1ST3A

The crystal structure of the bacillus lentus alkaline protease, subtilisin bl, at 1.4 angstroms resolution
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
269
structure length
269
Chain Sequence
GQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGADGRGAISSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGASSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the Bacillus lentus alkaline protease, subtilisin BL, at 1.4 A resolution.
pubmed doi rcsb
source organism Bacillus lentus
molecule tags Serine protease
molecule keywords SUBTILISIN BL
total genus 102
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1991-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1st3A00
1GTG1 4NE7A 4CG0A 3OSZA 3TI7A 1JEAA 1GNSA 4J94A 4OMDA 3BPSA 5FBZA 4AKTA 3EE6A 3CNQS 2IXTA 2Z58A 3Q40A 3VHQA 3TECE 1BJRE 1LW6E 4HVLA 1Y34E 1YJBA 5AVKA 3WIVA 4KB5A 1SCDA 4K8RB 5B1DA 1Y3FE 5JXHA 2W2PA 3DE3X 1IAVA 1KE1A 3DWEX 1SBNE 3LPAA 3D43A 1BH6A 2SBTA 4RYDA 4DJ5X 1C9MA 3VYVA 2Z56A 1SBIA 1TO2E 2HD4A 3SICE 3GT4A 2DQKA 4H6XA 1KDYA 4KPGA 1SUCA 1R64A 1AU9A 1SN7A 1TECE 2ZWOA 3AJ9A 4ZARA 2DP4E 1TK2A 2SICE 1OYOA 1Y9ZA 2Z2YA 1YJAA 1ZVKA 2Z2ZA 3LPCA 4LVOA 5AQEA 1Q5PA 1CNMA 1SCBA 3BX1A 3DE7X 3DVQX 1ST3A 5JXJA 1TM7E 2PWBA 4OV6B 1MEEA 2PKCA 1WMDA 1DUIA 1SIOA 2GKOA 1KDVA 2WV7A 1BE8A 2X8JB 4MZDA 3VV3A 5JMOA 1BFUA 2PWAA 2WWTA 3DW3X 3DDZX 1Y33E 2V8BA 1GTL1 1R6VA 1Y3DE 3SQOA 1S01A 1CSEE 2WUVA 3DVRX 4WOBA 1SBTA 3WIUA 1Y3BE 1GTJ1 2TECE 1GT91 1S2NA 2DUJA 3A3NA 4I0WB 2ID8A 3I2YX 1SH7A 2P4EA 1XF1A 4NE9A 1WMFA 4B5LA 1GCIA 3DE4X 3WHIA 2Z30A 3I34X 1SCAA 1C9JA 3QFHA 4WOCA 3T41A 3VSBA 3F7OA 3DW1X 1GA6A 1PEKE 1AVTA 1WMEA 3BGOS 1KE2A 3A3PA 2Z57A 5B1EA 1P7WA 1HT3A 1PJ8A 1A2QA 2X8JA 2XTJA 1SBCA 2XRMA 4H6WA 1Y48E 4M1ZA 1SPBS 1DBIA 1AV7A 3GCXA 2SECE 1SVNA 3PTLA 3DE2X 1GNVA 3GCWA 4FONA 5K7SA 1TM1E 2W2NA 1P8JA 2E1PA 5CW1A 2IY9A 1AK9A 4NMXB 1SUEA 1YJCA 2W2MA 1SUPA 1YU6A 2W2QA 1T1IA 3F7MA 2ID4A 3PRKE 3WQBA 2B6NA 2QTWB 4GI3A 3VTAA 3DE1X 1Y1KE 1T1EA 1C9NA 2SNIE 1EGQA 1GA1A 1SBHA 2ST1A 3L1KA 1NDQA 4H6VA 5ARCA 1P7VA 1Y4AE 1V5IA 3F49S 3DE0X 5ARDA 5SICE 4CFZA 3HJRA 4C3UA 1AH2A 5AVJA 1TO1E 4YN3A 2PMWB 3I37X 1WSDA 1Y4DE 3ZXYA 4DWWA 4OMCA 3QTLA 4ZOQI 3DVSX 1T1GA 1AF4A 1SELA 4C3VA 5JXGA 1TM5E 2WUWE 2ZWPA 1Y3CE 2ZRQA 1PFGA 1SCJA 2W2OA 1R0RE 3VV2A 2PYZA 1UBNA 3DE5X 4CFYA 1V6CA 2Z2XA 3AJ8A 2HPZA 1PTKA 1NDUA 1ZVJA 1SIUA 1OT5A 3CO0S 4KG7A 5JXIA 1BE6A 4LVNA 5FFNA 3QMPA 2PRKA 3EIFA 3LXUX 1TM4E 2G4VA 1GA4A 3UNXA 4DZTA 1EA7A 1SIBE 1BFKA 1SUAA 3H42B 4HX2A 5FAXA 3A3OA 5I9SA 1KDZA 5ARBA 4AKSA 1VSBA 3I30X 2PQ2A 3DYBA 3EDYA 1WVMA 3DE6X 1NLUA 3TI9A 3D9QX 3ZXXA 1C3LA 1OYVA 3AFGA 1S02A 1TMGE 1AQNA 1IC6A 1TM3E 5AMXA 3GT3A 4BWGA 1SCNE 1SUBA 4JP8A 4Z2AA 3P5BA 3LPDA 1MPTA 1THMA 1ST2A 1SUDA 3Q5GA
chains in the Genus database with same CATH superfamily
4MJ3A 4LMBA 4P7JA 3RAFC 1U3FA 2QVZX 2NYVA 3DUWA 5AP9A 5JU6A 1KAEA 5CLQA 3KJHA 3LUFA 4GVPA 3K32A 4P36A 2G25A 3AJRA 5CJ2A 3VA7A 2CXNA 4ZQBA 1V41E 3EXG2 3B1JA 1K2VN 3C3JA 1N5DA 2EYQA 1TIBA 3OCCA 3D4OA 3VVCA 4MVJD 4D9CA 1FB5A 2EDCA 3DF9A 1MQAA 1PWEA 1UJ2A 4U7TB 3GAAA 3KPYA 4FZ3A 3U4AA 3UCEA 5HUQA 1QBGA 2P6UA 3OTWA 4NNPA 4UARA 5DP2A 4N9QA 3DPUA 1NYQA 4PSVA 1VE1A 1V7ZA 2VJBA 5IBRA 2H0RA 1CPYA 1VSTA 3PGVA 4O4IB 4CMGA 4IQGA 4R6XA 4LQDA 2OO3A 3EPJA 2Z4RA 2CXHA 2XMCA 4IFIA 5IF3A 3ZI0A 3O8CA 4HGYA 1DTWB 4FHDA 1KHHA 1Y6QA 5B6PA 2XQGA 4OATA 7ABPA 4HRAA 1ORDA 4NJOA 2QL6A 1ZN2A 2TECE 2YN4A 2XMPA 5C8YF 2A9RA 4UCXA 3OURA 5I4KA 5TVGA 4OY3A 3V8VA 4DDVA 3C97A 4YGYA 3RVRA 3OHSX 1XCMA 1N7HA 3PX2A 4UREA 4M88A 3J81A 3OX1A 4E21A 3G59A 3GG2A 3D6TB 4Q9HA 4EFNA 1I3MA 4FYHA 3VAZA 4OOEA 1MN6A 4RJTA 1Y48E 2ZTVA 2IUEA 2R8OA 3I92A 4BPRA 3NBFA 1I0IA 4V0NA 3A1EA 4I1SA 3PCTA 1PWHA 1FMLA 4GPIB 4DARA 4DHEA 1Z5OA 4MQ6A 1M67A 1UBTS 5ALWA 2BFEA 5KX5A 1KSJA 3ONFA 2A58A 4JGBA 3EQ9A 1IN4A 3DL0A 4A8JA 1L9KA 1K6MA 3L6BA 2ZRMA 2QEQA 4MVXA 2WWVD 4RA9A 2CXSA 4EHBA 4AN0A 2JLBA 4IJKA 4JAVC 3M6VA 3QLJA 3MT9A 1WUYA 3W9UA 1XDDA 3MSXA 1HUQA 3OUTA 3EEQA 5IEBA 3UHFA 3ERCA 3ZHYA 2EZ4A 4KDEA 1GSIA 4MVJM 4PGMA 4YMUA 1F14A 2GTIA 1FDOA 1OT3A 4WIAA 4RZXA 1NW9B 4MIEA 4DJEC 3O8RA 4F3NA 2DTXA 1ZGZA 3DGFC 1T9KA 4B6GA 5FOVA 1ZD2P 1IOWA 4OHVA 2VTBB 1M7HA 1BYUA 1DWQA 3JW8A 5GJWC 1JDBB 1EEXB 1DRVA 1PF7E 3I3SR 3N5KA 2UUOA 3GV0A 4MIKA 3UAWA 1XCGB 1YUBA 4B47A 4V2UA 4OQQA 5JS6A 3T3HA 4B3SB 1K8RA 4B3HA 3F71A 3TRDA 3OX3A 2QDXA 2VQSA 4JLOA 3CVWA 1ABEA 3H0CA 2FUNB 2C82A 4JBGA 4D80A 2A5LA 2HFJA 5A7GA 1AHPA 2R8YA 2D13A 3ZWXA 3HN7A 4D41A 1ZVQA 1H8ED 1YS1X 3PZBA 3FFXA 3KT6A 4TZKA 1T26A 3CR7A 4G3XA 4XOUA 3K0FB 3EIEA 2P2DA 3CNEA 2PIAA 1W2WB 4KR3A 1FJGB 4R1PA 2HK8A 3ZXIA 4K86A 3RYHB 2IYWA 3FDZB 3CT4A 2O8BA 4INOA 2B1JA 1D2GA 2NZ2A 4A91A 1PJAA 1EVEA 4AD8A 3BD9A 1VRWA 2XMSA 3RKSA 4ENTA 1DC3A 1ZU5A 4FJ2A 4JT2A 3K71B 