A 5CV7A 4DAPA 1U4MA 1U4RA 2EJGC 2F0TA 1B1ZA 1EY7A 1H9KA 1IYUA 1PZID 1WD0A 1Z6HA 2F0MA 4WFN3 2A5HA 2F0SA 1ONLA 2EYFA 3NK9A 3KK7A 5ELEA 1TWFB 4J1MA 2DY7A 2V4DA 5JOBA 1PFBA 4KHZA 2XNAC 3D31A 1M8AA 4C3IG 2KVMA 4O1NA 3OWEB 5CV5A 2IWHA 1QILA 3I70A 4XTCS 5CC4A 1KTKA 3RD4A 2K33A 2J7ZA 1RCVD 2LMCB 1TWGB 4RGTA 3AB9A 4N9TA 1TWAB 1A3VA 5J1ZA 1AEXA 2KOLA 4TSSA 1E2VA 4RWSC 3FVQA 1KDBA 1XYIA 2XWJB 2HUGA 4H44C 1SE4A 1S5DD 1BCPC 1QE6A 2XRSD 2DN8A 1ZXTA 3IFDA 1H9MA 1STHA 3ITPA 3GV6A 4M1UB 1KABA 1JWSD 1QB5D 5KNCA 4EQOA 3T56B 3I4NB 1EYCA 1F2MA 4R8NA 2JE6I 1JCKB 4C56C 2FHTA 1YNJC 2A6HC 3Q22A 2EY2A 1Q1EA 2SOBA 3U9OA 4K6LA 1PTOC 4H0LC 2RSOA 4HR7B 5C0XJ 2ICIA 2D62A 5KNBA 3CRLC 4R9WA 1JOOA 1T5EA 2MHVA 1F9RA 3R2IA 1PXUA 2NUCA 1XX8A 5A2QE 2QDBA 4ZUIA 3M4YA 5C4XB 4M8AA 3MEHA 1DZ1A 2DY8A 2B2TA 2KECA 2ZT9C 1LTTD 1TY2A 2EJMA 1B2TA 4BWGB 1GHKA 2R6GA 1FNVA 1W6JA 4IUTA 3NUCA 2NN6H 1HPCA 5ELBA 2NWGA 3PO2B 3ND8A 4MN3A 1F2YA 4ILWA 1QNUA 2PZUA 5ELFA 2VNUD 2SNSA 2B2WC 1NSNS 2GA4B 2E2DC 2EDGA 1STEA 4HMIA 4NMZA 1HRJA 1HA5A 2D5DA 4DF7A 2JP1A 4CJ2C 1JORA 1Q1BA 2X69A 3FPUB 3H94A 2KEEA 4PV1C 4Z9CB 3K59A 3JAML 2EJFC 2N88A 3LNNA 4J8QA 1PRTF 1C8CA 2E74C 5I4DA 3BDLA 2K03A 1Z47A 1K8MA 2B2YC 3M3YB 4KY6A 1EY4A 3NPPA 1OXTA 3I73A 2IT1A 3IFTA 3S14B 5IT9E 1S5FD 2KCNA 3IKJA 5HGTA 2AQ1B 4DXGA 1RHPA 1ESRA 1JQYD 3FKIB 3J7AF 3QJYA 5E4WC 4KV6A 3MTSA 1U4PA 1V1PB 1JWMD 3I91A 3PUXA 1F2LA 3NQIA 1RTNA 1NR2A 2VUMB 1VF5C 4C2MB 2ZXRA 1PTOF 5M5WB 1JICA 4RHRA 4TRDA 1G91A 5J22A 1D1KA 1EWCA 2M9VA 3RUZA 1MBYA 4U673 3MVVA 2SNMA 4KN4C 1SYGA 2O5IC 3TZUA 1Q8IA 5I6WA 3D8GA 1LT3D 2WKCA 3FPPA 4HCSA 1M4VA 2EY5A 1F9PA 4K5VA 2R61A 1B9NA 4V0BA 1GJXA 4OIKA 1EYAA 1EQTA 4KKSA 2LS01 1S4ZA 4FF1A 4ZAIA 5D14A 3LWEA 1SBBB 4A3IB 3PMFA 3K5MA 1ZEQX 1SSOA 1H9SB 4RHSA 3I4MB 3BG3A 3RZOB 1BNZA 5ELDA 3SEBA 5JVG3 4IFDH 2PZTA 3RLFA 5EPJA 3S1NB 3OMGA 4FYDA 1SMYC 3TP6A 1EU3A 2EYPA 4P2CB 2KEDA 3A7AB 4KY5A 3SXHA 1ENAA 1QG7A 1TY0A 3OIQA 1SDFA 4R8IA 3E5SA 3MXUA 1UUPA 2K01A 4JBWA 1JE4A 2TSSA 2XIWA 2B2UA 1TKWB 3PUVA 2JEAI 1MSGA 2K6AA 4IFDI 4BA2I 1KAAA 3EA6A 4QCLA 4BA1I 3VYTA 1GOZA 3OSOA 5F2DA 4HMJA 3G6JB 3DWAA 2B8GA 1B53A 2OEOA 3QWNA 1TR5A 1WTQA 1B44D 2N55A 3A8JE 2IX3A 3HOZB 1B4OA 4A3BB 1AP0A 1ILPA 1T5XD 1ML0D 5IGEA 3D6WA 1PDQA 2EE1A 2K1BA 2PMZB 3NP8A 3H0GB 2A74C 1UAPA 1EIHA 1R4PB 4XDXA 3L7ZC 3VR5A 4JK1C 2Q8IB 5I9OA 1U4LA 1AZQA 1I4XA 1G8ZD 3J80E 1SNDA 1JR0D 2EY6A 1E2WA 4G4KA 2LKVA 3X3NA 3UI2A 1GUSA 3NBHA 1HUNA 2KHSA 3DEPA 4F7XA 4RKBA 2F0OA 4KTAA 2E2JB 3E0JA 2C5CA 4X3KA 2RBMA 1SNOA 5K5PA 4RGNA 2X6LA 2K28A 2KA7A 2ZXOA 4J6HA 1LO5D 1TQOA 4C3JG 1BCPD 3WOFA 1TU2B 2Q8TA 3SK6A 1XTCD 5G3LF 4C3JB 5BN3A 3OW7A 2L4NA 1YNNC 3G7LA 5EPKA 4LJZC 5K36G 2Z4HA 2A6ED 4A3DB 1OXXK 4DAVA 2A68C 1I4GA 1STYA 3IAYA 1JOQA 1SJED 1XXGA 2EY1A 3TN2A 4HEDA 3C46A 3OMCA 3IL8A 1V8QA 2E2IB 2AWOA 5JEAJ 4K8JA 2PW5A 3ND9A 1V1OA 3H09A 4CGYB 3SR1A 5JEAG 1SYDA 4ABNA 4KK7A 3R3OA 2YYZA 4XYOA 3GP7A 1ENCA 2HCIA 1AFPA 1TT2A 3GTPB 3SK5A 4K8IA 1D2BA 1EZ6A 1D1IA 2F3VA 3MFYA 1G2SA 2F0UA 1O80A 1F9QA 4CJ1B 3QIAA 2EVBA 4FF3A 1II3A 1MGSA 4PMBA 2EYJA 1PTOD 2CW0C 5KRUA 1CM9A 2H1EA 4B9WA 1UEAB 2CQAA 1PRTC 1S5BD 2B2VC 5HURA 4NKLA 1DM0B 3U9SA 4KHVA 2M00A 2F0LA 1PTOB 3PUWA 1TVXA 1IW7C 1I50B 1CA6A 1TS5A 2BA0A 4K5XA 4F8MA 2IPKD 3MXPA 1PLFA 3DHQA 4CJ0B 4RH6A 5JVH3 1Y1WB 4LK1C 1S5ED 3J81E 2PZWA 3FMCA 4KD3A 3S2HB 1QNKA 3PV0A 2CVRA 1A2UA 1SNCA 4A3KB 5FLXE 3DMUA 2BA1A 1Y8NB 2L0CA 3C2PA 3K6OA 5C4HA 1QJOA 3N6RA 2A69D 2F0JA 1G291 4FXDA 1KLGD 1SE2A 4DA2A 4EQPA 1GHJA 2DNCA 1K8OA 1J8IA 1SYCA 3HOVB 1JOKA 4OGQC 1EU4A 2L5TA 1CT1D 1RTOA 2IW3A 3MXNA 3S1RB 4G7ZC 4EVOA 3LX0A 5EKKA 2OXPA 5CORA 1LT4D 3HRZC 2NVXB 2NVTB 2YU9B 4U68A 4NW2A 2HDLA 1ZYRC 1YNJD 3NTHA 5C4JB 3A8KE 3BVZA 2PQEA 3K57A 3C1FA 3MC0B 1AN8A 5EPLA 1FD7D 4PNYA 2F0QA 4WJWA 3BYYB 5C0XG 2DNEA 3Q0AA 5M3FB 3J7AV 1I4QA 5BN5A 2KQ3A 2QCPX 1EYDA 2F4IA 1RDPD 1VCIA 3EROA 4DN4M 3WDNA 5C3EB 5FKAC 2VB2X 5IOCA 2E75C 1DCZA 4YIJA 1Y69U 1EOTA 5CBEE 1C48A 1FYCA 1WTVA 3DM1A 1AZPA 1EEID 4CKEA 3DWPA 3TP5A 2EYOA 5CV4A 2EYLA 1DOLA 2F0IA 1ICWA 3KLRA 5FO9B 2J0TD 4DXFA 4C1NI 1NCVA 4RCNA 1RF2D 1Q3LA 3JAME 5FO8B 4H7BA 1D5ZC 1LTGD 1SEBD 4IUQA 3M4OB 5CMDA 4V190 2BDNA 3CQZB 4QMGA 4XT1B 4PMCA 4QUFA 1OO9B 5C0XH 3A56A 2K7VA 1SXTA 2NN6I 3GD7A 1TS2A 4BY7B 4I65A 1QCBD 4FO2A 1W6KA 1HTPA 3V05A 2BE5D 3A7LA 3AU7A 2A6HD 3OWFA 1BR9A 2MP1A 2WIIB 3VR6A 2PPBC 5FK9C 1LV9A 1IKLA 1FR3A 3OOCA 1IKMA 2R92B 2JSOA 1D5XC 2G9DA 2B39A 2JEBI 4ZQ3A 1GUNA 1F77A 4QIWB 5E4XA 4XQQA 3L9AX 4FP5D 5JAVA 4A3EB 1UNSA 3HS0C 1MI2A 3ONAB 1DOKA 2E2HB 2BCOA 1LTAD 3VYRA 5C3WA 3CU7A 2F0VA 2PYKA 4A3MB 4QB4A 4RCOA 1O7ZA 4ZKCB 3DUZA 1PMRA 2K05A 4Y7NB 3C3LA 2H4OA 2F0PA 1I4PA 5I2XA 1LT6D 4HAEA 1SNMA 3HGBA 3P1HA 3K58A 4HSVA 4NP5A 3TP7A 2AUJD 1STGA 2F0WA 4DFAA 1CZGA 3P75A 1WCMB 3S2DB 3S16B 3X3MA 3J7YW 4Q0FA 2I07B 2VB3X 5ELCA 1DOMA 5T1GA 2JXMB 4RGOS 1O7YA 2L9HA 3GTQB 4X3TA 5CGKA 4RFBA 2F0KA 1OXSC 3A55A 1LTSD 4IFDJ 2K32A 3GO5A 4XYQA 2R3ZA 2Z4IA 4ZKBB 1PTOH 4HCEA 3NXWA 3R8BA 3QOJA 1KDCA 3GV3A 4RKLA 2F0FA 4TKOB 4C3HB 1PFNA 4B08A 2JYOA 2XN9C 1SYEA 4QUCA 1VMPA 4S3SA 3KLSX 3NTKA 4F88A 2HQEA 2QILA 2F0NA 3RZDB 3KF8A 4K2LA 5T1IA 1HUMA 4G7HC 1MSHA 3BDOA 4X3SA 5DM73 5EBDA 4BY1B 1XWEA 1Y8PB 4LMQD 1IW7D 2B2YA 1X3QA 3W2DA 2FMMA 4XQJA 1CFMA 5CV9A 3F2UA 1Q90A 4UAIA 4KJOA 3T13A 1E2ZA 2AWNA 1EZ8A 2F03A 5DM63 5C0XI 2XWBB 3GTJB 1EL0A 1WTXA 1HFGA 5C5MA 1A6XA 2F1MA 3Q6SA 4Q5VA 3L3OC 2PW7A 2NBFA 3HKZB 3NWTA 4HN7A 3M7GA 2IL8A 1I6VC 2RDGA 3D4WA 1A2TA 5KGUA 1SMYD 3OIPA 4ZYSA 3PO3B 5COYA 3HP3A 4N9PA 5C4ZA 5M5YB 1X32A 3URYA 1RKNA 3CKIB 2K5WA 4A3JB 3HOUB 2B2TC 5JPNC 2Z8LA 3M7NA 5G3LD 1SJHD 1EIGA 5C44B 2RA4A 1CQVA 1FNUA 5FO7B 1EQVA 5IGDA 2WKDA 1O7LA 4IN3A 4DK0A 3QB3A 4A93B 2K04A 3EJIA 1HTLD 4CHTB 5D3IB 1L0YB 2QF7A 3QO2A 5ISRA 3C1EA 1WTWA 2RQXA 3GQBA 2MUYA 1BDOA 1PRTB 1LT5D 2XSCA 4XT3B 3SDZA 4ME5A 