1JJ7A 5KYWA 4W5TA 3OUUA 3GVHA 3UMYA 5HFNA 1QZUA 1XVTA 3JQ7B 5TPWA 4G85A 3N53A 1D07A 1F51E 1CY0A 1XTZA 3IV7A 4TT3A 3NV7A 5DTEA 2OGZA 1DB3A 3DR3A 3G3EA 4HK4A 1RPJA 1VCHA 4KLZA 4D6PA 5KTRA 3D5TA 5JSKA 1FP1D 4NCXA 3T5TA 1J56A 4BKUA 4M86A 3C5CA 4NJMA 1YZGA 2ERYA 4V3CA 3FNHA 1TTPB 4JBXA 1ZXBA 2DFDA 4JLJA 3UJ8A 1WMDA 2W6ID 2ZRFA 3DLIA 4Y9SA 1YACA 821PA 2V4MA 4W8OA 4UMEA 4ZQCB 3QUQA 3HJNA 3Q3IA 4C0HA 1TVEA 3NBZC 3ZJTA 1G8FA 1WXQA 4YAUA 3K9LA 2P69A 5GM2A 2PUCA 3VOAA 1WZNA 2H65A 3MB8A 4PYJA 1KYWA 4B3RB 1YRBA 3TNYA 3DSRA 4GOKA 5AK6A 2NUAA 3P2IA 1M6YA 1XROA 2CHFA 2PGIA 3DLPX 3PG5A 5ILQA 1QGOA 4TS1A 3F1KA 1J2TA 3I34X 3QPVA 4F5YA 3QVTA 1WETA 1G8AA 3GRKA 5LKRA 1CUXA 3QPUA 3DKRA 2AMJA 1W0KA 4YRBA 3BERA 1FXWA 4Q12A 1E4VA 3KR9A 3VZPA 2IYXA 1J2YA 1PFWA 1MOQA 1J9ZA 3LT4A 3PITA 1O95C 1YIDA 1LI7A 3GT7A 3HBNA 5IT5A 1LWOA 3PNKA 3GDWA 4QA9A 4TTIA 3W04A 1NLYA 2AUNA 3RAEC 2BUBA 1Z25A 2BFFA 3I76A 1N57A 3IV9A 4NICA 1WXHA 1H0KA 4OQZA 4ZOLB 3NFYA 1L5HA 1CDDA 1T9CA 1XLTC 2JRCA 4MVWA 2J5KA 3ZZ1A 3ET4A 1U4NA 4TRMA 3DKVA 4WW0A 2YV5A 2I2WA 3WL5A 4S2EA 1V71A 1BXRB 1Z36A 2IE8A 2JDIA 3B1FA 3TL6A 1Y1LA 4MW7A 2OTCA 5AIAA 4A8JC 1KOLA 3HM2A 5EPUA 1DVRA 2QM8A 3I42A 1M3SA 1LLDA 2AOTA 2CBXA 3O82A 2VHCA 2AXEA 3DVSX 4UBNA 2RHTA 2O14A 4IIVA 2RGRA 4R2KA 4J16A 5EKUA 4AY3A 4N8EA 4HBZA 5DNCA 2PTGA 1RXSA 2PYZA 4MUAA 1Q1EA 5FV4A 4KPYA 2X2FA 5IDXA 1YVUA 1VKHA 3RRXA 4MRAA 2ODNA 4EYSA 1DQNA 3SXUA 1N6NA 4ND3A 1FYDA 5BXYA 5MGNA 4P82A 3ZLBA 1T5DX 2CF5A 3EVTA 4H08A 3UNXA 6ADHA 3AVWA 1Q1GA 3KYCA 4DDKA 1W36C 2HY7A 3FNGA 4FN5A 1DJNA 2OHVA 3DKPA 3UJPA 1KY4A 9LDBA 4KPUA 2VOJA 2YC2C 5ALQA 5EMNA 4OHZA 4E03A 3I01M 3K30A 5EGNA 3R3HA 4RK1A 4JOSA 4IJWA 4K03A 2Q3CA 3PHCA 3FDJA 4WGFA 4YRJA 3FYTA 3O94A 2QRZA 4JEHA 1JB9A 3R24A 4XWTA 5DRTA 3E4CA 3O2QB 1LC0A 3CJRA 3CWCA 5HM6A 3DVLA 4JT9A 4JT8A 4X63A 3FR8A 3RTDA 5BSVA 1CUEA 1F9AA 4D8XA 5BQ5A 4KLRA 3C5VA 1XZFA 1VSQA 1QQBA 4E15A 2ZI9A 5FO0A 3GRVA 3PFGA 2FK7A 3TDNA 4LRXA 2IEBA 1VJTA 3FCSB 2IV3A 4C4AA 1IVSA 2FE4A 4OGFA 2PZJA 2E1RA 2FP4A 1NZFA 2PRYA 4GKAA 3GLGB 4BJ3A 4XCQA 3T06B 3MNFA 3NEJA 3D8NA 1P33A 1KJNA 1LC3A 1OI2A 2AX4A 2Q3LA 3HVIA 1TTQB 4Q66C 3GZNA 3IUYA 1EVKA 5BV0A 3S7ZA 5B7NA 1UKCA 1QE0A 2Y9MB 1DWUA 2W0MA 4CIVA 4MI1A 1XRPA 2RCYA 4XYEA 4F56A 1SXJB 2VQ6A 5DB4A 3ZNOA 1YNOA 4B0PA 3OPNA 4LC1A 3KTAB 5CBPA 2WHPB 4HWGA 3ACDA 5CH5A 1NPDA 3FRJA 4N7MA 3H5IA 1Y3IA 1ZWKA 4URUR 4E51A 3ECSA 3OZBA 5DKFA 3LVRE 3U09A 4LNAA 3IR5A 1EWRA 5DGCA 3ZK7A 4YLYA 5FEMA 1INLA 1OHHA 3OAAD 1JMVA 5EKSA 1JHUA 3GLHB 1TJ4A 1MOSA 3GJ6A 4AXXA 2EOAA 2EEPA 3EFOB 1TZKA 2VXBA 1Z29A 2XB9A 3TVTA 2GRUA 2FEMA 3HBMA 1QRTA 1MX9A 2Z1DA 1UZNA 1ODSA 2GZSA 5DWQA 1HL3A 2C4KA 1Z13A 4N82A 4N3AA 4FT4A 2LKCA 4HWOA 3BKXA 1JGTA 1SXQA 3VHLB 4WLNA 4IG4A 3CGGA 4HDKB 1WS6A 3I3OA 2VWHA 4JV5B 2EX0A 4RENA 2SCUA 1SG0A 4NHEA 4CM4B 4CKWB 1FK8A 1TJNA 1KOJA 5KYYB 4DQDA 1YULA 2RGGA 2PX8A 2SKEA 2QY9A 4X20B 3DE1X 4PCUA 3A1SA 3D2AA 1I5OA 3UK6A 3T1TA 3IEKA 1YA4A 4NULA 3FHTA 1JIJA 4OQFA 5HSGA 1ZINA 2Z2JA 2QP4A 1UOPA 2XF2A 4RA6A 3TQIA 5KNLA 4K9LA 2QRPA 2VDOB 2H1FA 5DK6A 1Q22A 2ECPA 1PN3A 3MGAA 3VKUA 1ZVMA 5IP5A 1ECPA 2C97A 1B73A 1DEOA 1I3CA 1GRCA 1OROA 1VDMA 3IQWA 4OMUA 1U0HC 5HGJA 2C2WA 2GERA 4KUEA 2WWYA 3AHEA 4KVAA 5KVCA 2Q5CA 2B8TA 3DYVA 4L57A 4FC6A 2PUFA 2BKVA 2V0CA 3MFYA 4WY5A 5LZ2A 3C87A 3A14A 4N5DA 4Z49A 3B1VA 1HEUA 3DE6X 5DTJA 4CMEA 1T6XA 4Q01A 1HDGO 2AMFA 4Q4DA 1CR0A 3G02A 1OWOA 1L6RA 4TYYA 4ZCLA 1G8JA 1HL7A 2HSEA 5ALPA 3RYFB 3QPCA 3TZQA 2Q8NA 5FBVB 5K7SA 2I54A 4JP8A 1F3LA 3B48A 3N7TA 1RTTA 1G8YA 1Z8NA 4PZPA 2PUEA 1D1QA 4M8NE 4IP0A 1GGNA 3FIJA 4MB2A 4Q3NA 3S28A 3V1LA 1DBQA 1X87A 3KKKA 4JX9A 5EE5B 2QLNA 2FTKE 4G0PA 1K7SN 1KZ1A 3DAYA 4LJ8A 4NBLA 4IIXA 4R1TA 1PGNA 4G1CA 4LRWA 4CFSA 2XUAA 3IE1A 5LA6F 4HS9A 1DG9A 5BSEA 1QHHB 1W59A 3ZD9A 5KZMB 2VRCA 1WTCA 2XYHA 4EPXA 2H7VA 2IHVA 3VZDA 5DT9A 3F46A 2P2ZA 3HBFA 4AP5A 2ZWOA 2IWRA 1ZGBA 3R6GA 2PLRA 4UBMA 4LA4A 2JIOA 1MW9X 1W25A 2BDTA 5KOYA 1OJ7A 1CQXA 5C8ZA 3VUFA 4TYNA 4HTFB 4O4LF 4QOSA 4QYIB 2APJA 2FJ0A 1NFQA 2GCOA 2H1OA 2GKSA 3N2KB 3PB3A 4PSUA 1R88A 2DCUA 2GF2A 5D1HA 3IT3A 4DC1A 3COVA 4R69A 1P3JA 5KYVA 4B71A 4C0KA 1B6SA 4C2TA 3BMOA 1KTIA 1L4EA 1E2DA 1NVAA 5FO1A 3TRKA 1NX6A 3HPQA 1PSWA 3AOEC 4IDAA 5FOSA 1HNXB 3E7XA 4JI8B 4D4MA 5G4LA 1JH8A 4EW1A 2Q4OA 5JW6A 1OQAA 3TSOA 3MELA 5AOBA 2RBEA 4Q6WA 8ABPA 4NEHB 1OB2A 4IWYA 4KOAA 5K2MA 4CBVA 2FAXA 3WOVA 3VQTA 2XB4A 3A2KA 4I9GA 1ZNZA 5IC4A 4E70A 3OLVA 4EPRA 4U3JB 2C78A 3AHHA 2BMVA 4XGIA 5FBWB 3W8DA 2EIHA 2MSKA 4QL3A 5C7OO 3NC4A 1PNTA 1RWMA 2D74A 2FPUA 2A92A 3PQEA 1X0XA 5JJKA 2EQAA 4WCFA 3H9GA 4WX2B 5TIIA 3UHAA 5FUXA 2IEGA 4EITA 1WXWA 1XK7A 3OOHA 4JBNA 4AP9A 1FMTA 3NB0A 5GIOE 1P4JA 5IMBA 4ZQEA 4FGUA 4DPMA 2EP8A 3HN2A 1I51A 2QYSA 3ZU2A 3KCNA 5JECA 3B9QA 4QEZA 5AM2A 3RVBA 1F2DA 1SOMA 2P8JA 2VHQA 1E1RD 3UMSA 4B2IA 2P7IA 5DM2A 4YY3B 4BTEA 4WEOA 1G1MA 2F90A 3JD3A 2GD2A 4ZDWA 3CZQA 1ZI6A 4WK2B 3C6BA 4BX8A 3GAFA 5ADVA 2I4TA 4H4DA 1EGAA 4E08A 3AHIA 3LQKA 5JADA 3AF5A 5JD3A 3F2VA 4FHEA 1YOVA 3NBUA 4P33A 1JWLA 3A1CA 3ASYA 3W3AH 3LI2A 1P5HA 4KNYA 2WIBA 1SVOA 1NVVQ 2HFKA 4PQRA 2X19A 3OZUA 1J0AA 3A7DA 1DIHA 1RJFA 3H5OA 4D6YA 1E58A 2ZRDA 5CLLA 2EKBA 5INTA 2R2AA 3H9JA 3TW4A 1JHDA 2DWQA 3RTGA 4LXTA 4QEKA 5A5DA 4UAVA 2WIDA 1H94A 3MAGA 1T5HX 1T9AA 1VYTA 1Y7TA 2QZJA 3G5LA 4ZKDA 2L0XA 3VKWA 2VDMB 4OK6A 2WB2A 1ST2A 1X7HA 2ONZA 1OPRA 5B7QA 4EEZA 3LRPA 1N2CE 2GLXA 5KTKA 2NSLA 2ZT6A 5KSPA 2P9CA 2OLEA 3I5AA 1RXYA 4URHA 5F64A 2MU1A 5HJ2A 4N41A 3DCNA 3NT4A 3ZQ4A 4GPAA 2IBMA 3AF2A 4TKVB 2HU7A 2R7MA 5EWLB 2I6FA 2H0AA 4JODA 1W35A 1KI9A 1A96A 1HV8A 1Z0SA 3AERB 5EE0A 3KAQA 4B4DA 4NEGA 4B43A 3ZJ4A 2E89A 3OSUA 4EIWA 1CRLA 4EMSA 3P7MA 2A0UA 1P2VA 4R83A 1Z74A 4M4SA 4RESA 4YVFA 3SYKA 3TLCA 1VXOA 2YFHA 1LDGA 2OHOA 3P4UA 2YYZA 4YECA 2SKCA 1ONSA 1NNI1 3LRTA 1KMHB 2UVPA 2W6JA 1BFDA 5AR1A 5T6MA 2HSJA 3SFTA 1YVDA 1ST3A 1CY2A 2VC2B 4UHHA 4X44A 3JQCA 4R2XA 3ZBQA 2JPDA 2FW8A 1TKRA 5AVYA 3AXTA 4WXHA 1X7XB 3VUEA 4Y6SA 3WR5A 4JJIA 3HRHA 1KKMA 1DO0A 3KEGA 3MK31 5DJ5A 3UHPA 4OQLA 3D8BA 1XTBA 4GP7A 5DGDA 3KOXA 4RORA 2A67A 4AF8A 3ICCA 1Z4OA 1ZN8A 2IEDA 1SA0B 2Q28A 2V7TA 2YWJA 4HX9A 4K9SA 1NLMA 1YDFA 4Y1RB 3G9QA 2EL7A 2RHDA 1TUIA 4AJ2A 3HXMA 4CMHA 1BKDR 3DHYA 1TT5B 4CEHA 1I33A 1E3SA 1I4LD 2RHGB 3UFXA 2BKXA 5THQA 2Q1SA 3MJSA 1PEKE 4PZUA 2ZLBA 4DSNA 4DQLA 4YEDA 1FOEB 4MQ5A 4TLDA 2D1YA 1SVLA 2WF8A 5DGXA 5C7YA 1WQ3A 4IKPA 3ZBUA 3GJZA 1QG6A 2SECE 4DQUA 2JFOA 1L1RA 2KJQA 1PYGA 3K2QA 1SEPA 1H65A 5JNLA 3U7GA 4IICA 4Y1FA 4F2DA 2C3PA 5JNWA 4U63A 2FN8A 3E7WA 5LQUA 4UE6A 3QK7A 1L8QA 4OSOA 4GI3A 3OO0A 1YB6A 2CLEB 4YRRA 5KJ1A 1MVNA 1Q16A 3EZ9A 3I9V6 5C8YA 2ZETA 3PICA 5J2UB 5IJ9A 2QNRA 3ETDA 5K0EA 3KPWA 3CO5A 4B75A 4JL5A 4RD0A 3SJZA 4HB4A 1Z2NX 2AWOA 4RVDA 1IHUA 5DHAA 4GYJA 2W37A 1JHPA 1QDEA 4BWYA 4C1BA 1C7RA 1CDZA 1ECFA 2XF8A 3WI7A 4DLSA 4Y2UA 4IKOA 4AN1A 4CCYA 1UAGA 2IU6A 4RNDB 1ITZA 2EJBA 1O94D 1RI1A 1LBTA 3NDRA 2HPZA 4EJMA 2PMCA 4KXLA 5AW3A 1SU6A 3U62A 3HS3A 4NBUA 4GM0A 3M8KA 3X2SA 2A0FA 3B9RA 4C4TA 1QGED 1F17A 4WN9B 1TD9A 2QD4A 3K9CA 5LWQA 3PD1A 4HX2A 2XRYA 1T5IA 4PYOA 1ULUA 1PR6A 3P5SA 4Q9DA 2P0YA 3A32A 1V4BA 1OCEA 3I9FA 2XOKD 4UTZA 3LNCA 5L40A 3LO5A 1GEGA 2AC2A 3ETNA 3MIZA 3UAGA 5FWYB 4PGHA 3K4QA 3T54A 1GAQA 2YJNA 2IXDA 4DBVO 1Z4PX 3QPDA 3R76A 1A9RA 4IQ8A 5L3RA 1GSAA 2ICAA 4JXXA 2WSBA 3QVGB 2DBRA 1NQVA 2FPKA 4ZANA 3WQHA 1S9DA 3UWSA 1J49A 1NOJA 3PEYA 1NRXA 1NGSA 1QWSA 3PR2B 1GPWB 4LXQA 5BW8A 1RRFA 4ITVA 5K0GA 2Q6OA 5EA2A 5H3LA 5K8LA 2FWBA 1HQKA 2M98A 3EN0A 4Q39A 3LUGA 5E3HA 3GEGA 3G7NA 1AS3A 4YRMA 2BW0A 1JG3A 4YYZA 5B1HA 1JEQA 3DLHA 3T5PA 1GZHB 2Q7OE 3U48A 3LUPA 1KH2A 2DX7A 1AGYA 2WFLA 3LCMA 2A2ZA 3LHKA 3PUWA 1T2FA 3HL0A 2UV8A 4ZVPA 2VI5A 4RD1A 5EI5A 4E5KA 5AJTA 3GEMA 1VLLA 3GAZA 1XDUA 2WTUA 1FNMA 4LDQA 3RUFA 4UHDA 1FTQA 3HWWA 3B13B 2E5FA 4LY6A 1F7VA 2AG0A 4UPEA 1SFRA 5EJ9A 4QJ5A 3C3CA 4HEA1 5JPCA 2JI7A 1R8SA 1RJ9A 5SYAA 2GKOA 1K6JA 3M5DA 4TYWA 4NAHA 1AHHA 2Q2WA 3DEJA 1L1QA 2EBUA 4XXHA 3X2FA 5I7RA 2I55A 1FP4A 1EX7A 1TCCA 2YWEA 3N9IA 2V58A 3EOZA 1I4OA 2JLXA 4TX1A 4K9MA 5J4KA 3F3YA 3T1QA 4I0WB 3FGOA 2P5YA 4RAOA 2VNAA 2IYVA 2MSNA 3ITKA 2J7PA 5K6RA 4L6IA 4I3FA 4DM4A 4J4TA 4M49A 2AEJA 1USKA 1A9ZA 3LHSA 1IN8A 1MP0A 1T35A 2EV9A 4DQVA 4ERNA 4PGFA 2Q6LA 3JAKB 4BVGA 1IM8A 2JCSA 4MYDA 2QB5A 3GA0A 2PKYX 4G97A 5IZCC 2X23A 4L5CA 5AT1A 3U4IA 2OFFA 1CVRA 2ZJFA 1FE8A 4PO3X 5I9TA 1AX9A 2QMOA 5JASA 3E7PA 4OHWA 5FORA 4IRXA 4YRKA 4TV9F 2ATVA 3O5AA 2O2HA 5ARCA 4MIOA 4CIXA 1V3QE 2NADA 2LR0A 5DO9A 5G1NA 4U7WA 2AVDA 2PVPA 2WINI 5JAQA 5TQVA 4C3UA 3KWJA 3LBHA 4BEVA 3P0IA 1ULBA 1RCTE 4IGAA 3JXEA 121PA 1K5HA 4X5OA 4X64B 1TIKA 1TQ6A 2YJTD 3BTOA 1H2AS 2YHBA 3I4CA 3NQ41 4LQ4A 4FOPA 3N2ZB 1OJLA 1Y6RA 4HNQA 1UBSB 4A0FA 4HVTA 2AEMA 2AFIB 3EEIA 3WB1A 1K3UB 4DMGA 4ER3A 1KBQA 4YDSA 2J0SA 2O1XA 2ZSEA 4MEBA 3F67A 1TEXA 2C2KA 1K27A 1XZIA 2LD4A 3NYWA 4R1SA 3GEPA 4RQTA 4O0MA 4RTQA 2Q4BA 3U7IA 4KRYA 4G1FA 2UDPA 4NF2A 3HJBA 1E1QA 3EXFA 1PEAA 3D6VA 2FDCA 2ZJOA 1JBQA 2WG2A 4QARA 2J08A 2GM5A 4N4AA 2OECA 4ZOBA 3VR0A 2K6GA 4TLLB 4XWAA 1WKCA 3H5RA 1IVNA 2CCJA 2PVSA 2QAGC 3NIDB 5AVTA 1M8FA 4D44A 3KJIA 1DUSA 3CINA 1YL6A 3IKLA 5K0BA 2P79A 4L22A 3NHPA 1KYYA 2Q6IA 3PFKA 5JH7B 2D3TA 2IYFA 4NBRA 3UPTA 5A2GA 3KBBA 3QPBA 5LXTA 1I0ZA 2DJ5A 1XZAA 3P0EA 3ZDFA 1ZUNB 3TJRA 4F11A 3DEZA 5EESA 1KZGB 2BBWA 3TOXA 1SO8A 4RYDA 2YVKA 5AWFC 1Z0FA 1CT9A 1UDRA 4G81A 1CC1S 4F5WA 4ZYUA 9MHTA 2EP5A 3H3JA 4PM4A 4DANA 1AURA 4IDDA 1QWOA 3I2GA 2CFSA 2B4TO 4O5AA 3S3TA 5L4NA 3ICVA 1B76A 3QU2A 2QE7A 2EX4A 3AP1A 4AMZA 1J8FA 4RS4A 2ZYVX 3Q7TA 4BJHB 1Z2EA 2RE8A 3P97A 3DTVB 3V4FA 1WSAA 1A98A 1JSXA 4LVUA 4HQKA 3DLBA 3RGWS 3HA3A 3SKXA 1Y4UA 4BRSA 1U9JA 1KA9H 3R5XA 1T9ZA 1XF9A 3I39X 3CX4A 2C5HA 4GM4A 4MB6A 1EBUA 4OQ4A 3GLGA 1O1YA 2VJMB 4KXMA 4RH3A 2QNIA 5FTMA 4WZAB 3I5YA 3BK1A 3FMFA 4BNDB 2CJXA 2V55B 4OPMA 4C6HA 2V5UA 3PHBE 4UMFA 3S1LA 2G9VA 5JAPA 3NP7A 3HEBA 5K3FA 3TD6A 4BBZA 1W85A 4Q1DA 4P0TA 4OK3A 1ONNA 5JRJA 3S55A 2E87A 5KOIA 3H1GA 3GMSA 3WRVA 3W8NA 3HQ4O 2FFAA 3EG5A 3EARA 1KAQA 4Y6QA 3TE6A 4MWCA 2RHMA 3NJ4A 5ABPA 2QTWB 4ZT2A 1S3IA 3T15A 5HHTA 1MJ5A 4JJ7A 3RFVA 4TTTS 4MYCA 1M76A 3VR5D 4IS2A 2VT7A 3IDAA 3O84A 3ONWA 1RI5A 2JFWA 3I9V1 4RDHA 3KQVA 3BORA 4ZEMA 3PD7A 2H3HA 2PFGA 2YJZA 2FPPB 4F3CA 1OBHA 1QVVA 4X65B 1QF6A 3ZZTA 5FKJA 2O23A 1N4AA 3FOWA 1D4FA 5LUAA 3ITNA 3CRQA 4K6CA 3MD0A 2XCRB 4EAQA 2F6RA 5CB4B 4HDSB 3A6ZA 4BRUA 3GDOA 1U9CA 3IP6A 3LBFA 4UD6A 2HJGA 2R00A 2YHIB 4KXXA 3KQYA 1RP1A 1C7QA 2C1ZA 4R0VA 1EDEA 4H1HA 2QN2A 3UJ3X 5DHTA 4E5SA 3COJA 3PC8A 4NAVA 5FAXA 5ESXA 1U1DA 2Q6TA 1T1SA 3UHOA 2K7FA 1BRTA 4GX1A 4RA6B 3MWDB 1T8WA 3GLQA 5HIIA 5K51A 2NU7B 2V97A 4ZOAA 4V0OA 2FVXA 2P77A 4GZLA 3KQNA 2Z9BA 4BNIA 2CVPA 2FSIA 4BO2A 1YZYA 2CSXA 2VNHA 3SX2A 1AK2A 1VI5A 4EJ0A 1Z35A 3TSWA 4B3DA 4M8LA 3K6SB 2VDLB 4UBIA 3EXHB 3WNDA 1J8MF 3O0TA 1QC5B 3I83A 5ERXA 3X44A 4R1NA 2YZGA 2X4IA 1GG5A 2VDQB 3FLMA 3RFTA 3K8YA 3WBKA 2QD5A 1C80A 1XCBA 2QENA 1P1HA 3EULA 5G0TA 3HYLA 3VHQA 4BUJA 4C07A 4YIHA 1G5TA 2ZDQA 2QP9X 3CZ4A 2CDRA 3WIOA 1QZZA 1FS5A 2WUEA 1DC5A 2R6HA 4W1PA 3GY0A 4N0PA 1PLLA 5KTMA 5EPOA 5I5GA 1VSUA 2RHRA 1DBWA 4FK8A 4EG5A 3UMFA 3O0DA 4V0MA 2HMTA 4KFCA 5FUYA 3E2IA 3HR7A 4RFVA 5DBGA 3QELA 4Y2RA 4HH4A 3RC2A 4UUQA 4LSGA 5E4JA 1JVSA 3G8CA 5BN4B 4E5MA 5KVVA 1LWNA 2DE0X 5TNXA 3PTZA 4B34A 5ICGA 1U2TA 2GPTA 3OP1A 3KUDA 2F7SA 2PWAA 2CXPA 2BSXA 4RH0A 1NBMD 4X3OA 4FBGA 2HO4A 1ORIA 2L69A 3ONVA 1NM5A 4OJNA 1MB3A 1LRLA 3SDZA 2IK8A 4MWSA 1GQRA 2HK6A 3BHMA 2B21A 3H4VA 5LXTF 3INRA 2EWMA 4Q1VA 4ZOCA 2REOA 3UH1A 1QCDA 1Z9BA 1TM2A 4ZVKA 4ZHQA 1VPWA 2XOKA 2Y77A 2HRCA 1NXOA 2QTTA 4YFVA 5EXXA 2PXXA 4QAJA 1KEPA 5L3ZA 4YR9A 4DCTA 1NKSA 2R97A 2W6PA 4MV6A 2HTEA 1IWPB 4PVDA 4DDUA 2TMKA 3HMQA 4IUCS 5AKGA 2HNKA 4L7QA 3FSJX 1DTWA 4UATA 1YRQA 4HNGA 2CFCA 2GBCA 2NU6A 5JIBA 1DDGA 3IAM1 3OF5A 1DE0A 4ZI5A 1ZK2A 5HOEA 5CA1A 1YQUA 4PSDA 3T8YA 4WN3A 5ADUS 4LGYA 3EW9A 1CW2B 4U5QA 1G7CA 3WMEA 3E1KA 1UJCA 3M6UA 5AKIA 1DAEA 2G67A 1NF3A 1A2KC 2ZR9A 3CB4A 3FI9A 3GJ5A 1EE2A 3GLSA 4ZODA 4NS4A 1QYDA 3IAXA 2XNSA 1N3IA 2Q5QA 1KSHA 2CD9A 2XMDA 3NFRA 4RV9A 3T7TA 1JDBC 1SG9A 4BS9A 4DV7B 4V1CI 3THSA 2OM2A 2C4WA 3AEQA 4FQ5A 3GG9A 1M5TA 3RD5A 5CFMA 3P2JA 4XW2A 3RSZA 2M2IA 4UM5A 3N6XA 4ER7A 5FWXB 2CLLB 3W90A 1MHPA 1UBEA 4M6WB 1H66A 3F9IA 2G4VA 2XJ4A 4F72A 3F3KA 3U7JA 3O8BA 4GGOA 4BX2A 4DR3B 3RUDA 1CWUA 3ON5A 3L1HA 4J07A 4RETA 3TB4A 3TK1A 1JFLA 3L0OA 3MWEA 4KE6A 1IPEA 1OXVA 5JALA 2O2ZA 3ESYA 5DHFA 4AY6A 2EW8A 1LPAB 4R3WA 4PNPA 2JGMA 5C8XA 1GAXA 4IDGA 1GPH1 2A8YA 3BFJA 1S02A 1DFGA 3BRWA 1TM3E 3EMBA 1U1GA 2FSVC 2W98A 4M7PA 3MWGA 3G5AA 1TYBE 4HWKA 3ZNQA 2ZCUA 1NT4A 1Z38A 1HYEA 3D3WB 3QKSB 4KC0A 2CXUA 4L7VA 5JCZA 3ASUA 2ZS7A 4YAWA 1BDHA 4DEYA 5GP1A 1WF3A 1OFVA 2O7RA 3DAOA 3KHTA 1P77A 3QBTA 2CK3D 1JFRA 4HJXA 1E6KA 2WAAA 2VDWB 4IVQA 4MA4A 3WGOA 2CLOB 3EHDA 2ES4A 3TD2A 2GS9A 3ROFA 3B9BA 5TS3A 4K9QA 1EIZA 3ZIDA 5IYZF 2J9RA 1AQJA 5F3DA 4CMAA 5A3RA 4R9RA 5C37A 1J8DA 2P4SA 2ZIFA 4YQFA 2AEEA 4Y7DA 1K3FA 1SKMA 2EWVA 1UFRA 2XNDA 3LW8A 4QPNA 3T0IA 4CT5A 2OD9A 4WFIA 1LX6A 4H15A 2O2GA 3WDKA 4AG3A 3DMPA 3R9WA 1M1NB 5F2OA 1YJAA 1PGJA 1W1IA 5FADA 4D6XA 4WBNA 5CITA 1WXXA 3WYDA 5DI3B 2NZJA 2EEZA 3HLYA 2CLKB 3C1AA 3K2BA 3PXXA 1C2TA 4ZKEA 4BWFB 1JU9A 1DCTA 1GDTA 2BKUA 3DXFA 2QUKA 1Q7TA 3PYMA 1FJ2A 3H2IA 4FNMA 4N54A 2WWTA 4TN1A 5DSXA 5L95A 1Z62A 4BQSA 3JQ7A 1UPAA 1E6CA 2P6MA 3FIUA 4TM8A 5G2OA 4D4KA 4QRHA 1I4DD 5B5SA 1KEEA 3U44B 4RKQA 5JD5A 2PSHA 3N75A 4OTZA 5JY6A 2RJ3A 1NUHA 4ZCQA 4BNGA 1TQDA 2GPNA 3DDNA 2I3BA 3ZJVA 3QLUC 2H8GA 1JSCA 2ZJ7A 4LJYA 3N8GA 3SYNA 1OPXA 5LBTA 4M0KA 3GLRA 4GRAA 5L7YA 1QLHA 1NJ5A 1KTVA 5ITVA 2AOXA 4ZO7A 2L17A 4Q4CA 1GNTA 2GLTA 4OQDA 4YMTA 3EA5A 1SEVA 2VPTA 2WD8A 4Q34A 4JR2A 5IYZA 4GI1A 1W49A 3IKMB 2GETA 1G41A 3TQFA 5UKDA 2W2KA 1JDJA 5IPFA 3WLTA 1Y3HA 2I65A 5FI1B 3F74A 4RIFA 2NUPB 2PT5A 2RIPA 2ODWA 2NUAB 4D4JA 1P7PA 2AJ8A 2D0DA 3F0TA 1V47A 3ZCRA 2F67A 5BWBA 4HZUA 1UT6A 1U8EA 1NXPA 1ZVVA 1HH4A 1I3NA 2X77A 2VK4A 2A3RA 3HDJA 4BLSA 5ICEA 1G8KA 1KPIA 1KXJA 1VZ2A 2BGTA 1O6ZA 3GFRA 5JLAA 5IBCA 1JHXA 5LCXA 4E14A 2K2QB 2QX4A 2QRVB 4KAXA 3QQ5A 3RTBA 3MWYW 2IZ6A 4P32A 4A6XA 4CEIB 4Z4FA 5I7EA 1MH1A 4YJGB 4Y8VA 3VR4A 1SCJA 4RPIA 3ZI4A 2N1BA 2B82A 1KI6A 1PR2A 4HZIA 2H2WA 3EIUA 3N2YA 3ZYZA 3COZA 4K6OA 1FA9A 1FMFA 4BFSA 4POOA 2W5UA 1JFFA 1LLQA 4JB0A 1RU3A 4MW5A 3U56A 3ZE8A 4WL0A 5G41A 1FFGA 4CUZA 3L8HA 4UNSA 3PGJA 5EN4A 2W90A 5ALVA 5JNRA 4Z4IA 3UOGA 1ISHA 3PGMA 3PDUA 4WA8A 1AA6A 2PQ2A 5DASA 2A14A 1PFQA 3MERA 4RM2A 3D0RA 4A8HA 