5E1FA 5C5LA 3WOEA 1KDAA 1E0BA 5CV8A 4KKUA 2EOTA 1BBXC 4ZRZA 4OO1I 4OL7A 1NUCA 3HEJA 1LTRD 3D3RA 3R93A 2LY7A 2RDFA 2O4XA 3OPOA 1BF4A 3LWUA 2NYZD 4QF4A 5EKIA 3S1QB 2NVQB 4IURA 3T51B 1VF7A 1R4QB 2HCCA 3H3VC 3GTKB 3TP8A 4OO1G 1RD9D 4CBVA 1OXVA 2O2LD 1A3UA 5LHY1 3GTGB 2AQ2B 2MJ8A 2B63B 3NSWA 1CQFA 1CTMA 3KLSA 1G2TA 1CZWA 5TSSA 4K5WA 3MFGA 3MZ5A 4L8JA 4PQXA 3K7AB 1CI3M 4IALA 1HA6A 4KMUC 4TQUS 2RKSA 1WTRA 3I4LA 3PUYA 4O42A 5CBAE 1BO0A 3M85A 1L0XB 2WB1B 2J4XA 4KKTA 3V2TA 4DGZA 4KI0A 5J39A 3FRPB 5I2YA 2Z1CA 1EEFD 1LTBD 1EY9A 3SK8A 3SHLA 1V1PA 3I72A 2VXWA 1ESFA 5CYUA 1BCPF 2B2VA 3I3CA 4EQNA 5A2QL 2WV6D 5IGCA 3SE0A 2EPBA 4ZK9B 2MPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JE4 A;  1NCV A;  2B2W C;  2X6L A;  4HSV A;  1JIC A;  2FFK B;  2XIW A;  1G91 A;  2HUG A;  1KNE A;  1E0B A;  2B2U A;  2K28 A;  1CM9 A;  1Q3L A;  2X6G A;  4IUU A;  2H1E A;  3DEO A;  2L1B A;  1EL0 A;  2EOT A;  1MSG A;  1WTX A;  1BBX C;  1QE6 A;  1HFG A;  5COR A;  4IUQ A;  3H91 A;  1GUW A;  4IUP A;  1HHV A;  1B3A A;  2HDM A;  4RA8 A;  3KUP A;  3Q6S A;  5CMD A;  2B2V C;  1G6Z A;  3R93 A;  1ZXT A;  1DOM A;  3IFD A;  4U68 A;  5T1G A;  4NW2 A;  4ZLT F;  2BDN A;  2HDL A;  2RSN A;  4RAU C;  3GV6 A;  2Q8T A;  2Q8R E;  1BF4 A;  1ROD A;  1B50 A;  1HRJ A;  1NAP A;  1O7Y A;  2IL8 A;  2L9H A;  2NYZ D;  4XT1 B;  5EKI A;  1B53 A;  1WTQ A;  2JP1 A;  4CJ2 C;  2L4N A;  2N55 A;  3N52 A;  4IUR A;  2FIN B;  4X3T A;  2B2W A;  5DNF A;  2X69 A;  4QUF A;  3G7L A;  1SAP A;  3FPU B;  4MHE A;  5EPK A;  1B4O A;  1KNA A;  1PFM A;  5EPL A;  2HCC A;  2KEE A;  1J9O A;  3TZD A;  2R3Z A;  1TVX A;  1AP0 A;  4ZKB B;  1ILQ A;  2N88 A;  5COY A;  2FHT A;  1C8C A;  2M2L A;  1WD1 A;  1CA6 A;  1ILP A;  3HP3 A;  2KUM A;  1ML0 D;  2SDF A;  1WTO A;  2K03 A;  4HCS A;  3D6W A;  1PDQ A;  3I8Z A;  2EE1 A;  2K1B A;  4IUV A;  1F9P A;  5D65 A;  1PLF A;  1X32 A;  2RVL A;  3GV3 A;  4CJ0 B;  2MP1 A;  4OIK A;  2D9U A;  1EQT A;  2RSO A;  1U4M A;  1PFN A;  2B2T C;  1U4R A;  2MJ8 A;  1HFN A;  3TN2 A;  3KBX A;  2B2Y C;  4HED A;  1S4Z A;  1LV9 A;  3IL8 A;  2JYO A;  4ZAI A;  5D14 A;  2FJ2 A;  1IKL A;  4QUC A;  3LWE A;  1WD0 A;  3P7J A;  1G2T A;  4R9W A;  4X3U A;  1VMP A;  1EIH A;  1NR4 A;  1F9R A;  4XDX A;  2L11 A;  1IKM A;  1QNK A;  1CA5 A;  4DN4 M;  2CVR A;  1XX8 A;  1EIG A;  2DY7 A;  1F9S A;  5AFW A;  4OIJ A;  1HA6 A;  2RA4 A;  2MGS A;  5T1I A;  1HUM A;  1SSO A;  1U4L A;  5E4X A;  1MSH A;  4X3S A;  1PFB A;  1WVL A;  1XYI A;  1WTR A;  1AZQ A;  1DZ1 A;  4O42 A;  5CBA E;  3SVM A;  2DY8 A;  2B2T A;  1BO0 A;  1M8A A;  2KEC A;  1EOT A;  3MWY W;  4LMQ D;  2B2Y A;  1MI2 A;  5CBE E;  1BNZ A;  2HCI A;  1RHP A;  1X3P A;  3ONA B;  2KVM A;  1DOK A;  1ESR A;  1X3Q A;  3I90 A;  1B2T A;  2K04 A;  1WTV A;  3DM1 A;  5EPJ A;  1DON A;  3UI2 A;  2B2U C;  1AZP A;  2FMM A;  5E4W C;  4IUT A;  1RJT A;  3MTS A;  5JJZ A;  1U4P A;  1J8I A;  2J7Z A;  1HUN A;  1A15 A;  2KED A;  1IL8 A;  3DEP A;  1WTP A;  1O7Z A;  4ZKC B;  2NZ1 D;  1G2S A;  2VXW A;  3F2U A;  3I91 A;  3QO2 A;  2B2V A;  2K05 A;  3I3C A;  1O80 A;  1QG7 A;  2NWG A;  2L12 A;  1WTW A;  1DOL A;  1F2L A;  1ICW A;  4MN3 A;  1RTN A;  1SDF A;  1NR2 A;  4UAI A;  4X3K A;  5EQ0 A;  1F9Q A;  4CJ1 B;  1VMC A;  4R8I A;  4HAE A;  1RTO A;  2KOL A;  4XT3 B;  5EJW A;  2EPB A;  3FDT A;  2K01 A;  4RWS C;  1MGS A;  4ZK9 B;  2MPM A; 
#chains in the Genus database with same CATH topology
 2VQE L;  4HJ7 A;  2NTS A;  2JA8 B;  1BUV T;  1LTI D;  3Q8D A;  3KJP A;  4IO9 A;  3K7A H;  5DAU A;  3CPW A;  3EVQ A;  2SEB D;  3BDC A;  5CR3 A;  1TXY A;  3H91 A;  4EGV A;  4IUP A;  2OT2 A;  1PH3 A;  1V9P A;  2UUC Q;  2TMP A;  1C4Q A;  3KF6 B;  5C6A A;  4JW0 A;  1Y1V G;  1G6Z A;  2BDO A;  3CCQ A;  1HJP A;  1D8L A;  5IT9 L;  1CHQ D;  2RSN A;  4GKJ L;  1BKB A;  3U58 A;  1ROD A;  2BOS A;  1PVO A;  3J81 L;  4XQN A;  2IJ0 A;  3K5L A;  1N36 L;  2K5D A;  4PZ6 A;  3HG9 A;  2FIN B;  5DNF A;  2B2W A;  1SAP A;  4EQ5 A;  1Q12 A;  4GKJ Q;  1X56 A;  3TDQ A;  2NN6 G;  4AQY Q;  5LL6 S;  2M2L A;  3A5Z B;  4C3H G;  3I8Z A;  1TS3 A;  4X6A H;  2CWP A;  4ID6 A;  2RVL A;  1SE3 A;  1Z9F A;  3NHH A;  4LUO A;  1XMO L;  3HOX H;  4X64 Q;  2XRQ D;  4K6D A;  3K80 C;  1HFN A;  4FXK C;  1JB3 A;  1I6H B;  1CHP D;  4UDU C;  4X3U A;  3PSI A;  1MIU A;  4HIO A;  2CQO A;  1CSP A;  1NR4 A;  4R4Q A;  1DGS A;  5NUC A;  4BY1 G;  1F9S A;  4OIJ A;  3HOW B;  1FNW A;  1TWF H;  4BBR B;  5GAH C;  4FF2 A;  5E7N A;  1QVF A;  3EQL C;  4N8X 1;  4FNF A;  3ULP A;  4PMW A;  3HOW G;  2LXK A;  3MWY W;  1GKH A;  5FJ8 G;  2C9O A;  1PYW D;  4L6T B;  1K83 B;  1TS4 A;  1NBW A;  4IZ8 A;  1NE3 A;  2QEJ C;  1JWU D;  2B2U C;  3VYU A;  3BS1 A;  3K5N A;  1SFO B;  3GTK H;  4DUZ L;  5M3M H;  1WTP A;  1IL8 A;  3I2Z A;  3G71 A;  3K5O A;  1XNQ Q;  3BZD B;  1YNX A;  2EXZ A;  2L12 A;  3M4P A;  4FVM A;  2ES2 A;  5KYI A;  3PIP 3;  5EJW A;  2B8F A;  2Y0S B;  2BE5 C;  2FFK B;  3TSS A;  1IYJ B;  3J80 i;  1N34 Q;  3S16 H;  3CXC A;  3PQI A;  2ICE C;  3P20 A;  1OXU A;  3AMU A;  2PMZ E;  1GXD C;  2D0P A;  1SYB A;  4YWK A;  1B3A A;  1IBK Q;  3EFX D;  4RGM A;  1QOH A;  3KUP A;  1D6E C;  5DEH A;  1ENF A;  5C3X A;  2CKZ B;  4ODG A;  3S1M B;  4ZLT F;  3M3Y H;  3KDF B;  4C3I B;  1I4R A;  1SNQ A;  4CDC C;  1O78 A;  2A69 C;  3QR8 A;  4KD4 A;  4BS9 A;  1E22 A;  5IT9 c;  4DAY A;  4A3J H;  5IE8 A;  2UUC L;  4A75 A;  2K5Q A;  4MIU A;  3QG1 A;  3Q23 A;  3N52 A;  1LLR D;  4WOR A;  1AW7 A;  5IWA L;  1TWC B;  5IYC G;  2IX1 A;  2KEN A;  4KJN A;  3MXG A;  4A3M H;  4A3G B;  1KNA A;  2K5H A;  1HR0 L;  1WYD A;  2EYM A;  4P75 A;  4JV5 L;  4NXM L;  4DK1 A;  3T16 A;  1EY0 A;  1EUJ A;  1RIP A;  4L63 B;  3ERS X;  3CRK C;  2QEX A;  5D65 A;  4DR7 L;  1PH4 A;  2D9U A;  5GAG C;  3S2H H;  4R1J A;  4A3C G;  2F0E A;  2ID0 A;  1I3Q B;  2JA7 B;  5JEA H;  5JPM C;  1VDZ A;  4DAY B;  3NEN A;  2WAQ B;  2XVS A;  3NQT A;  4DR1 Q;  4X64 L;  4OON A;  1VQN A;  2WFW A;  2L11 A;  1Y14 B;  4LFB Q;  2OF1 A;  2ZXP A;  1IHZ A;  3O13 A;  2AQ3 B;  4QY7 A;  3VA5 A;  1SNP A;  3OTO Q;  4AYB B;  2MGS A;  4K14 A;  5D3D A;  4XXE A;  2WB1 E;  4ME3 A;  1PYS B;  1KHI A;  1Y8O B;  4GN3 B;  3S9W A;  2EZV A;  5M3M B;  4JYA Q;  1PRT D;  4AYB G;  3SVM A;  1BOS A;  3J80 L;  3NBI A;  1X3P A;  4LF8 L;  3I90 A;  2A19 A;  5ELN A;  3J7Z C;  4PG3 A;  3K7U C;  3NEM A;  5M3F H;  4LF8 Q;  4I7Z C;  2JA6 B;  1RJT A;  4LF6 L;  4DNT B;  1J6Q A;  1YZ6 A;  3AFP A;  1PH7 A;  4DV2 L;  4K2K A;  4CDE C;  4B3R L;  2JJQ A;  4UP8 A;  1STA A;  1L1O C;  2NZH A;  4LAA A;  5EQ0 A;  5IOD A;  2Q2U A;  2HQL A;  4JI5 L;  1WI5 A;  1K0R A;  5KND A;  3FDT A;  3VR2 A;  2NB0 A;  5M5X H;  3GTO B;  4WRD A;  1HQR D;  4NPS A;  4OWW B;  4DU9 A;  3RZD H;  4HJ5 A;  2IX0 A;  4DR1 L;  3RMH A;  2G9H D;  4OHJ A;  1HHV A;  1TWH B;  3H6M A;  4RA8 A;  3K81 C;  4DR2 Q;  1KQS A;  4HSP A;  3PIO 3;  1EOV A;  2PI2 E;  3U4V A;  2L55 A;  3VR4 A;  2E76 C;  4B9X A;  2Q8R E;  4C1N K;  1B9M A;  2RDH A;  1Z7T A;  2I46 A;  3STB D;  3VA7 A;  4JI7 Q;  4CKB A;  4NXN Q;  4FF4 A;  3W3A A;  5BN4 A;  1J9O A;  4B3T L;  1EY8 A;  4JC0 A;  2UUB L;  3KBG A;  1ILQ A;  3FEW X;  1V43 A;  3DXJ C;  2KUM A;  4DV0 Q;  2SDF A;  4IUV A;  2F3W A;  1IBM Q;  3HOY B;  2R7Z B;  3V96 A;  3H3V I;  2MNA A;  1A3T A;  3MAQ A;  4F87 A;  5IGF A;  1HR0 W;  1ET6 A;  5FOB B;  2JA9 A;  2FJ2 A;  1GUT A;  3P7J A;  4X65 L;  4DNR B;  1IBM L;  3T1Y L;  4LWC A;  4H13 C;  1STB A;  4GKK L;  5AJ3 Q;  1R9T B;  1Y1W G;  4GLA C;  4HJ8 A;  4K0K Q;  4HTH A;  2I0Q A;  3OHX C;  1BCP B;  1GUO A;  2F0G A;  4MTK A;  1EWH A;  2JA5 B;  3CHB D;  1F2Z A;  4A3I G;  3HOV G;  4IQZ A;  3TS2 A;  3AEV A;  3D4D A;  1IYV A;  3A8I E;  1HXY D;  1JC7 A;  5IYC H;  5A35 A;  3ERQ A;  5JJZ A;  4J15 A;  4HJ9 A;  2E2J H;  1A15 A;  4DV3 L;  3DWQ A;  5IGB A;  3S17 B;  2E2H H;  2GVB A;  4JI3 Q;  2YU9 H;  1EFW A;  2NVT H;  4KN7 C;  1MHW C;  2PQA B;  5LMU L;  1BQQ T;  5I6Y A;  3TS0 A;  1VMC A;  3CD6 A;  2FMC A;  4B3R Q;  1VQE A;  4A3C H;  5KYL A;  1KNE A;  4DUY L;  2X6G A;  4XIG S;  1YHB A;  2Z9H A;  4NDX A;  3TBI B;  3E6Z X;  5IP7 G;  2HDM A;  4LF9 Q;  2MFI A;  3QOL A;  1EY5 A;  3HFZ B;  1MD2 D;  5C44 G;  1CK1 A;  5ELO A;  1QUQ B;  4HID A;  2F0D A;  1B50 A;  1NAP A;  1TII D;  4JI8 L;  2DJF C;  3M4Q A;  1S5C D;  2A73 B;  4IFD G;  3HOV H;  5M5X B;  3NWS A;  1LAB A;  4IUN A;  1SYF A;  4GLV B;  1W3S A;  3F1Z A;  1NMF A;  1PFM A;  3TZD A;  1C9O A;  3HOX B;  4CKC A;  4G7O C;  1BXT A;  1HNX L;  1WD1 A;  4GN4 B;  2PO4 A;  5EKL A;  1U0L A;  3K0Y A;  1QWY A;  1WTO A;  4G57 A;  3GTL B;  3T53 B;  1PZK D;  3D4R A;  1N33 Q;  2KJX A;  1LAC A;  1EIF A;  1GD7 A;  3KBX A;  4OO1 H;  2WAC A;  1ZYR D;  4MNO A;  2PNR C;  5M9O A;  2PCF B;  5KIX A;  1FGB D;  2CW0 D;  2VQE Q;  1E1O A;  1CA5 A;  2EIF A;  4JI2 L;  5AFW A;  4DR5 Q;  1AE2 A;  5EBC A;  3G48 A;  2WIN B;  3BVG A;  4FXG C;  4ZUJ A;  1WVL A;  1H9S A;  1Q86 C;  1Y1V B;  1D5M C;  1AH9 A;  3MXN B;  5E3F A;  1DJR D;  1SFO H;  5K36 H;  2JA8 H;  2R7Z H;  1ET9 A;  5KEE A;  5IGG A;  4BBS B;  1DON A;  3BYT B;  1KLU D;  2AKW B;  5JJI A;  2NVY B;  1STN A;  1C0A A;  4KY7 A;  5FLX L;  1DYQ A;  3W1G A;  2WP8 J;  1X3G A;  4DR4 Q;  3KF8 B;  2NZ1 D;  3NTI A;  1G6P A;  5M3F G;  2F0H A;  3S15 B;  2D2C C;  3H0G G;  2R93 B;  4ULL A;  1EFI D;  3NE5 B;  3ZYY X;  3PIP A;  3PUZ A;  2O5J C;  2ENB A;  1DD2 A;  3R2T A;  4GZY C;  3D6C A;  3TME A;  1H9R A;  1U9R A;  2CHB D;  2BH8 A;  1HQM C;  5I9P A;  5EGT A;  1VQF A;  4IUU A;  5IIF A;  1WOC A;  2A6E C;  3NBH B;  2A68 D;  3DEO A;  2L1B A;  3MA2 B;  3BVM A;  2AUK A;  2QKI C;  1GUW A;  1YNN D;  1GUG A;  4A3F B;  2LFN A;  1ZKO A;  2DUD A;  1FGU A;  2NTT A;  3KOJ A;  2KCC A;  4RAU C;  1I4H A;  4WJ3 M;  4KHP L;  1EY6 A;  1PZJ D;  3Q24 A;  3HZX A;  1EQQ A;  4MHE A;  3GTM B;  1HCZ A;  5LL6 X;  1H9J A;  3A54 A;  3VYS A;  3T4A C;  3AFQ A;  2DGY A;  1KRT A;  3SK4 A;  2EYH A;  4E6I A;  2GVA A;  2ATW A;  5HY6 A;  4DV7 Q;  3MHB A;  2K75 A;  3VR3 A;  1DXM A;  2RHS B;  5CV6 A;  1WJJ A;  3FP9 A;  5CV7 A;  4DAP A;  1PH2 A;  1U4M A;  4DV6 L;  3ULL A;  1U4R A;  2EJG C;  4R4O A;  4POG A;  2F0T A;  4A3G H;  1B1Z A;  1EY7 A;  1H9K A;  4JI5 Q;  4L5S A;  1IYU A;  1PZI D;  2ZM6 Q;  1WD0 A;  1Z6H A;  2DJG C;  2F0M A;  1EWI A;  4WFN 3;  4DV1 Q;  2A5H A;  2F0S A;  1ONL A;  2OQ0 A;  2EYF A;  2UU9 Q;  3NK9 A;  4JI7 L;  3KK7 A;  2WB1 G;  5ELE A;  3S1M H;  1TWF B;  4J1M A;  2DY7 A;  2V4D A;  5JOB A;  4DPG A;  4GNX B;  2UU9 L;  2ZTD A;  1R9T H;  1PFB A;  2K4K A;  4UY8 C;  1GM5 A;  4KHZ A;  2XNA C;  3D31 A;  2EXD A;  1VQI A;  1K8G A;  1M8A A;  1PH5 A;  4C3I G;  2KVM A;  4O1N A;  3OWE B;  5CV5 A;  4AQY L;  2IWH A;  1QIL A;  3I70 A;  1Q7Y C;  4BY7 G;  4XTC S;  5CC4 A;  1KTK A;  3RD4 A;  3RZO H;  2K33 A;  1N32 Q;  2J7Z A;  4IPC A;  4DV7 L;  1RCV D;  3JAM i;  2LMC B;  4YWM A;  5DLQ E;  1TWG B;  4RGT A;  3AB9 A;  4JI6 Q;  4N9T A;  1TWA B;  1A3V A;  4BXX H;  4GN5 A;  5J1Z A;  5IP9 H;  1AEX A;  2KOL A;  2V1C C;  4TSS A;  1E2V A;  4RWS C;  3FVQ A;  1PH6 A;  1KDB A;  1XYI A;  2XWJ B;  2HUG A;  3HKS A;  4H44 C;  3CF5 A;  1SE4 A;  1S5D D;  2NVY H;  4DV4 Q;  5GRO A;  1BCP C;  4LFA Q;  1QE6 A;  2XRS D;  5LMN L;  2DN8 A;  1VQM A;  5GQO A;  3TRE A;  5JJK A;  1ZXT A;  3IFD A;  1H9M A;  1STH A;  3ITP A;  1M1K C;  4A3L G;  3GV6 A;  4M1U B;  1KAB A;  4JOI A;  1JWS D;  1QB5 D;  1UE5 A;  5KNC A;  4EQO A;  3T56 B;  4A3F H;  3I4N B;  1K83 H;  1EYC A;  1F2M A;  3FKI H;  4QIW E;  2NZO A;  4EX5 A;  3F2D A;  4R8N A;  2JE6 I;  1JCK B;  4C56 C;  2FHT A;  1YNJ C;  4JPB W;  3HOY G;  2A6H C;  3Q22 A;  1N34 L;  2EY2 A;  1Q1E A;  2SOB A;  1QVC A;  3U9O A;  1EYG A;  4K6L A;  1PTO C;  4H0L C;  2B3G A;  