2O20A 5H16A 2X5XA 2WJGA 5U4QA 4B2LA 3O92A 4OLAA 4UAUA 3DD5A 4J0GA 4FFVA 4TYPA 2GD6A 4FC7A 1FDSA 4M8KA 1A4RA 3IUNA 3LX6A 1HDCA 5DX0A 3ZEIA 2DLNA 4GPEA 4D3FA 1YI1A 2DVMA 3IPCA 2QZPA 2R9VA 3TIFA 1JWAB 5BUCA 1E9FA 5HS6A 1HYQA 4MDYA 2ZU6A 1SQ6A 1NI3A 2QTAA 3F3MA 2K87A 1UDXA 5B4VA 5B1DA 3HXQA 5CXSA 1U28C 3GDGA 5B2FA 5IRCD 2EJCA 4XCXA 1LPPA 4JU8A 5BR1A 3A2NA 2QMUA 5EWMB 3PKJA 1LGYA 1G16A 3E8XA 3HFRA 4U0JA 4JI6B 3T4PA 3D8UA 4MCAA 1X0VA 1A2OA 2QM3A 3LPCA 4L50A 3CVUA 4S0XA 1SUSA 4HFRA 3W5AA 3AXSA 3OOEA 2M1ZA 1ACLA 4H7FA 4P8RA 3O26A 4BAGA 3AIIA 4NCHA 4W5WA 2BTOA 4Z0HO 3Q8XB 3S2IA 5JS1A 4P98A 2M6KA 1H2WA 2C61A 2RG7A 3DCJA 3ZV4A 3LY8A 1L5LA 4WXPA 3M33A 2CBGA 3DVRX 4M0EA 3RHTA 4UOEA 4YPVA 3ML1A 3NTQA 2IBSA 4BP3A 3TN7A 5LD2B 3WGUA 3RRYA 5F9HA 4PNHA 2A3NA 2NUBA 1P72A 4KQEA 4DAEA 3Q98A 3CZ5A 1ORHA 3DH0A 1K4YA 3DWGA 2GAAA 1P7WA 1GNLA 1HT3A 4QX6A 1ZDMA 4JN6B 1XU7A 3PYLA 5JTUA 4LY9A 4DR7B 1N6RA 3OX4A 2E4WA 3AJAA 2EKPA 1AN0A 3L43A 4RABA 1FP4B 3F9RA 2Y27A 2X0NA 1UZAA 3B2EA 5H0IA 4AJOA 3AHCA 4E1BA 1MB9A 3PFBA 3DCIA 2JD1A 3V8QA 4JXZA 4J0IA 3TSYA 3KZNA 1MO3A 1NVGA 2OR3A 3RS3A 1RPZA 2BM9A 1JPUA 1OV6A 3I8SA 4I5GA 4QQKA 4C3ZA 3VJRA 4LHXA 5DLDA 1YDHA 1B8UA 4XTRA 4B3BA 1W44A 2H3EA 4Y9TA 4G5RA 2E4XA 4F9GA 3AR4A 3I37X 3NHLA 3S81A 2Y1CA 3F5DA 5DNEA 4CT0A 4DMRA 3QJYA 3L7MA 3KC2A 1JL3A 4GO1A 4O63O 4RSGA 4GI2A 1XMVA 2IPLA 2P68A 3WWOA 2ZITA 2YKGA 5CUQA 2FN9A 2R8ZA 2VATA 3K0FA 4S1WA 1IZYA 5DN6A 2CFTA 5HFAA 3RVDA 4CKWA 1SXPA 4PYNA 2X5NA 3ZKWB 2IP1A 4KJXA 4LOIA 3RARA 3DLCA 1E32A 3BB1A 4WKCA 4LQLA 2J6HA 5CG2A 2DC1A 3WNCA 1ODTC 1Z88A 2Q6KA 2B5OA 2KSQA 4ODIA 4CUJA 3GK3A 4O33A 5C9ZA 2POQX 1CV2A 3GBSA 3N7AA 3DAHA 4RTRA 1COWA 4J0JA 4MMYB 4HGOA 1QGUB 2OWEA 3DZGA 4EKYA 3AUAA 1XRJA 3D6NB 2X3FA 2HDWA 4W63A 5C4IA 3FRHA 1ZSNA 3F97A 2I3DA 1BDBA 2DSTA 3NWJA 4XD7D 3WL6A 3ND5A 4J0HA 3FB4A 2FJUA 4AJHA 1KK3A 5D5QA 1KAOA 2IXTA 4QECA 1XD9A 3AM1A 3GJ0A 3PFHA 2G5CA 4EELA 1B42A 2VPPA 4QFCA 1SD1A 2H29A 5TV2A 4YJHB 5FI0B 3WXMA 4EX6A 2HI0A 1I9CA 5GWXA 1JQKA 4ZEVA 1LPNA 2X8LA 4FDLA 4JFAA 1YCHA 3ZJYA 3DBRB 2V7QA 3N05A 4AI6A 4QNRA 2W70A 3RI3A 5BWNA 1E1DA 5DTIA 1MJGA 2E21A 3PQ7A 1MKYA 4F4HA 4GI7A 2AIRA 4Q4JB 4WVFA 4Y0VA 3WGKA 4DW8A 3DMHA 1HDRA 1DELA 1Q1ZA 1NN1A 4OKIA 3E81A 1W4CA 5ANRB 4N6OA 1SRRA 5LMNB 1W1UA 1CNMA 2OQRA 2PRZA 1UDAA 2WJ3A 2ZAIA 4H7IA 4OXXA 4OV6B 5A5FA 3M7IA 3UJ7A 1GADO 3G8DA 3RRBA 3GAMA 2PMDA 1XG5A 3IVGA 2YTZA 3CW8X 4BX0A 5BSKA 4G5HA 5EZYA 3U16A 5GPBA 1GO2A 2FWRA 3AL3A 1XHEA 2XD9A 2GRJA 2IX3A 3G2HA 2V7VA 2Q9BA 3D0KA 1G2OA 4QYMA 3LM8A 1SQFA 4RMHA 3TQHA 1T0BA 2GN6A 2PKQO 4Y2GA 2FW7A 3OT1A 5D84A 2A9PA 1O96A 2I67A 3RS8A 1Z5VA 3TBKA 5TDHA 3S5UA 4LOLA 4DJTA 2JAWA 1QQ5A 4DLZA 1HM5A 1C0IA 5TEVA 4RTSA 3JQ6A 4UPVA 1I9GA 2ORWA 1D5CA 1ZM9A 4UXIA 4EY4A 2GPWA 1CU1A 1UODA 2OHGA 2CLIB 5JZSA 1ECJA 4RGQA 1P8JA 3BIOA 1QP0A 3BH7A 1JIQA 3U1BA 2GHTA 1DRKA 2GNPA 1N7JA 5EHNA 1V4VA 3ORHA 1YONA 3OZRA 3QJ5A 5CFQA 5JHGB 5H8WA 1O5TA 1DPGA 1JRLA 5E1OA 1EH5A 5JPIA 2NZXA 5KNCA 1JG6A 5ALGA 1G38A 1ZR2A 1DINA 1WUIS 1C8BA 3C3WA 5FPPA 5LWHA 5CTAA 3MCZA 2GB4A 3VVLA 2QQ5A 1F4PA 5EE1A 1M66A 1GQOA 3RHSA 3DNFA 4CIWA 3P9XA 3IMGA 3ND7A 2P90A 2VL7A 1C7IA 1GYRA 1KYZA 4KUHA 4HRYA 1ZMXA 1T4MA 2X9QA 1XZ8A 3OD5A 4QKQA 3Q1LA 4F9EA 1XRNA 1RLMA 4L8GA 1II9A 5E0OA 4WAUA 4LV8B 1XMJA 4EZBA 1CS0B 4ND7A 5JNTA 1EUQA 4TLEA 4Y6LA 1IMJA 3COPA 2I2XB 1HFKA 1X14A 2N46A 4P2GA 1MR3F 4JP2A 3VGJA 3RVPA 4YUZA 3Q8LA 1EX6A 1WIWA 3IUJA 3RSQA 1XKLA 4RF5A 4ENUA 2G07A 1BG6A 1KFJB 4MJLA 2OEPA 4I50A 2PXAA 5BSTA 4A3SA 1A7AA 4QBGB 1LF5A 4FKMA 4DMUB 5KNDD 1S8AA 1RQGA 1KY3A 2D2EA 4HH1A 2XX3A 5KHLB 2FGJA 3FTDA 3SHFA 3HU2A 3TAXA 3ZWYA 2ATCA 4FM9A 1TYDE 3PPXA 4CM9A 4DLXA 3OEYA 4EUKA 4ZZ3A 1N0VC 1K68A 2OXFA 4NMWA 3HU1A 3C6YA 521PA 2A5YB 2GVZC 2Q5HA 5CTJA 4TVSA 3RFXA 3ROKA 2O8EA 3A6EA 4ZYTA 4YACA 3LP8A 4IIUA 2XA2A 2WE7A 4GP9A 2G28A 4F12A 2XDWA 3OLCX 2Y9PB 3HPRA 4RY8A 4AIIA 1EXDA 2VHJA 2DCMA 1NXSA 1AA9A 2YDYA 5IN5A 3OQIA 3M49A 1DO2A 3AY7A 4EI7A 2OE2A 2WSMA 4H60A 4B6SA 4TMZA 2ZBEA 3FPJA 3UAYA 2RHLA 2CXRA 4IHJB 5EJ7A 2HC9A 4KIFA 1ADFA 4RD2A 4NIMA 1TKCA 1MNQA 3IA2A 4CF3A 3VH2A 4RTKA 4JQZA 4K9RA 3DOCA 3G0BA 1OZ0A 2FHSA 3EVAA 2M6RA 4BFUA 2PL1A 4L16A 4KH1A 5BVGB 3MPUA 4DQXA 3FPFA 1SIOA 3NTUA 4R6WA 1YZQA 2RC5A 3HCWA 1C3XA 3DZFA 3G0GA 1CIJA 2LP4Y 1J0CA 1YZFA 3A28A 3ZE6A 2HHAA 2ZQ5A 2JHCA 3KUCA 3D6AA 4HATA 2CUNA 2EG5A 3SBDA 2UVDA 5L3SB 3EZNA 1TGVA 4YR7A 3N58A 1IBKB 3BJRA 4U6SA 1P9RA 1VFNA 1BAPA 1XNHA 2ACVA 3LF1A 5D3KA 4G8BA 4CM4A 4DNXA 2YNMC 4XFKA 2JK0A 3LZCA 4D3XA 1PYDA 1X7DA 2COKA 2YQ4A 1XXLA 2A4MA 1OC2A 2PKXA 3NAZA 3O3MB 5C2JB 1IXKA 1NMEA 1WZCA 3ZY6A 4CM8A 1TL7C 1Z5ZA 4RZ2A 4YNBA 4ABYA 2BI4A 4N3BA 1FTGA 4C20A 3JARA 8ATCA 2BUAA 3TECE 1YT5A 3GGDA 2PM8A 3FOBA 3HCCA 2C8VA 5EXSA 5HBGA 2GF9A 4EHAA 1GZ3A 3HZZA 3FYUB 1KEUA 5BVHA 2RGNA 2LKDA 1QOPB 