2RSO A;  2JA5 H;  4HR7 B;  5C0X J;  2ICI A;  2RCN A;  2D62 A;  5KNB A;  3CRL C;  1K9M C;  4R9W A;  1JOO A;  1T5E A;  2JA6 H;  1TWH H;  2MHV A;  1F9R A;  3R2I A;  4GLX A;  1PXU A;  3H0G H;  3CME A;  3GTP H;  2NUC A;  1XX8 A;  5A2Q E;  2QDB A;  4ZUI A;  4JI6 L;  3M4Y A;  5C4X B;  2OTL A;  4M8A A;  3CCE A;  3MEH A;  1DZ1 A;  4DAM A;  2DY8 A;  2B2T A;  2KEC A;  2ZT9 C;  1LTT D;  4ZCK A;  1B3Q A;  1TY2 A;  3UDI A;  2EJM A;  1B2T A;  4BWG B;  2NVX H;  2R6G A;  1UEB A;  4DV4 L;  3ZJY C;  3F2C A;  1GHK A;  1FNV A;  1W6J A;  4JG2 A;  1N8R C;  4YY3 L;  1XMQ Q;  4NXN L;  4IUT A;  2Y0S G;  3NUC A;  4L5T A;  1FVI A;  1HPC A;  2NN6 H;  3CCU A;  1N9W A;  5ELB A;  2NWG A;  3PO2 B;  3ND8 A;  4MN3 A;  1F2Y A;  4ILW A;  3W1B A;  1QNU A;  2PZU A;  5ELF A;  4OX9 Q;  2SNS A;  2VNU D;  3RLO A;  2NVQ H;  3S1Q H;  2B2W C;  2Z6B A;  1LTL A;  1NSN S;  2GA4 B;  1IXR A;  2E2D C;  2B63 G;  2EDG A;  1STE A;  2PI2 A;  1VQ5 A;  2VW9 A;  3CCS A;  2OQK A;  4HMI A;  3BJU A;  4A3E G;  5IWA Q;  1E3P A;  4DKA C;  2FXQ A;  5IYB G;  4NMZ A;  1HRJ A;  1BBW A;  1HA5 A;  2D5D A;  5IP7 H;  3SGI A;  4DF7 A;  2JP1 A;  4CJ2 C;  1JOR A;  4JI4 Q;  1Q1B A;  2X69 A;  3FPU B;  3H94 A;  2KEE A;  4PV1 C;  4Z9C B;  2JQO A;  3K59 A;  4IOA A;  2EJF C;  3JAM L;  2N88 A;  3LNN A;  4J8Q A;  1PRT F;  1C8C A;  2E74 C;  5I4D A;  3BDL A;  4JI0 L;  1MJE A;  2K03 A;  1VQ8 A;  2UXC Q;  2G5D A;  4LF7 L;  4WJ4 A;  1Z47 A;  1MJC A;  1K8M A;  2B2Y C;  3I4M H;  3M3Y B;  1JT8 A;  1XPR A;  4KY6 A;  1EY4 A;  4MZ9 A;  3NPP A;  1OXT A;  1HNW Q;  2N49 A;  3I73 A;  1XTD A;  4B3S Q;  4A93 G;  2IT1 A;  2HHH L;  1X3F A;  3IFT A;  3S14 B;  5IT9 E;  1S5F D;  2KCN A;  3IKJ A;  5HGT A;  4LF5 Q;  2AQ1 B;  4KLK A;  4DXG A;  4LF4 L;  1RHP A;  3I7F A;  4R4I A;  1ESR A;  1JQY D;  3FKI B;  3J7A F;  3QJY A;  1L1O B;  5E4W C;  1PV4 A;  2F3I A;  4KV6 A;  3FKI G;  2ZM6 L;  3KLW A;  1NNX A;  3K8A A;  3MTS A;  1U4P A;  3CC4 A;  1V1P B;  1JWM D;  3I91 A;  4QL5 A;  3PUX A;  3G6E A;  1F2L A;  3NQI A;  1RTN A;  1NR2 A;  1CKN A;  2VUM B;  2OWO A;  1VF5 C;  1JJC B;  2ZXR A;  4C2M B;  1SLJ A;  4MTN A;  1HNZ L;  1PTO F;  4JV5 Q;  1SE8 A;  2Z6K A;  5M5W B;  4GOP C;  3BZC A;  1JIC A;  4RHR A;  4TRD A;  1G91 A;  5J22 A;  1D1K A;  3L2P A;  1EWC A;  4OX9 L;  1TWA H;  2CH4 A;  4JI1 Q;  1NTG A;  2M9V A;  3RUZ A;  1MBY A;  4U67 3;  4A3L H;  3MVV A;  4LNQ A;  1XNR L;  2SNM A;  5GAD C;  4KN4 C;  2CCZ A;  1SYG A;  2O5I C;  2K14 A;  1IBK L;  1G51 A;  3TZU A;  1Q8I A;  1OTC A;  1UWV A;  4DV5 L;  5I6W A;  3D8G A;  1LT3 D;  4IPH A;  2WKC A;  2I5H A;  4DR5 L;  3FPP A;  3J7A 5;  3I56 A;  1WTH A;  4HCS A;  1M4V A;  1X55 A;  3A0J A;  2EY5 A;  1F9P A;  4K5V A;  2R61 A;  1B9N A;  4V0B A;  3PO3 H;  1GJX A;  4OIK A;  1EYA A;  1EQT A;  4KKS A;  2LS0 1;  1S4Z A;  4FF1 A;  4ZAI A;  5D14 A;  5L37 A;  3LWE A;  1XPO A;  2ALY B;  2ZTE A;  1SBB B;  4A3I B;  3PMF A;  4A3D H;  3HOU H;  3K5M A;  4NXM Q;  1ASY A;  4P74 A;  1ZEQ X;  1A63 A;  2IY5 B;  1SSO A;  4LFB L;  1H9S B;  4RHS A;  1IBL Q;  3I4M B;  3BG3 A;  4X62 Q;  2P5Z X;  1VQ4 A;  3RZO B;  2B29 A;  1E7Z A;  1BNZ A;  5ELD A;  3SEB A;  5JVG 3;  4IFD H;  2PZT A;  3RLF A;  3EBE A;  4LUZ A;  2PQA A;  2Q2T A;  5EPJ A;  3S1N B;  3OMG A;  1MKH A;  4FYD A;  1SMY C;  3TP6 A;  1EU3 A;  2EYP A;  2VS1 A;  4P2C B;  4I7A A;  2KED A;  3LGJ A;  3A7A B;  4YWL A;  4KY5 A;  3SXH A;  5IYB H;  4A3J G;  1ENA A;  1QG7 A;  1XMO Q;  1TY0 A;  3OIQ A;  2OCE A;  1HZ9 A;  1SDF A;  2F4V L;  1J5E L;  4R8I A;  3E5S A;  1W2B A;  3MXU A;  1UUP A;  3GTJ H;  2K01 A;  4JBW A;  1JE4 A;  4DV6 Q;  1KL9 A;  5EAY A;  2TSS A;  2XIW A;  2B2U A;  1TKW B;  3PUV A;  1S40 A;  2WAQ G;  1MSG A;  4OXP A;  2JEA I;  2K6A A;  4IFD I;  4BA2 I;  4K0K L;  1KAA A;  2GN5 A;  3EA6 A;  4QCL A;  4BA1 I;  1P16 A;  1SMX A;  3VYT A;  1GOZ A;  1YBY A;  3OSO A;  5F2D A;  4HMJ A;  1XNQ L;  2K52 A;  4BBR G;  3G6J B;  3DWA A;  3UE0 A;  2B8G A;  1B53 A;  4PZ8 A;  2OEO A;  1FL0 A;  3QWN A;  1TR5 A;  1WTQ A;  1B44 D;  1WCM G;  2N55 A;  3A8J E;  2IX3 A;  3HOZ B;  5IYD H;  1B4O A;  4A3B B;  2CH4 W;  2QW7 A;  4DR4 L;  3PCO B;  3TEH B;  3HOZ G;  1AP0 A;  1ILP A;  1T5X D;  1ML0 D;  4LFC L;  5IGE A;  1JB7 A;  3D6W A;  1PDQ A;  4JI1 L;  2H5X A;  2EE1 A;  2K1B A;  2E8G A;  2PMZ B;  3RN2 A;  5LMN W;  3NP8 A;  1YIJ A;  1VQH A;  1X3E A;  1VQ6 A;  3CW2 C;  3H0G B;  2R93 G;  3HOY H;  1Q46 A;  2A74 C;  5FJ8 H;  4BY1 H;  4DV0 L;  1Q81 C;  1UAP A;  1VQK A;  4DUY Q;  1EIH A;  1R4P B;  4ALP A;  4QQB X;  4XDX A;  3L7Z C;  3VR5 A;  2R7F A;  4A3B H;  2BH2 A;  4BBS G;  3D0F A;  4JK1 C;  4Y52 H;  2Q8I B;  5I9O A;  4A93 H;  1U4L A;  4UHV A;  1AZQ A;  1I4X A;  2Q2I A;  1G8Z D;  3J80 E;  2A8V A;  1SND A;  1JR0 D;  1E1T A;  2EY6 A;  3ULJ A;  1LUZ A;  1E2W A;  4R4C A;  4G4K A;  4B3M L;  2I5L X;  2LKV A;  3X3N A;  4DK6 C;  3UI2 A;  4DNI A;  1S72 A;  3I4N G;  4JBJ A;  1GUS A;  3NBH A;  1CKM A;  4UP7 A;  1HUN A;  2KHS A;  4GNX A;  3DEP A;  4F7X A;  4RKB A;  3F8T A;  2F0O A;  4KTA A;  2E2J B;  3E0J A;  2C5C A;  4BY7 H;  4X3K A;  1I94 Q;  2RBM A;  3EIV A;  1SNO A;  2ZJQ A;  2MO1 A;  5K5P A;  4JYA L;  1I94 L;  4RGN A;  2X6L A;  2CFM A;  2R92 G;  2K28 A;  2KA7 A;  4YCV A;  1CUK A;  2ZXO A;  4KHP Q;  2RHQ B;  1TWG H;  1PH1 A;  4J6H A;  4Y7N H;  1LO5 D;  1TQO A;  4C3J G;  1BCP D;  3M9B A;  3WOF A;  3T1H L;  1TU2 B;  3RN5 A;  4DV5 Q;  2Q8T A;  3SK6 A;  1XTC D;  2QA4 A;  5G3L F;  4C3J B;  5BN3 A;  4A3D G;  3OW7 A;  2L4N A;  1YNN C;  3G7L A;  5EPK A;  4LJZ C;  3UDG A;  5K36 G;  2L15 A;  2Z4H A;  2A6E D;  1Y1W H;  4A3D B;  1OXX K;  4LW1 A;  4DAV A;  3HKZ G;  1HZA A;  1D7Q A;  2A68 C;  2YV5 A;  1I4G A;  4LF9 L;  1XPU A;  1STY A;  2A1A A;  3IAY A;  1JOQ A;  1SJE D;  4IOC A;  1IZ6 A;  1IBL L;  1XXG A;  5BR8 Q;  2ZTC A;  2EY1 A;  3TN2 A;  4HED A;  