3EQ8A 4IXDA 1OTXA 1PX2A 2MHCA 3D0OA 4GUAA 4EB6A 3P9KA 3FPKA 2AKYA 1MO5A 5GM1A 2PA3A 2IEZA 3RIXA 4ENWA 1YFJA 1J24A 5EXTA 1UBUS 1L7NA 4UTRA 3EVFA 4CHGA 2V9PA 2NU6B 1JNYA 3I23A 4XEUA 3OWOA 1HSOA 1FU8A 3DDUA 4HEA6 3DE5X 4JITA 3QF7A 3ORFA 4EFKA 3HO1A 3F6SA 4BIMA 1QPZA 5DIZA 3CEAA 4N12A 3EQ2A 3TLXA 1KI7A 1R6AA 3VAYA 3FCEA 4BGEA 3GCGA 5C8YB 1SR8A 3KL2A 4B3FX 1J22A 1AUVA 1FNBA 3KLOA 3KT8A 1EI9A 4G0NA 2C98A 4G4SP 5F2EA 4DIOA 2NSYA 5KOHA 1K9SA 3QF4A 3B89A 5DWVA 4XR9A 5FUMA 1Z0AA 4KRGA 2A9VA 3IVXA 3PZRA 4MW9A 4QYTA 3R7SA 3NANA 3QFCA 4J0CA 4Y18A 3LUBA 3BFVA 1TMGE 2EDAA 3CJQA 4IEEA 1N2BA 5AMXA 3PQ4A 4GGPA 2Q5EA 2P9HA 3HO6A 1O77A 4U7FA 5E0KB 3I4FA 1USVA 4JUIA 4WOJA 4G09A 4IFBA 4YUAA 4J94A 3DBLA 4UASA 2VYFA 3ILXA 4DSZA 1QXSA 1YSCA 2EFHB 4OA8A 5ESRA 2AUTA 1RE0A 3WSVA 2QYTA 3WXBA 2HSZA 1IBLB 1KFCB 2GK3A 4FCWA 4ERXA 1NXVA 5DHSA 1XXHE 1YFZA 2R8BA 3GP8A 1V9CA 1OA1A 2QN1A 3F5MA 3MXTA 4NV0A 3IQZA 2AJCA 5EMLA 2XKJE 5BN5B 2I71A 3HJCA 1H4QA 4PR3A 3SN6A 2BE9A 1JF8A 5JS7A 2DF8A 2AZXA 1C7ZA 1PD0A 1VYUA 2DP4E 2WD9A 2E4VA 1K3TA 1IAQA 3JYNA 3NBMA 5F5NA 5A4AA 3VR5H 4G4JA 4X7BA 3TNDA 3R6WA 3W9YA 1DUIA 3UZUA 2HU5A 1LJ8A 2C3MA 2XMRA 3Q4GA 4PG4A 4ZVQA 3NUZA 3ORQA 5JVDF 1E3EA 4BAZA 2NP7A 2O57A 1CNFA 3DVAA 2B1QA 4P3OA 3VOSA 3A3NA 1TQ2A 3P32A 1YE8A 3V7WA 5EFOA 3K2EA 4LSMA 4P31A 3OF2A 1R7RA 1KMIY 2C1EA 2B94A 2IX9A 5SZKB 5F1YA 4C29A 4Z8XA 4WADA 4DQ0A 5DM70 5DI3A 4EUNA 5A3JA 1U9ZA 1YAHA 3CXRA 2I3AA 3A3PA 3FOAA 1E1CA 4HQNA 1NULA 4JDUA 5LB2A 3MTGA 3GDHA 4MVJG 2PZAA 4KQFA 2XOEA 4XD7A 2PLWA 3USES 1ESMA 3GCWA 3M6AA 1V2GA 4MPJA 4P86A 1K5GA 1IY9A 1QF7A 1QVZA 2C5SA 3KQMA 4K87A 3GFOA 1NDHA 4E2ZA 2CMKA 5I9MA 4U39A 2I03A 1SUPA 2G9NA 4EHLA 4GECA 3MF4A 4FGJA 2YWGA 3HY6A 2ACKA 3L40A 3O31A 2B6NA 2OK7A 1RYFA 2O1SA 4DIKA 1T34A 4UE2A 2Z98A 1AUOA 2EZUA 2WJIA 1EGQA 4PZAA 1P0IA 2IF0A 3CLRC 3PVSA 1UFVA 4PZ9A 1VLJA 3H2SA 4KOEC 1TA9A 4DCVA 2AG8A 2YV2A 4P7BA 2YNMA 4GQIA 4GIBA 1WULS 2IUTA 2O0JA 5A2QA 2QTRA 4OREX 4JLDA 3SSNA 5FF9A 2VAMA 4HXFB 2ZWPA 3EA4A 2WWFA 1EM6A 1WW2A 4RV5A 4D8YA 2A0XA 2JGJA 3ZWQA 4U7DA 1G21A 4NMHA 5L53A 1LDBA 2QTNA 1XU4A 1OBCA 3R7NA 3ZVKA 4NZ9A 1NASA 1L7EA 3E3OA 2O8BB 3EIFA 1I7LA 2VP4A 1U0EA 4P3KA 1CQJA 1S6YA 2IEAA 2W2XA 1CDOA 2DECA 1EFVB 1TADA 1MPXA 3LBAA 3FSGD 3RC9A 4ZPJA 1TU4A 3W5JA 3WFZA 4FNGA 4KSCA 4YRQA 2J09A 5IJZA 1Z16A 1TVCA 5KYWB 2ZS9A 4CCWA 3D8TA 1GGEA 1Z2DA 3Q7EA 1FNSA 2Q1WA 4OHFA 1R9NA 3DT8A 5H9VA 1E4EA 4CQMA 2ONJA 1XWFA 1ZMRA 2CFOA 2W11A 1DKQA 1VI2A 5BNWA 1T8RA 1RRPA 5EMHA 2PH1A 1EQUA 2H7XA 4CTKA 5CGQB 4KN5A 4KTTE 5IM5A 3KQTA 1N5JA 2HMAA 1UC4B 4GNRA 3MHTA 1Q83A 3BQMB 5TMBA 4XOIA 1QCCA 2IYLD 2F1HA 1FXSA 3EC1A 1CQWA 5AVRA 2Q2VA 1LTKA 1TGYA 3KE9A 3H5AA 2B61A 2X76A 4GXNA 3TYXA 5K3AA 2D59A 4R1LA 2OAQ1 1PR9A 3ZQKA 5LIPA 3P0HA 2P11A 3WK9A 2H1IA 3R0XA 4OHYA 1N3BA 4HT3B 2HXSA 4YJ2B 1GUDA 1USUA 2JF0A 4GLLA 4PZYA 4QDKA 1QV6A 3QX3A 2OCBA 4NFLA 2XA9A 3H7AA 3O9MA 3TW8B 1T8UA 4LI3X 1ZLXA 1SBQA 3DB2A 1XELA 3TLMA 2AZDA 1H2BA 3T41A 3A7EA 3SF8B 3HXKA 1AY0A 3OVMA 4U2DA 1SCBA 2EFYA 3QA3E 2FI1A 2P5SA 4FYYA 4P34A 2R8EA 1VKOA 3N74A 5DYIA 5DH9A 1TUEA 1QQ7A 4XFJA 2GJKA 2VLBA 4DCJA 1L4MA 1IM5A 2YVLA 3RC7A 1G63A 3O7MA 3PHGA 3T1YB 3WK8A 3L6UA 1W6RA 4I2VA 5E1MA 1DIOB 4LZAA 1G8GA 2VTDA 3LKZA 4JLSA 2WY2D 5FULA 4GVXA 1YRWA 4FGSA 1W5EA 2H4WA 1KFBB 2VOEA 4BKMA 1L5HB 1ZNXA 2HK9A 3FGZA 1UJMA 1YKFA 2HHJA 1OW3B 2ISCA 3QY9A 1E9EA 4HZGA 3BXOA 4MWTA 4WNCA 1WP9A 3U3MA 2V7QD 3LDGA 2W43A 1MXHA 5J9FA 3OEHD 4J1SA 3VSBA 5A0FA 5IJ9B 5HGXA 5J2UA 3VDRA 4OI0A 3KZCA 2P9FA 2DM6A 2NTJA 4M1ZA 4H4CA 3DV2A 5E3IA 5EJAA 3NVDA 5EWJA 3BT7A 1E2BA 4DGQA 4C4PA 3L6RA 4I8XA 5CR9A 1VCMA 4ZQFA 5JHHB 1AK9A 1D9ZA 4OJKA 1Z15A 2JHAA 3VZQA 1PQWA 4RPJA 5EG5A 4AJEA 1CKEA 1RBQA 3NC1C 5KNCH 2PR2A 1B1AA 3L9WA 1U6JA 1Y1KE 3SXUB 1IB0A 1Y5LA 5CHEA 1HA3A 1JS1X 2OO5A 3DXZA 4NDNE 4L3VA 4C14A 4D02A 4XWGA 1K0FA 1Y4AE 2Q0QA 4A8TA 4ZJYA 5EIEA 5K3FB 8MHTA 5GONF 3ZXYA 4EYEA 3PT5A 1A0OA 4F60A 2EJVA 5KO2A 4F92B 2II6A 4OXNA 3UXYA 5IFKA 4OGKA 4HYQA 2Z8ZA 1WUHS 3LPLA 1U0JA 4IRMA 2J46A 4CFYA 5ICSA 1H6CA 1MX3A 4LHZA 3JTMA 4A10A 1CEEA 1ZUHA 4JYZA 2HEIA 1TEVA 3L8YA 4CPDA 3BMQB 2QR5A 4C0QC 1HMPA 5CLHA 2FMIA 1EXWA 1E66A 4ILKA 4U00A 1E3DA 1VHJA 1Y80A 2QHXA 3DLAA 4OP1A 4QM7A 2BGWA 4N39A 1EP3B 5B1YA 5K9ZA 3EJ6A 3RS9A 4DAOA 3HR8A 1GKYA 3OFVA 4KLAA 3VPGA 4BQRA 2AHRA 1OFHA 1JKIA 2PZGA 3H5WA 4R05A 4DDWA 5CK4A 3SYRA 4ZJZA 2IPNA 1CETA 1CUFA 1KK2A 2PU5A 3DGEC 2ZPUA 3ELYA 4HF7A 4O4HA 4PR0A 1GKIA 4AY5A 4GOMD 1GL9B 4NBTA 3CR8A 5CT4A 5CA0A 3S2SA 3KV1A 2YX1A 4R7GA 1EMDA 1IN7A 5AO9A 3I8XA 1C3OA 4MYTA 3QYJA 2OUKA 2QE6A 1OXXK 1HC7A 3H9UA 4RGYA 1W7AA 2G5PA 1Z4KA 1PQPA 4WQMA 5BW6B 4GYWA 4JUFA 5HZMA 1QUEA 3NBXX 1L4YA 2FFBA 1SBIA 3E0XA 1N6IA 5IEJA 2Z9CA 4E0BA 2ZSUA 1LNQA 4LJSA 3NONA 1QIHA 3BD8A 1Q19A 2IYRA 3MS7A 4BE4A 4HAOA 4L73A 1N3LA 1Y9ZA 3H65A 