1K8A C;  3C46 A;  1NJI C;  3OMC A;  3IL8 A;  3PO3 G;  1V8Q A;  2E2I B;  2AWO A;  2KCM A;  4X66 L;  4GS3 A;  5JEA J;  4K8J A;  2PW5 A;  5H1S E;  4DR6 L;  1V1Q A;  3ND9 A;  4JVZ A;  1V1O A;  1CKN B;  3H09 A;  4CGY B;  2VQF Q;  3SR1 A;  5C4X H;  5JEA G;  3PGZ A;  5C3E H;  3HOU G;  1SYD A;  4ABN A;  4KK7 A;  2JA7 G;  2MQH A;  1A8V A;  2UUA Q;  1PYB A;  1SRU A;  4C3J H;  2Y0S E;  2AHO B;  3R3O A;  1X65 A;  2JA6 G;  2YYZ A;  2HT1 A;  4XYO A;  1JJ2 A;  3GP7 A;  4JI2 Q;  4LF6 Q;  1ENC A;  2HCI A;  1AFP A;  2IHE A;  3AQQ A;  1TT2 A;  4A3G G;  3GTP B;  3SK5 A;  4LUV A;  4K8I A;  1D2B A;  1EZ6 A;  3UE1 A;  1D1I A;  2F3V A;  5M5W H;  3MFY A;  3GTM H;  1G2S A;  2VUM G;  2F0U A;  4IPD A;  1O80 A;  1VQO A;  3E9H A;  2UXC L;  1F9Q A;  4CJ1 B;  3CMA A;  3QIA A;  2EVB A;  4FF3 A;  1II3 A;  1K28 A;  1MGS A;  4PMB A;  4DV1 L;  3PIO A;  2ASB A;  2EYJ A;  1PTO D;  2CW0 C;  5KRU A;  1CM9 A;  2H1E A;  4B9W A;  1VQC A;  1X6O A;  1UEA B;  2CQA A;  1PRT C;  1S5B D;  3NEL A;  5J3B A;  2B2V C;  1KRS A;  2N3S A;  5M3M G;  5BR8 L;  5HUR A;  3PF5 A;  4NKL A;  1DM0 B;  2QGQ A;  2LXJ A;  3U9S A;  4P73 A;  3HOZ H;  4KHV A;  2M00 A;  2F0L A;  1PTO B;  3PUW A;  4QJF A;  1TVX A;  1IW7 C;  1I50 B;  1CA6 A;  1TS5 A;  2BA0 A;  2XTI A;  4UP9 A;  4K5X A;  4A76 A;  4F8M A;  2IPK D;  1A0I A;  3MXP A;  1PLF A;  1Q8K A;  3DHQ A;  4CJ0 B;  4RH6 A;  5JVH 3;  1Y1W B;  3PO2 G;  1Y1V H;  4LK1 C;  3STB C;  1S5E D;  3J81 E;  1L2F A;  1N32 L;  2PZW A;  2K50 A;  4A3K G;  3KJO A;  3FMC A;  4KD3 A;  2YTY A;  3U4Z A;  1VQL A;  3EN2 A;  3S2H B;  1LYL A;  1QNK A;  3PV0 A;  2CVR A;  1A2U A;  1SNC A;  3I4M G;  4A3K B;  3FHW A;  3DMU A;  5FLX E;  2BA1 A;  5IP9 G;  1Y8N B;  1JJG A;  2L0C A;  3C2P A;  4IPG A;  2EQS A;  3K6O A;  5C4H A;  1L1O A;  1QJO A;  4C3H H;  5FLX c;  4RG1 A;  5AJ3 L;  3N6R A;  2A69 D;  2F0J A;  1PH8 A;  1G29 1;  1B70 B;  3J80 c;  4FXD A;  1KLG D;  1SE2 A;  4DA2 A;  4EQP A;  4LFC Q;  1GHJ A;  2DNC A;  1K8O A;  2OTJ A;  1J8I A;  1SYC A;  3HOV B;  1VQD A;  1JOK A;  4OGQ C;  1I50 H;  1EU4 A;  2L5T A;  1CT1 D;  3CC2 A;  3UDX A;  3PO2 H;  4A3I H;  1RTO A;  2IW3 A;  3MXN A;  1UE6 A;  3S1R B;  4G7Z C;  1NY4 A;  4EVO A;  2CWA A;  5C44 H;  3LX0 A;  5EKK A;  2OXP A;  3DLL A;  1NMG A;  3S2D H;  2I5M X;  3J81 c;  2R92 H;  2UXD L;  5COR A;  1LT4 D;  3HRZ C;  2NVX B;  2NVT B;  2RCF A;  3HOW H;  2YU9 B;  4RMF A;  3M4O H;  4U68 A;  4NW2 A;  2HDL A;  4DV2 Q;  4L5R C;  1ZYR C;  1YNJ D;  3NTH A;  5C4J B;  1HNX Q;  3OYY A;  3A8K E;  3BVZ A;  2PQE A;  1JMC A;  3GTO H;  3DM3 A;  2D0O A;  1I6H H;  2MO0 A;  3K57 A;  3C1F A;  1YVC A;  4LF7 Q;  1WFQ A;  1AN8 A;  3MC0 B;  1GVP A;  5EPL A;  4OEM B;  1FD7 D;  4PNY A;  1L0W A;  4JI8 Q;  3UDF A;  4DUZ Q;  4DR3 L;  2F0Q A;  1UE7 A;  4WJW A;  1GO3 E;  3BYY B;  4X66 Q;  5C0X G;  2DNE A;  3Q0A A;  5M3F B;  2AMC B;  3J7A V;  1I4Q A;  4A3E H;  5BN5 A;  1UE1 A;  2JA8 G;  2F4V Q;  3TQY A;  2KQ3 A;  2QCP X;  2JK8 A;  2N8N A;  1EYD A;  3CCL A;  2F4I A;  1RDP D;  1VCI A;  3ERO A;  1VQG A;  1HZC A;  4DN4 M;  3WDN A;  1J5E Q;  5C3E B;  4POF A;  2HD3 A;  5FKA C;  2VB2 X;  4DK3 C;  3J81 j;  5FLM H;  1CKO A;  5IOC A;  2E75 C;  1DCZ A;  1QVG A;  4YIJ A;  1Y69 U;  1EOT A;  5CBE E;  1C48 A;  1FYC A;  4CDD C;  1E24 A;  4GOP B;  3DM1 A;  1WTV A;  1AZP A;  1RL2 A;  4L5Q A;  1EEI D;  2IHF A;  4CKE A;  3DWP A;  1YHQ A;  4DR2 L;  3TP5 A;  3G4S A;  2R7Z G;  2UXB Q;  2EYO A;  5CV4 A;  1U5K A;  2EYL A;  1DOL A;  2F0I A;  4HIK A;  1KD1 C;  1ICW A;  1EIY B;  4A3F G;  3KLR A;  5FO9 B;  3GTL H;  2J0T D;  4DXF A;  5IY0 A;  4C1N I;  1NCV A;  4RCN A;  4X62 L;  2PNH A;  1HNW L;  1RF2 D;  1Q3L A;  3JAM E;  1C7Y A;  3AYH B;  1IL2 A;  3OTO L;  5FO8 B;  4H7B A;  1D5Z C;  4DR3 Q;  1LTG D;  1SEB D;  4IUQ A;  3M4O B;  3I4O A;  5CMD A;  2JA5 G;  4LF5 L;  1XJV A;  4V19 0;  5C4J H;  2BDN A;  2N78 A;  3CQZ B;  2UUA L;  3CPF A;  4HJA A;  3OW2 A;  4QMG A;  3CCR A;  4XT1 B;  2XGT A;  4B3T Q;  4PMC A;  4QUF A;  3HKZ E;  1OO9 B;  5C0X H;  3A56 A;  1PFS A;  2K7V A;  1SXT A;  2NN6 I;  3GD7 A;  2ZJP A;  1TS2 A;  4BY7 B;  4P71 A;  4I65 A;  1FJG Q;  1QCB D;  2R7D A;  4FO2 A;  1W6K A;  3CAM A;  1HTP A;  3V05 A;  2BE5 D;  3A7L A;  4UPA A;  3J81 i;  3AU7 A;  2A6H D;  3OWF A;  1BR9 A;  2MP1 A;  2WII B;  3VR6 A;  4JOI C;  2PPB C;  5FK9 C;  4H02 A;  1LV9 A;  1IKL A;  1FR3 A;  1VS0 A;  3U50 C;  3OOC A;  4YHH L;  1IKM A;  2R92 B;  2JSO A;  3GTG H;  1D5X C;  2G9D A;  2K5V A;  2B39 A;  2JEB I;  4ZQ3 A;  1GUN A;  2HIX A;  1F77 A;  4QIW B;  2LSS A;  3I55 A;  5E4X A;  4XQQ A;  2K5N A;  3L9A X;  5JJL A;  4FP5 D;  5JAV A;  4YCW A;  4A3E B;  1UNS A;  3HS0 C;  1YEZ A;  3RLN A;  1MI2 A;  3ONA B;  1DOK A;  3KFU A;  4GOP A;  1HZB A;  2E2H B;  2RF4 A;  2BCO A;  4A3M G;  2VY3 A;  1LTA D;  3H3V H;  3VYR A;  5C3W A;  4A3B G;  3CU7 A;  3ER0 A;  2F0V A;  2PYK A;  2UUB Q;  4C3I H;  4A3M B;  4QB4 A;  2HHH Q;  4RCO A;  1O7Z A;  1FJG L;  4ZKC B;  3DUZ A;  1PMR A;  2K05 A;  4Y7N B;  4GKK Q;  3C3L A;  2H4O A;  2F0P A;  1I4P A;  5I2X A;  4X65 Q;  1KC8 C;  1LT6 D;  4HAE A;  1SNM A;  3HGB A;  1SRO A;  3P1H A;  2UXD Q;  3K58 A;  4HSV A;  4A4I A;  4NP5 A;  3TP7 A;  2AUJ D;  1STG A;  2F0W A;  4DFA A;  1YJW A;  1CZG A;  4JBK A;  4B3M Q;  3P75 A;  1WCM B;  3S2D B;  3S16 B;  3X3M A;  4BBS H;  1BBU A;  4Q0F A;  3J7Y W;  4OWT B;  4JBM A;  2I07 B;  3B6Y A;  2VB3 X;  5ELC A;  1DOM A;  4AIM A;  5T1G A;  3S1R H;  2JXM B;  2QDL A;  4RGO S;  3MEF A;  3CCJ A;  1O7Y A;  2L9H A;  3GTQ B;  4IJL A;  5FLM G;  4X3T A;  5CGK A;  1K3R A;  4RFB A;  2F0K A;  1OXS C;  3A55 A;  1AE3 A;  3S17 H;  1LTS D;  3BZK A;  4IFD J;  2K32 A;  3GO5 A;  4XYQ A;  2R3Z A;  2Z4I A;  4ZKB B;  1PTO H;  2Z0S A;  4HCE A;  4OWX B;  3NXW A;  3R8B A;  3QOJ A;  1KDC A;  3GV3 A;  3T1H Q;  4RKL A;  1VQ7 A;  2F0F A;  4TKO