4YS6A 4BV3A 5BV1A 5L4LA 4GR5A 1HLGA 4ITRC 3MBKA 2PKCA 5DSZA 3SEFA 3SHQA 2BFMA 3RIEA 3B20A 4Q3LA 4U9HS 4BLRA 4ALKA 1IQUA 1KI3A 1SU8A 2CMDA 3MLAA 3MWLA 1I3LA 3WAKA 4Y6RA 4KL8S 3GFQA 2NSDA 3MLBA 2QQ0A 4OQYA 1DSSG 4RCZA 4RZQA 3WIUA 4BGIA 2FMTA 4HDKA 2CGEA 1WG8A 4QOJA 2PO7A 1H3EA 1DOZA 1FEZA 3R4CA 5JUWA 2A5GA 5JNSA 1WPQA 2WJAA 5A5VA 4GS5A 4JB2A 4QPJC 5L51A 1YFKA 4IQ4A 4NE9A 3UM9A 1S2GA 1SB8A 1SUIA 3HA7A 4RSRA 3ABSB 3D1VA 3THYB 3NIGB 2VCYA 2VSYA 2BTQB 4TGLA 1QCZA 3YASA 2E6UX 1MABB 2XYRA 4KZKA 5DULA 4DXDA 3GYBA 2LE0A 3CZ9A 1GPYA 2FSPA 3L7AA 4CL3A 3I8OA 3U80A 1XCLA 2IY8A 2H07A 2V7WA 4JEMA 2I2BA 4LWOA 4M9UA 5EE3A 2DPYA 1PR5A 4I9UA 4YUXA 2YZKA 2PBZA 4CMCA 1A9PA 4TMWA 3KLMX 1UMCB 2ZBDA 3IODA 5JDCA 5E9QA 1RMQA 4MS4B 1QH8B 2QM7A 3LUHA 1U8YA 4PNZA 3M5CA 3GGCA 3MWKA 4N3NA 3FYDA 3PCRB 4C2AA 3WGLA 1R0CA 4O4JF 4L3WA 4YT4A 3BZWA 1FPQA 1OAKA 4GP6A 4J0DA 3VZCA 3C8HA 4J3NA 5C8VA 4IWXA 1MJHA 4WPGA 2BHSA 1BQ4A 3DHWC 4F1KA 2VJKA 2XMBA 1ZRNA 4WCVA 3IS3A 4UEOA 2J3HA 2Y0PA 1ZFNA 1Q44A 1DOHA 3II6X 3EFBA 4PANA 5FFMA 5SZIA 4DWOA 5EJEA 3OFKA 2AJLI 5DCLA 1RS0A 2GO1A 4WLUA 2FX5A 2WYIA 3ZV7A 1L4FA 1YE3A 2NP6A 2JZNA 1JXAA 4AJKA 2FK8A 2PAFA 1Z7EA 4JEIA 3AVPA 1J8YF 4LGCA 2ECQA 2FE1A 1BFKA 2QK4A 4IOKA 4NU5A 4O2LA 2FQWA 4UJ3A 5TR9A 3WZ2A 1NYRA 3QHAA 4KQCA 3T1OA 5HZKA 1WNFA 1TMYA 1Y1RA 4BGVA 4ZDIA 2HAEA 1JX6A 2BFDA 1U7UA 1IJFA 3F1LA 4HWRA 3WLIA 2KE5A 4M55A 1TFRA 4UNQA 5BV2P 3J81k 5DNUA 1ZISA 1QKIA 2JHPA 2JAQA 3AINA 4TN5A 4MGHA 4ZT4A 3ZCTA 3GRAA 3HUDA 1K6EA 3FW1A 4H2DA 4A0GA 4W8GA 1H5NA 1OC4A 4I81A 5EXEA 3TLGB 1FS6A 3PWSA 3QH4A 4URWR 5HE8A 5IMSA 5KPDA 4AWAA 5KYTA 2UXDB 3TI7A 1LV8A 3WY9A 3PL5A 4KAAA 2X7JA 2CE7A 2NAPA 2Y05A 1T1JA 3ER9A 4WZBB 2QRUA 1QNFA 3QPAA 1CUDA 3A0RB 3ANSA 1RKQA 4HTFA 4RKWA 4MP3A 1N33B 2WSIA 4Q3DA 1P4AA 1DAFA 1NUAA 3LA8A 3CVYA 2PGNA 3NOXA 4Z9BA 3VPBA 5E4TA 1EIWA 2HJVA 4O2BB 3R23A 5KYUA 4D8TA 1CUYA 3TQCA 2OCYC 2SBTA 5LUBA 7MDHA 3BMOB 2IQIA 3OM0A 5IN4A 1XMSA 2XADA 3IPAA 3QKSA 2NO4A 1LFDB 1CIPA 1CUVA 1NYLA 1KQ3A 3H0KA 4N49A 2PBLA 1R12A 2R7LA 4BFXA 4XVQA 1RLUA 4EB3A 5HJEA 1ZAYA 3VJMA 2IH5A 3RFFA 2YJ5A 1YGPA 3HVRA 1SKAA 4D9MA 5C51B 3E9RA 2IU0A 5K99A 1T9GR 2GD1O 5LZ9A 4AY4A 4FVTA 2G82A 2BEKA 2ZI3A 5DFAA 2ZI5A 3N3BC 4I4TB 2QLJA 4OSEA 1P2GA 1TX4B 4QUAA 4DEVA 1E9VA 1ZZGA 2Y2VA 2JJYA 3E70C 4RTOA 2IFTA 4MJXA 1Z06A 2VPQA 3IJEB 2I2CA 3ZHUA 2CMGA 3T94A 5HUHA 1GNPA 3AONB 2RD2A 3AVOA 1PD1A 1TTHA 3ER8A 4G1EB 5IXSA 1PGQA 4R9VA 2ZJ5A 1X3SA 1X13A 4BMZA 3GCDA 1A7JA 2Q41A 1GFIA 2ZGVA 2C95A 4F1WA 3GNSA 4ASUA 2NV0A 2PKWA 2XRMA 1FUYB 3MT7A 3URKA 1EUYA 2YHSA 2W6CX 4BZZA 3ROPA 3RR2A 2BGNA 2JA1A 2NV2B 4X8LA 4DJJA 3RVLA 3SQDA 4LOAA 2BGKA 2VPZA 4LZJA 4WESA 1SC1A 1VJ0A 4FU0A 1SVKA 4GR4A 4JGGA 4J9UE 5DLYA 4QO8A 3W5HA 3BBPA 2R11A 1RLJA 4KRFA 2PKEA 3KXPA 2VAWA 2WSSD 4MVJH 3PPWA 4UVGA 4KQ2A 2PUHA 5C53B 4XYMA 4BFWA 3DULA 2HF9A 4AJ1A 2Q5FA 1AF4A 3BAZA 3OM9A 3CPSA 1QE5A 3V1TC 4C6TA 2Q45A 1SQGA 3G2LA 5AJUA 2OO7A 2QD3A 2X0RA 3FYCA 4DA6A 4YAKA 2QXYA 1Y8AA 1ZX1A 2GN9A 5A1JA 2Z2XA 1VA4A 4BNFA 4X1YA 2JJ1A 1XZGA 1YCFA 1Y9AA 3KZ1E 1P6QA 3I0ZA 1EVIA 4ECAA 2IZ5A 3HABA 2HPVA 4ZU3A 3TR0A 3EVBA 1E1NA 2AOUB 4ALNA 3ICQB 3UATA 1KIFA 1N0UA 3PSHA 4XWWA 3X3HA 1E77A 3HYRA 2B5VA 5T3YA 4EA8A 3FGNA 1W4BA 4OM8A 4FZVA 3ROTA 4DADA 1KY2A 2F48A 2GBLC 5AKLA 5LZ5A 3GJ8A 2FSHA 1N0HA 3R5HA 1QYWA 1T3TA 2W48A 1PW5A 2QG9A 2NTNA 2ZIUB 2V6FA 3H19A 1RWPA 3IQEA 3L0SA 2ZUCA 3QOWA 5ELMA 2P6OA 2Q5IA 2J41A 3T1VA 2JLZA 4R9NA 1B15A 1THMA 3NKFA 2RH4A 1E20A 4IIDA 3P9SA 1KK1A 4M54A 3CNBA 4CG0A 1JB1A 4QREA 3L1JA 4D5GA 3RBXA 4I6JA 1BZYA 2J3MA 3SDBA 1D4OA 1Y81A 1YIOA 2D8MA 3HRKA 4BO6A 4E4YA 3Q5DA 1S3GA 3Q40A 4GZ6A 3N2NA 3HUTA 5FA8A 4JD5A 4PBSA 4BJ5A 2C2YA 2QI9F 3NBQA 1Y5NA 1BHJA 2FSVA 3QVJA 3RF6A 2PV7A 1AMNA 3JVDA 2RK6A 3W7BA 4DUZB 4B09A 1LSOA 2ZCVA 2V4UA 3PK0A 1JQBA 2R4QA 3EK2A 2VUIB 4GOJA 4OJYA 2AJBA 5GQSA 3TSAA 3O9VA 5THXA 3KDSE 3O1IC 1G2QA 4BNZA 2FRVA 1PZGA 1SA0A 2VH2A 2I7VA 2G4LA 3VI3B 3EDCA 5MF6A 2CHUA 4Y2VA 4ZEOA 4GBMA 2I4RA 5F5LA 1HNZB 4UAJA 3U1VA 4PBTA 1TM7E 2NU8B 2Q7DA 5KNBA 4DA9A 1P80A 2XKAA 4YTEA 1WM1A 1W88B 4CZ2A 4FGKA 4MZDA 2QX8A 1U3CA 3FFWA 4NFSA 2VA8A 1IONA 4OJMX 5JATA 3KB8A 1N1MA 1U0TA 1JBEA 4Y2YA 4E5NA 4G89A 1HKHA 4LPKA 1JU3A 4QSMA 1QK5A 2BELA 2VG8A 1KGSA 4NENA 1NVXQ 4FUTA 1E1MA 1RQNA 1W47A 4TQ9A 3HEMA 2XCIA 4B80A 3NVMB 1V11B 4HPWA 2VDJA 1NI4B 2WV9A 3IRVA 3ZUPA 5A5EA 3L77A 2WIFA 1VE6A 1RYHA 3IEXA 3TKAA 3ILYA 3GUUA 3B1XA 3W6NA 2BIFA 1Q2UA 1IOVA 3U5TA 2VIIA 3P9CA 1WMEA 1QIIA 4CIDA 4BV2A 3IDZA 3SOZA 1JSLA 1XYYA 2LDBA 2VKQA 2D06A 2VR1A 2QVLA 4Q19A 4CMBA 1DIRA 2AF3C 1NIPA 2SKDA 1T29A 2XVZA 2H4JA 1L5WA 5BRJA 4R16A 4XGRA 1XN1A 4C0WA 4XARA 2VNIA 1GTZA 4J29A 2B2CA 1L4BA 2IRWA 3FA2A 1Z2OX 1J99A 4OHUA 1CFJA 1FS4A 3I2FA 1EDBA 1UK7A 4FDAA 5C5IA 3K15A 4IUDS 1R8YA 2VF5X 4QUGA 1TUBA 2JJQA 3ME5A 3IVMA 4TLMB 