B;  4C3H B;  1PFN A;  5HGQ A;  4B08 A;  2JYO A;  3S15 H;  2XN9 C;  1SYE A;  4BBR H;  4QUC A;  1VMP A;  2YTX A;  4S3S A;  3KLS X;  3NTK A;  4C2M H;  5IYD G;  1Q82 C;  3F2B A;  4F88 A;  2HQE A;  3CP0 A;  2QIL A;  2F0N A;  3RZD B;  3KF8 A;  4K2L A;  5T1I A;  1HUM A;  4G7H C;  3GTQ H;  1MSH A;  3BDO A;  4X3S A;  3W5O A;  5DM7 3;  5EBD A;  4BY1 B;  1XWE A;  1I5F A;  1Y8P B;  1QUQ A;  1PH9 A;  1KXL A;  4LMQ D;  1IW7 D;  1P8L A;  2B2Y A;  2R93 H;  1X3Q A;  3H15 A;  4FDB A;  1I3Q H;  3W2D A;  2JA7 H;  2FMM A;  4XQJ A;  4IJH A;  1A62 A;  1CFM A;  4YHH Q;  5CV9 A;  3F2U A;  1N33 L;  3JC6 6;  1PA6 A;  4AYB E;  1Q90 A;  4UAI A;  4KJO A;  3T13 A;  1E2Z A;  2AWN A;  1EZ8 A;  2F03 A;  4OEL B;  5DM6 3;  5C0X I;  1VQJ A;  2XWB B;  3GTJ B;  1O7I A;  1EL0 A;  1WTX A;  1HFG A;  1T9H A;  5C5M A;  1A6X A;  2F1M A;  5C4X G;  3RR5 A;  5M5Y H;  3Q6S A;  4Q5V A;  3L3O C;  3KDF A;  2PW7 A;  2NBF A;  1HH2 P;  3HKZ B;  3NWT A;  4HN7 A;  2YTV A;  2UXB L;  3M7G A;  2IL8 A;  1KIX A;  3S24 A;  1I6V C;  1VQP A;  2RDG A;  3D4W A;  3CCM A;  1A2T A;  2B63 H;  5KGU A;  1SMY D;  3OIP A;  4PZ7 A;  4ZYS A;  3PO3 B;  5COY A;  1N36 Q;  1YIT A;  3HP3 A;  4N9P A;  5C4Z A;  1TWC H;  5LMN Q;  3CC7 A;  1VQ9 A;  5GAE C;  3WWV A;  5M5Y B;  1X32 A;  3URY A;  1RKN A;  3CKI B;  2K5W A;  4A3J B;  3HOU B;  2B2T C;  5JPN C;  3JAM c;  1SN8 A;  3HOX G;  3I4N H;  1YJ9 A;  4B3S L;  2VZA A;  1EQR A;  1X54 A;  1H95 A;  3KF6 A;  2Z8L A;  3M7N A;  5G3L D;  4GNX C;  1SJH D;  3ICE A;  1EIG A;  5C44 B;  1K3B C;  2RA4 A;  1CQV A;  3E3X A;  1FNU A;  1YHA A;  5FO7 B;  1EQV A;  1X9N A;  5IGD A;  1SR3 A;  2WKD A;  1O7L A;  2KHJ A;  4IN3 A;  4DK0 A;  3QB3 A;  4A93 B;  2K04 A;  3PF4 A;  3T1Y Q;  3EJI A;  1PHJ A;  1HTL D;  2JN4 A;  4CHT B;  5D3I B;  1S3O A;  1L0Y B;  2QF7 A;  1HR0 Q;  4O0A A;  3QO2 A;  5ISR A;  4YCU A;  3C1E A;  1WTW A;  4HIM A;  2RQX A;  1VQA A;  3GQB A;  3IRB A;  4R4T A;  1QZG A;  1HNZ Q;  1WCM H;  2MUY A;  1BDO A;  1PRT B;  1LT5 D;  4JI4 L;  2XSC A;  4XT3 B;  3SDZ A;  4NB3 A;  4ME5 A;  5E1F A;  5C5L A;  3A5U A;  4LFA L;  3WOE A;  1KDA A;  2WAQ E;  1E0B A;  4A3K H;  5CV8 A;  4KKU A;  1VQB A;  2EOT A;  4TVA B;  4ZRZ A;  1BBX C;  4OO1 I;  4OL7 A;  1NUC A;  3HEJ A;  1LTR D;  1YJN A;  3D3R A;  4YY3 Q;  4DV3 Q;  1XMQ L;  3E9I A;  3S14 H;  3R93 A;  4CDF C;  2LY7 A;  3BU2 A;  2RDF A;  5C3E G;  2VUM H;  2O4X A;  3OPO A;  1BF4 A;  2KCT A;  3LWU A;  2NYZ D;  4QF4 A;  5EKI A;  4LF4 Q;  1YI2 A;  3S1Q B;  2NVQ B;  2E5L Q;  4IUR A;  3T51 B;  5LMU Q;  4APV A;  1VF7 A;  2HIV A;  1R4Q B;  3A74 A;  2HCC A;  4P72 A;  1M90 C;  2E5L L;  3H3V C;  3GTK B;  4JI3 L;  3TP8 A;  4OO1 G;  1LM0 A;  3KYH C;  1RD9 D;  4CBV A;  1OXV A;  2E2I H;  2O2L D;  3K0X A;  4QGU A;  1A3U A;  5LHY 1;  1B7Y B;  3GTG B;  2AQ2 B;  2MJ8 A;  4JI0 Q;  3S1N H;  2B63 B;  1ASZ A;  3NSW A;  1CQF A;  1CTM A;  3KLS A;  3GDE A;  1G2T A;  1CZW A;  5TSS A;  4K5W A;  3MFG A;  3MZ5 A;  4L8J A;  3RNU A;  1JE5 A;  1ICF B;  3CQZ H;  4PQX A;  1KAW A;  3K7A B;  1CI3 M;  3L0O A;  4IAL A;  1HA6 A;  3TRZ A;  4BXX G;  2VQF L;  4KMU C;  4TQU S;  2ZJR A;  2RKS A;  1QZH A;  4JCV E;  3I4L A;  1WTR A;  4DR6 Q;  1XNR Q;  4DR7 Q;  3PUY A;  4O42 A;  5CBA E;  2KBN A;  1BO0 A;  2VL6 A;  3M85 A;  3CCV A;  1L0X B;  2Z6K C;  2WB1 B;  2J4X A;  4KKT A;  3E0E A;  3V2T A;  4DGZ A;  4KI0 A;  5J39 A;  3FRP B;  5I2Y A;  1K0S A;  2Z1C A;  1EEF D;  1BVS A;  1LTB D;  1K73 C;  1EY9 A;  3SK8 A;  4AH6 A;  3SHL A;  1V1P A;  3I72 A;  2KHI A;  4O2D A;  2VXW A;  1ESF A;  5CYU A;  1B8A A;  1BCP F;  2B2V A;  3I3C A;  2F52 A;  4EQN A;  5A2Q L;  2WV6 D;  2Q2H A;  1CSQ A;  2C35 B;  5IGC A;  3SE0 A;  3VDY A;  2EPB A;  4N8F A;  4ZK9 B;  2MPM A; 
#chains in the Genus database with same CATH homology
 2NTS A;  2JA8 B;  1BUV T;  1LTI D;  5DAU A;  3EVQ A;  2SEB D;  3BDC A;  5CR3 A;  3H91 A;  4EGV A;  4IUP A;  2OT2 A;  2TMP A;  1C4Q A;  5C6A A;  1G6Z A;  2BDO A;  5IT9 L;  1CHQ D;  2RSN A;  1ROD A;  2BOS A;  3J81 L;  4XQN A;  2IJ0 A;  3K5L A;  2K5D A;  3HG9 A;  2FIN B;  5DNF A;  2B2W A;  1SAP A;  1Q12 A;  3TDQ A;  2NN6 G;  5LL6 S;  2M2L A;  4C3H G;  3I8Z A;  1TS3 A;  4ID6 A;  2RVL A;  1SE3 A;  3NHH A;  2XRQ D;  4K6D A;  1HFN A;  4FXK C;  1JB3 A;  1I6H B;  1CHP D;  4UDU C;  4X3U A;  1NR4 A;  5NUC A;  1F9S A;  4OIJ A;  3HOW B;  1FNW A;  4BBR B;  4FF2 A;  3EQL C;  4FNF A;  4PMW A;  3MWY W;  2C9O A;  1PYW D;  4L6T B;  1K83 B;  1TS4 A;  4IZ8 A;  2QEJ C;  1JWU D;  2B2U C;  3VYU A;  3BS1 A;  3K5N A;  1SFO B;  1WTP A;  1IL8 A;  3K5O A;  3BZD B;  2EXZ A;  2L12 A;  4FVM A;  5KYI A;  3PIP 3;  5EJW A;  2B8F A;  2Y0S B;  2BE5 C;  2FFK B;  3TSS A;  3AMU A;  2ICE C;  3P20 A;  1OXU A;  1GXD C;  1SYB A;  1B3A A;  3EFX D;  4RGM A;  1QOH A;  3KUP A;  1D6E C;  5DEH A;  1ENF A;  5C3X A;  4ODG A;  3S1M B;  4ZLT F;  4C3I B;  1I4R A;  1SNQ A;  1O78 A;  2A69 C;  4KD4 A;  4BS9 A;  4DAY A;  2K5Q A;  4MIU A;  3QG1 A;  3Q23 A;  3N52 A;  1LLR D;  4WOR A;  1AW7 A;  2IX1 A;  1TWC B;  4KJN A;  3MXG A;  4A3G B;  1KNA A;  2EYM A;  4DK1 A;  3T16 A;  1EY0 A;  4L63 B;  3CRK C;  5D65 A;  2D9U A;  2F0E A;  2ID0 A;  1I3Q B;  2JA7 B;  5JEA H;  5JPM C;  1VDZ A;  2WAQ B;  2XVS A;  3NQT A;  2L11 A;  2OF1 A;  2ZXP A;  1IHZ A;  3O13 A;  2AQ3 B;  3VA5 A;  1SNP A;  4AYB B;  2MGS A;  4K14 A;  5D3D A;  4XXE A;  3S9W A;  1Y8O B;  2EZV A;  5M3M B;  1PRT D;  3SVM A;  1BOS A;  3J80 L;  3NBI A;  1X3P A;  3I90 A;  4I7Z C;  2JA6 B;  1RJT A;  4DNT B;  4K2K A;  1STA A;  4LAA A;  5EQ0 A;  5IOD A;  5KND A;  3FDT A;  3VR2 A;  2NB0 A;  3GTO B;  4WRD A;  1HQR D;  4DU9 A;  2IX0 A;  3RMH A;  2G9H D;  4OHJ A;  1HHV A;  1TWH B;  3H6M A;  4RA8 A;  4HSP A;  3PIO 3;  2L55 A;  3VR4 A;  2E76 C;  4B9X A;  2Q8R E;  4C1N K;  1B9M A;  2RDH A;  1Z7T A;  2I46 A;  3VA7 A;  4CKB A;  4FF4 A;  3W3A A;  5BN4 A;  1J9O A;  1EY8 A;  3KBG A;  1ILQ A;  3FEW X;  1V43 A;  3DXJ C;  2KUM A;  2SDF A;  4IUV A;  2F3W A;  3HOY B;  2R7Z B;  3V96 A;  1A3T A;  3MAQ A;  4F87 A;  5IGF A;  1ET6 A;  5FOB B;  2FJ2 A;  1GUT A;  3P7J A;  4DNR B;  4H13 C;  1STB A;  1R9T B;  4HTH A;  3OHX C;  1BCP B;  1GUO A;  2F0G A;  1EWH A;  2JA5 B;  3CHB D;  1F2Z A;  4IQZ A;  3D4D A;  1IYV A;  3A8I E;  1HXY D;  1JC7 A;  5A35 A;  3ERQ A;  5JJZ A;  1A15 A;  3DWQ A;  5IGB A;  3S17 B;  4KN7 C;  1BQQ T;  5I6Y A;  1VMC A;  2FMC A;  5KYL A;  1KNE A;  2X6G A;  4XIG S;  4NDX A;  3TBI B;  3E6Z X;  2HDM A;  3QOL A;  1EY5 A;  1MD2 D;  1CK1 A;  2F0D A;  1B50 A;  1NAP A;  1TII D;  1S5C D;  2A73 B;  4IFD G;  5M5X B;  3NWS A;  1LAB A;  4IUN A;  1SYF A;  1PFM A;  3TZD A;  3HOX B;  4CKC A;  4G7O C;  1BXT A;  1WD1 A;  5EKL A;  2PO4 A;  3K0Y A;  1QWY A;  1WTO A;  4G57 A;  3GTL B;  3T53 B;  1PZK D;  3D4R A;  2KJX A;  1LAC A;  4OO1 H;  3KBX A;  2WAC A;  1ZYR D;  2PNR C;  5M9O A;  2PCF B;  5KIX A;  1FGB D;  2CW0 D;  1CA5 A;  5AFW A;  5EBC A;  2WIN B;  3BVG A;  4FXG C;  4ZUJ A;  1WVL A;  1H9S A;  1Y1V B;  1D5M C;  5E3F A;  1DJR D;  5K36 H;  1ET9 A;  5KEE A;  5IGG A;  4BBS B;  1DON A;  3BYT B;  1KLU D;  2NVY B;  1STN A;  4KY7 A;  5FLX L;  1DYQ A;  2WP8 J;  2NZ1 D;  3NTI A;  2F0H A;  3S15 B;  2D2C C;  2R93 B;  4ULL A;  1EFI D;  3NE5 B;  3ZYY X;  3PUZ A;  2O5J C;  2ENB A;  1DD2 A;  3R2T A;  4GZY C;  3D6C A;  3TME A;  1H9R A;  1U9R A;  2CHB D;  1HQM C;  5I9P A;  5EGT A;  4IUU A;  5IIF A;  2A6E C;  2A68 D;  3DEO A;  2L1B A;  3MA2 B;  3BVM A;  2AUK A;  2QKI C;  1GUW A;  1YNN D;  1GUG A;  4A3F B;  2LFN A;  1ZKO A;  2NTT A;  2KCC A;  4RAU C;  1I4H A;  1EY6 A;  1PZJ D;  3Q24 A;  3HZX A;  4MHE A;  3GTM B;  1HCZ A;  5LL6 X;  1H9J A;  3A54 A;  3VYS A;  3T4A C;  3SK4 A;  4E6I A;  2EYH A;  3MHB A;  3VR3 A;  1DXM A;  5CV6 A;  5CV7 A;  4DAP A;  1U4M A;  1U4R A;  2EJG C;  2F0T A;  1B1Z A;  1EY7 A;  1H9K A;  1IYU A;  1PZI D;  1WD0 A;  1Z6H A;  2F0M A;  4WFN 3;  2A5H A;  2F0S A;  1ONL A;  2EYF A;  3NK9 A;  3KK7 A;  5ELE A;  1TWF B;  4J1M A;  2DY7 A;  2V4D A;  5JOB A;  1PFB A;  4KHZ A;  2XNA C;  3D31 A;  1M8A A;  4C3I G;  2KVM A;  4O1N A;  3OWE B;  5CV5 A;  2IWH A;  1QIL A;  3I70 A;  4XTC S;  5CC4 A;  1KTK A;  3RD4 A;  2K33 A;  2J7Z A;  1RCV D;  2LMC B;  1TWG B;  4RGT A;  3AB9 A;  4N9T A;  1TWA B;  1A3V A;  5J1Z A;  1AEX A;  2KOL A;  4TSS A;  1E2V A;  4RWS C;  3FVQ A;  1KDB A;  1XYI A;  2XWJ B;  2HUG A;  4H44 C;  1SE4 A;  1S5D D;  1BCP C;  1QE6 A;  2XRS D;  2DN8 A;  1ZXT A;  3IFD A;  1H9M A;  1STH A;  3ITP A;  3GV6 A;  4M1U B;  1KAB A;  1JWS D;  1QB5 D;  5KNC A;  4EQO A;  3T56 B;  3I4N B;  1EYC A;  1F2M A;  4R8N A;  2JE6 I;  1JCK B;  4C56 C;  2FHT A;  1YNJ C;  2A6H C;  3Q22 A;  2EY2 A;  1Q1E A;  2SOB A;  3U9O A;  4K6L A;  1PTO C;  4H0L C;  2RSO A;  4HR7 B;  5C0X J;  2ICI A;  2D62 A;  5KNB A;  3CRL C;  4R9W A;  1JOO A;  1T5E A;  2MHV A;  1F9R A;  3R2I A;  1PXU A;  2NUC A;  1XX8 A;  5A2Q E;  2QDB A;  4ZUI A;  3M4Y A;  5C4X B;  4M8A A;  3MEH A;  1DZ1 A;  2DY8 A;  2B2T A;  2KEC A;  2ZT9 C;  1LTT D;  1TY2 A;  2EJM A;  1B2T A;  4BWG B;  1GHK A;  2R6G A;  1FNV A;  1W6J A;  4IUT A;  3NUC A;  2NN6 H;  1HPC A;  5ELB A;  2NWG A;  3PO2 B;  3ND8 A;  4MN3 A;  1F2Y A;  4ILW A;  1QNU A;  2PZU A;  5ELF A;  2VNU D;  2SNS A;  2B2W C;  1NSN S;  2GA4 B;  2E2D C;  2EDG A;  1STE A;  4HMI A;  4NMZ A;  1HRJ A;  1HA5 A;  2D5D A;  4DF7 A;  2JP1 A;  4CJ2 C;  1JOR A;  1Q1B A;  2X69 A;  3FPU B;  3H94 A;  2KEE A;  4PV1 C;  4Z9C B;  3K59 A;  3JAM L;  2EJF C;  2N88 A;  3LNN A;  4J8Q A;  1PRT F;  1C8C A;  2E74 C;  5I4D A;  3BDL A;  2K03 A;  1Z47 A;  1K8M A;  2B2Y C;  3M3Y B;  4KY6 A;  1EY4 A;  3NPP A;  1OXT A;  3I73 A;  2IT1 A;  3IFT A;  3S14 B;  5IT9 E;  1S5F D;  2KCN A;  3IKJ A;  5HGT A;  2AQ1 B;  4DXG A;  1RHP A;  1ESR A;  1JQY D;  3FKI B;  3J7A F;  3QJY A;  5E4W C;  4KV6 A;  3MTS A;  1U4P A;  1V1P B;  1JWM D;  3I91 A;  3PUX A;  1F2L A;  3NQI A;  1RTN A;  1NR2 A;  2VUM B;  1VF5 C;  4C2M B;  2ZXR A;  1PTO F;  5M5W B;  1JIC A;  4RHR A;  4TRD A;  1G91 A;  5J22 A;  1D1K A;  1EWC A;  2M9V A;  3RUZ A;  1MBY A;  4U67 3;  3MVV A;  2SNM A;  4KN4 C;  1SYG A;  2O5I C;  3TZU A;  1Q8I A;  5I6W A;  3D8G A;  1LT3 D;  2WKC A;  3FPP A;  4HCS A;  1M4V A;  2EY5 A;  1F9P A;  4K5V A;  2R61 A;  1B9N A;  4V0B A;  1GJX A;  4OIK A;  1EYA A;  1EQT A;  4KKS A;  2LS0 1;  1S4Z A;  4FF1 A;  4ZAI A;  5D14 A;  3LWE A;  1SBB B;  4A3I B;  3PMF A;  3K5M A;  1ZEQ X;  1SSO A;  1H9S B;  4RHS A;  3I4M B;  3BG3 A;  3RZO B;  1BNZ A;  5ELD A;  3SEB A;  5JVG 3;  4IFD H;  2PZT A;  3RLF A;  5EPJ A;  3S1N B;  3OMG A;  4FYD A;  1SMY C;  3TP6 A;  1EU3 A;  2EYP A;  4P2C B;  2KED A;  3A7A B;  4KY5 A;  3SXH A;  1ENA A;  1QG7 A;  1TY0 A;  3OIQ A;  1SDF A;  4R8I A;  3E5S A;  3MXU A;  1UUP A;  2K01 A;  4JBW A;  1JE4 A;  2TSS A;  2XIW A;  2B2U A;  1TKW B;  3PUV A;  2JEA I;  1MSG A;  2K6A A;  4IFD I;  4BA2 I;  1KAA A;  3EA6 A;  4QCL A;  4BA1 I;  3VYT A;  1GOZ A;  3OSO A;  5F2D A;  4HMJ A;  3G6J B;  3DWA A;  2B8G A;  1B53 A;  2OEO A;  3QWN A;  1TR5 A;  1WTQ A;  1B44 D;  2N55 A;  3A8J E;  2IX3 A;  3HOZ B;  1B4O A;  4A3B B;  1AP0 A;  1ILP A;  1T5X D;  1ML0 D;  5IGE A;  3D6W A;  1PDQ A;  2EE1 A;  2K1B A;  2PMZ B;  3NP8 A;  3H0G B;  2A74 C;  1UAP A;  1EIH A;  1R4P B;  4XDX A;  3L7Z C;  3VR5 A;  4JK1 C;  2Q8I B;  5I9O A;  1U4L A;  1AZQ A;  1I4X A;  1G8Z D;  3J80 E;  1SND A;  1JR0 D;  2EY6 A;  1E2W A;  4G4K A;  2LKV A;  3X3N A;  3UI2 A;  1GUS A;  3NBH A;  1HUN A;  2KHS A;  3DEP A;  4F7X A;  4RKB A;  2F0O A;  4KTA A;  2E2J B;  3E0J A;  2C5C A;  4X3K A;  2RBM A;  1SNO A;  5K5P A;  4RGN A;  2X6L A;  2K28 A;  2KA7 A;  2ZXO A;  4J6H A;  1LO5 D;  1TQO A;  4C3J G;  1BCP D;  3WOF A;  1TU2 B;  2Q8T A;  3SK6 A;  1XTC D;  5G3L F;  4C3J B;  5BN3 A;  3OW7 A;  2L4N A;  1YNN C;  3G7L A;  5EPK A;  4LJZ C;  5K36 G;  2Z4H A;  2A6E D;  4A3D B;  1OXX K;  4DAV A;  2A68 C;  1I4G A;  1STY A;  3IAY A;  1JOQ A;  1SJE D;  1XXG A;  2EY1 A;  3TN2 A;  4HED A;  3C46 A;  3OMC A;  3IL8 A;  1V8Q A;  2E2I B;  2AWO A;  5JEA J;  4K8J A;  2PW5 A;  3ND9 A;  1V1O A;  3H09 A;  4CGY B;  3SR1 A;  5JEA G;  1SYD A;  4ABN A;  4KK7 A;  3R3O A;  2YYZ A;  4XYO A;  3GP7 A;  1ENC A;  2HCI A;  1AFP A;  1TT2 A;  3GTP B;  3SK5 A;  4K8I A;  1D2B A;  1EZ6 A;  1D1I A;  2F3V A;  3MFY A;  1G2S A;  2F0U A;  1O80 A;  1F9Q A;  4CJ1 B;  3QIA A;  2EVB A;  4FF3 A;  1II3 A;  1MGS A;  4PMB A;  2EYJ A;  1PTO D;  2CW0 C;  5KRU A;  1CM9 A;  2H1E A;  4B9W A;  1UEA B;  2CQA A;  1PRT C;  1S5B D;  2B2V C;  5HUR A;  4NKL A;  1DM0 B;  3U9S A;  4KHV A;  2M00 A;  2F0L A;  1PTO B;  3PUW A;  1TVX A;  1IW7 C;  1I50 B;  1CA6 A;  1TS5 A;  2BA0 A;  4K5X A;  4F8M A;  2IPK D;  3MXP A;  1PLF A;  3DHQ A;  4CJ0 B;  4RH6 A;  5JVH 3;  1Y1W B;  4LK1 C;  1S5E D;  3J81 E;  2PZW A;  3FMC A;  4KD3 A;  3S2H B;  1QNK A;  3PV0 A;  2CVR A;  1A2U A;  1SNC A;  4A3K B;  5FLX E;  3DMU A;  2BA1 A;  1Y8N B;  2L0C A;  3C2P A;  3K6O A;  5C4H A;  1QJO A;  3N6R A;  2A69 D;  2F0J A;  1G29 1;  4FXD A;  1KLG D;  1SE2 A;  4DA2 A;  4EQP A;  1GHJ A;  2DNC A;  1K8O A;  1J8I A;  1SYC A;  3HOV B;  1JOK A;  4OGQ C;  1EU4 A;  2L5T A;  1CT1 D;  1RTO A;  2IW3 A;  3MXN A;  3S1R B;  4G7Z C;  4EVO A;  3LX0 A;  5EKK A;  2OXP A;  5COR A;  1LT4 D;  3HRZ C;  2NVX B;  2NVT B;  2YU9 B;  4U68 A;  4NW2 A;  2HDL A;  1ZYR C;  1YNJ D;  3NTH A;  5C4J B;  3A8K E;  3BVZ A;  2PQE A;  3K57 A;  3C1F A;  3MC0 B;  1AN8 A;  5EPL A;  1FD7 D;  4PNY A;  2F0Q A;  4WJW A;  3BYY B;  5C0X G;  2DNE A;  3Q0A A;  5M3F B;  3J7A V;  1I4Q A;  5BN5 A;  2KQ3 A;  2QCP X;  1EYD A;  2F4I A;  1RDP D;  1VCI A;  3ERO A;  4DN4 M;  3WDN A;  5C3E B;  5FKA C;  2VB2 X;  5IOC A;  2E75 C;  1DCZ A;  4YIJ A;  1Y69 U;  1EOT A;  5CBE E;  1C48 A;  1FYC A;  1WTV A;  3DM1 A;  1AZP A;  1EEI D;  4CKE A;  3DWP A;  3TP5 A;  2EYO A;  5CV4 A;  2EYL A;  1DOL A;  2F0I A;  1ICW A;  3KLR A;  5FO9 B;  2J0T D;  4DXF A;  4C1N I;  1NCV A;  4RCN A;  1RF2 D;  1Q3L A;  3JAM E;  5FO8 B;  4H7B A;  1D5Z C;  1LTG D;  1SEB D;  4IUQ A;  3M4O B;  5CMD A;  4V19 0;  2BDN A;  3CQZ B;  4QMG A;  4XT1 B;  4PMC A;  4QUF A;  1OO9 B;  5C0X H;  3A56 A;  2K7V A;  1SXT A;  2NN6 I;  3GD7 A;  1TS2 A;  4BY7 B;  4I65 A;  1QCB D;  4FO2 A;  1W6K A;  1HTP A;  3V05 A;  2BE5 D;  3A7L A;  3AU7 A;  2A6H D;  3OWF A;  1BR9 A;  2MP1 A;  2WII B;  3VR6 A;  2PPB C;  5FK9 C;  1LV9 A;  1IKL A;  1FR3 A;  3OOC A;  1IKM A;  2R92 B;  2JSO A;  1D5X C;  2G9D A;  2B39 A;  2JEB I;  4ZQ3 A;  1GUN A;  1F77 A;  4QIW B;  5E4X A;  4XQQ A;  3L9A X;  4FP5 D;  5JAV A;  4A3E B;  1UNS A;  3HS0 C;  1MI2 A;  3ONA B;  1DOK A;  2E2H B;  2BCO A;  1LTA D;  3VYR A;  5C3W A;  3CU7 A;  2F0V A;  2PYK A;  4A3M B;  4QB4 A;  4RCO A;  1O7Z A;  4ZKC B;  3DUZ A;  1PMR A;  2K05 A;  4Y7N B;  3C3L A;  2H4O A;  2F0P A;  1I4P A;  5I2X A;  1LT6 D;  4HAE A;  1SNM A;  3HGB A;  3P1H A;  3K58 A;  4HSV A;  4NP5 A;  3TP7 A;  2AUJ D;  1STG A;  2F0W A;  4DFA A;  1CZG A;  3P75 A;  1WCM B;  3S2D B;  3S16 B;  3X3M A;  3J7Y W;  4Q0F A;  2I07 B;  2VB3 X;  5ELC A;  1DOM A;  5T1G A;  2JXM B;  4RGO S;  1O7Y A;  2L9H A;  3GTQ B;  4X3T A;  5CGK A;  4RFB A;  2F0K A;  1OXS C;  3A55 A;  1LTS D;  4IFD J;  2K32 A;  3GO5 A;  4XYQ A;  2R3Z A;  2Z4I A;  4ZKB B;  1PTO H;  4HCE A;  3NXW A;  3R8B A;  3QOJ A;  1KDC A;  3GV3 A;  4RKL A;  2F0F A;  4TKO B;  4C3H B;  1PFN A;  4B08 A;  2JYO A;  2XN9 C;  1SYE A;  4QUC A;  1VMP A;  4S3S A;  3KLS X;  3NTK A;  4F88 A;  2HQE A;  2QIL A;  2F0N A;  3RZD B;  3KF8 A;  4K2L A;  5T1I A;  1HUM A;  4G7H C;  1MSH A;  3BDO A;  4X3S A;  5DM7 3;  5EBD A;  4BY1 B;  1XWE A;  1Y8P B;  4LMQ D;  1IW7 D;  2B2Y A;  1X3Q A;  3W2D A;  2FMM A;  4XQJ A;  1CFM A;  5CV9 A;  3F2U A;  1Q90 A;  4UAI A;  4KJO A;  3T13 A;  1E2Z A;  2AWN A;  1EZ8 A;  2F03 A;  5DM6 3;  5C0X I;  2XWB B;  3GTJ B;  1EL0 A;  1WTX A;  1HFG A;  5C5M A;  1A6X A;  2F1M A;  3Q6S A;  4Q5V A;  3L3O C;  2PW7 A;  2NBF A;  3HKZ B;  3NWT A;  4HN7 A;  3M7G A;  2IL8 A;  1I6V C;  2RDG A;  3D4W A;  1A2T A;  5KGU A;  1SMY D;  3OIP A;  4ZYS A;  3PO3 B;  5COY A;  3HP3 A;  4N9P A;  5C4Z A;  5M5Y B;  1X32 A;  3URY A;  1RKN A;  3CKI B;  2K5W A;  4A3J B;  3HOU B;  2B2T C;  5JPN C;  2Z8L A;  3M7N A;  5G3L D;  1SJH D;  1EIG A;  5C44 B;  2RA4 A;  1CQV A;  1FNU A;  5FO7 B;  1EQV A;  5IGD A;  2WKD A;  1O7L A;  4IN3 A;  4DK0 A;  3QB3 A;  4A93 B;  2K04 A;  3EJI A;  1HTL D;  4CHT B;  5D3I B;  1L0Y B;  2QF7 A;  3QO2 A;  5ISR A;  3C1E A;  1WTW A;  2RQX A;  3GQB A;  2MUY A;  1BDO A;  1PRT B;  1LT5 D;  2XSC A;  4XT3 B;  3SDZ A;  4ME5 A;  5E1F A;  5C5L A;  3WOE A;  1KDA A;  1E0B A;  5CV8 A;  4KKU A;  2EOT A;  1BBX C;  4ZRZ A;  4OO1 I;  4OL7 A;  1NUC A;  3HEJ A;  1LTR D;  3D3R A;  3R93 A;  2LY7 A;  2RDF A;  2O4X A;  3OPO A;  1BF4 A;  3LWU A;  2NYZ D;  4QF4 A;  5EKI A;  3S1Q B;  2NVQ B;  4IUR A;  3T51 B;  1VF7 A;  1R4Q B;  2HCC A;  3H3V C;  3GTK B;  3TP8 A;  4OO1 G;  1RD9 D;  4CBV A;  1OXV A;  2O2L D;  1A3U A;  5LHY 1;  3GTG B;  2AQ2 B;  2MJ8 A;  2B63 B;  3NSW A;  1CQF A;  1CTM A;  3KLS A;  1G2T A;  1CZW A;  5TSS A;  4K5W A;  3MFG A;  3MZ5 A;  4L8J A;  4PQX A;  3K7A B;  1CI3 M;  4IAL A;  1HA6 A;  4KMU C;  4TQU S;  2RKS A;  1WTR A;  3I4L A;  3PUY A;  4O42 A;  5CBA E;  1BO0 A;  3M85 A;  1L0X B;  2WB1 B;  2J4X A;  4KKT A;  3V2T A;  4DGZ A;  4KI0 A;  5J39 A;  3FRP B;  5I2Y A;  2Z1C A;  1EEF D;  1LTB D;  1EY9 A;  3SK8 A;  3SHL A;  1V1P A;  3I72 A;  2VXW A;  1ESF A;  5CYU A;  1BCP F;  2B2V A;  3I3C A;  4EQN A;  5A2Q L;  2WV6 D;  5IGC A;  3SE0 A;  2EPB A;  4ZK9 B;  2MPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...