3G85A 1PNQA 1E9DA 5H4GA 5HWSA 4NYJQ 5C35A 2CNBA 2XZDA 3HU5A 4LI0A 3N07A 1G5PA 1MC8A 3N0RA 3PS9A 3E22B 2HR1A 1RJEA 1RHJA 3S1SA 2HF8A 4HTAA 3VPDA 2YOFA 4BC1A 2OVBA 2QZ9A 4CKYA 4MSUA 1HOXA 2O7SA 3CYFA 1NAIA 3EMDA 3L6CA 4XDHA 5KDDA 1NXXA 1QP8A 5EYPB 5D3MB 1GGHA 1LPSA 4I1VA 1MT0A 1ZJZA 4RPCA 2B9VA 3ZW9A 3QJGA 4HEQA 2BYTA 1TZCA 3OCUA 1W75A 1PZHA 4AULA 2Q21A 1QDUA 3O3OB 3FMPB 3F3SA 5FYQA 3Q41A 1UPBA 3L01A 4N3GA 1HBJA 1PDVA 4WKGA 2FU5C 2C29D 2FG6C 2HBRA 3ECCA 1RZ3A 3RRNA 2R6GA 2FWPA 1B2RA 3RAPR 2FZKA 3JQ8A 1MXFA 1T2UA 3PYXA 2JGLA 2OZLA 2CYAA 1YQTA 2Y99A 3AILA 1EWKA 5H70A 2IE0A 5KAMA 2EKQA 3N87A 3UN1A 3E9QA 2OKCA 5HKKD 4K0RA 3ZWNA 3B12A 3ENQA 4DS3A 1KNQA 1XCOA 2H2HA 4OYYA 1JI3A 1T9GS 2DOKA 1TJ3A 2DFLA 2D2IA 3EG9B 4IIBA 4QPZA 3BWMA 4QTXA 4DHWA 3D2BA 3PEUA 3R0JA 1KETA 2JD0A 4FTWA 2V6GA 4BU1A 2R48A 3P0RA 5KQMA 4DKJA 1PHRA 3FKSD 1DXHA 2IWHA 4QELA 2OMEA 3Q10A 4KPGA 1ZRHA 4NVRA 3NWEA 1GYQA 3CZCA 4MV1A 3MG9A 4IMPA 1ZKMA 1Z4NA 1BW9A 4Q21A 4QRIA 5I7WA 5E9WA 1GNRA 1E5QA 3OFJA 4FE7A 4U2FA 2W00A 1HZZC 3ZHOA 1D2HA 2XCUA 4K46A 3WAGA 5DIFA 1H1TA 3S8YA 1XNQB 4QXMA 4FD2A 2DMRA 1B3BA 1VGRA 1XO1A 1TC2A 4PZ0A 4JDPA 4UKDA 2J0VA 1NOIA 3GN2A 4JSYA 1DCKA 1ZG3A 2ESRA 2GCIA 4WK4B 4DMLA 5DTMA 4ZDKA 5KCZA 4YJ2A 2GK6A 2D2FA 1T5BA 5LP1A 2X5JO 1DADA 1A9QA 1HFWA 2ADMA 1G8PA 2G71A 4CR7A 2PZLA 1QTIA 5CB4F 1PEYA 1GCIA 1XRSB 3N39C 2BC9A 1U04A 4NU8X 1O6BA 2BZGA 2PQ0A 2O59A 2K4MA 3X1KA 16PKA 4UEKA 4EJSB 1N0IA 2IL1A 1GIAA 2B99A 3ADKA 3EWAA 4YQYA 2OOKA 3H4TA 3ACCA 1SCUA 3ZTTA 3LL7A 4ZEWA 2OUIA 1YWGO 4NARA 5C5DA 1TI7A 4CYMA 4MVJE 4AXBA 1EFDN 1G64A 3LHFA 4PC1A 5BWCA 4CRWB 3KK0A 4HDMA 1K1EA 3JQAA 4GMFA 3BB3A 4GX2A 3ZTYA 3VTAA 4IO1A 1GFZA 1WMBA 2HA6A 2Q27A 4L51A 3KAJA 2OB1A 2OHIA 3EXIB 4R40A 4UHBA 1E3WB 4PZLA 5IAEA 4AY2A 3DE0X 2PMEA 3MS2A 3GP3A 1YC5A 4NZZA 4POAA 2C2XA 1VP3A 3T3EA 1YZVA 4CLRA 5SZJA 2JBAA 5C8DA 2COUA 5KTSA 4FDVA 1RYNA 3IIMA 4NU6A 1GCAA 3CR3C 3A6JA 1B0UA 3Q3HA 5L6MB 1BOFA 3FVRA 3BSWA 2XUPA 4FMDB 4XIGS 1F9EA 4ZAYA 3RIYA 3HH8A 1V35A 2ZSDA 1L5GB 4L78A 3EW7A 3DEKA 2O06A 4FR2A 4PLGA 4EEXA 3MAAC 2HTFA 5BSMA 4H4EA 4M1YA 5BSWA 3IEUA 1U0FA 5T8KA 3ZWWA 4WDQA 3EDOA 3JQ9A 3GVCA 3H42B 3NG1A 1XEXB 4J3JA 5GOTA 3NHMA 2PLNA 3EGDB 4KACA 1YQWA 4XDZA 2CDCA 1IN5A 1IJBA 4Y9UA 3UY4A 4C7VA 4DLRA 4GD3Q 4CN8A 4R54A 4YT8A 3P9YA 3REOA 3CNHA 4U8GA 4HQRA 5H81A 1YZNA 3T5AA 4GX0A 2VF2A 4Z86A 4EYGA 3QYAA 3VH1A 3GUHA 4LPSA 3RJTA 3GGPA 2IS4A 1CS0A 1OI4A 4YREA 3SVZA 3HCRA 3HEAA 3EYWA 4R2IA 4YUYA 4BNMA 3KFLA 4QBTA 4XA8A 3ITDA 4IG9A 4DV5B 3BWDD 2WYHA 2OGSA 2YZ7A 1WHSB 3A9TA 3Q12A 2HWKA 4HKTA 3RBZA 1L4UA 2ZUWA 4QDOA 1P1FA 4GPBA 2VCEA 1G3QA 4CUKA 1DEAA 1PJQA 1SOAA 5KOJA 2O3SA 1HE3A 1YBVA 1R5BA 4I08A 2YRFA 1P2BA 3UENA 5F7OA 1ZLYA 3IR6A 1GZ7A 2NYRA 3PFCA 1V48A 3FVQA 1F8UA 4HADA 5IT9A 2FZLA 3N6RA 1RADA 1YJQA 3CLHA 3EHEA 3QE4A 2QR3A 1G0NA 2C3YA 1R4NA 1RXEA 3FDFA 4GICA 4HQ0A 1ODKA 1CDEA 4LBYA 4QFDA 4B87A 5L6LB 1E0SA 2QJOA 2XE4A 4KE7A 4HWSA 4BNDA 1GU7A 1XEAA 3V46A 3CVOA 1SKQA 1E8DA 5D00A 2G0AA 3GGJA 1X1TA 2XQIA 3I0NA 3INTA 1KDVA 6NULA 4FYIA 2HNAA 1O4VA 3K1AA 4XIIA 2EJTA 1ZJWA 3W3AA 1LLUA 4J7XA 5DBEX 3VR3A 1BO6A 4XYBA 1UDBA 3ZDRA 1NBAA 4CQLB 5AW9A 4LG1A 2FOLA 4ARCA 3PNPA 2J1LA 5A0VA 1GGVA 1L5RA 2EF1A 3C7CB 3O4IA 3SM9A 3AGPA 4DLAA 1W0CA 3ZDCA 3PFNA 3QEMA 3KJXA 4JBLA 2WYWA 4RF3A 4FCCA 4H31A 3PL1A 4QOHA 3VOTA 3RJZA 4FDTA 3E61A 4KWCA 3K2IA 1VJDA 4OI1A 3L84A 1B8NA 4BMXA 1OE0A 1W4AA 3B82A 3SY8A 3RW9A 5ES4B 1E3JA 3RRZA 5A6SA 1ZN9A 4ZRMA 3KQKA 4ROSA 4JKYA 2OSVA 4YJKA 4MV0A 4H1UA 4KUGA 3FXAA 4NZPA 5BY2A 3B2QA 1U8XX 1BQEA 4FIZA 1PWYE 1ZQ1A 4RXMA 4H7PA 2CV1A 3Q7IA 1R5OA 3PHLA 3V80A 4GOND 4YP1A 2D5CA 1O94C 3EPHA 1EKXA 5T64A 2ORYA 1MV8A 1HEIA 1USIA 4NOJA 1L4NA 2IHBA 4CI9A 2BEUA 5AVXA 4LCJA 4MHSA 1UWVA 1GOTA 1KQOA 2QQEA 4DWWA 2Q3BA 4BQIA 3L0ZA 3P45A 1UKVY 1W5TA 5DYGA 5EL0A 4RC9A 5F7JA 2HCFA 4KGZA 1Z4MA 3WQQA 4JMLA 1T9DA 1R3UA 4IJ5A 5JT1A 1TZJA 2JFYA 4MWDA 1QRSA 5LSAA 1AKQA 2WAYA 4EG7A 3Q6MA 4IXTA 5FI3A 1NTRA 4AWXA 1BMFA 4DA4A 2P5UA 1Z28A 2AYYA 3ZU6A 4XEHA 4AL4A 2OD2A 3FYUA 1E99A 3MUOA 4NHOA 4X6XA 1BVYF 4JLUA 1QC5A 2CVHA 2F59A 4B44A 1H5QA 1HLDA 2JFNA 3UA4A 1ZQ9A 5ALEA 3BHNA 3QUBA 4EATA 4YRDA 4QTZA 2RHCA 2K7ZA 3UKJA 5LVAA 5KTPA 1WVMA 1HRKA 2OCGA 3HFGA 4U2EA 4J75A 3FWYA 3AT1A 3WLQA 2JARA 4OCZA 3ZDDA 3BRCA 4G0XA 3T7KA 3V4PB 3QV2A 3IH5A 3WTBA 2BWJA 1EA5A 1U7WA 2OBLA 3LYLA 3W1VA 3TUZC 3SHTA 1XFDA 2A1TR 4EPTA 4L6AA 1ISMA 4RAQA 3NETA 4MB0A 3ILHA 2AFHB 1R4AA 1TOAA 1UBRS 1WOYA 4JVLA 1FP2A 2PYDA 2ECKA 2YDXA 4ZC8A 4FUQA 3GLGE 1ONBA 1RYEA 3FSEA 3P2OA 2C8JA 4H17A 1N9ZA 1P91A 1P2TA 4BKRA 1HDEA 1K86A 3HCPA 5D01A 4O2AB 3KDPA 5C4GB 2ZFUA 3KOOA 4KQ1A 4NYJR 4LW8A 3U7QB 1Z26A 3TFQA 1KYTA 3PUKA 2X0FA 3NHKA 1OI3A 3EPPA 3FVTA 1NVUQ 3BM5A 1WUJS 1QIMA 4ZQIA 2DT5A 3ZX5A 3CKKA 2QTVA 4BVHA 5IJXA 4EPVA 1LDEA 3ZVMA 3H8SA 4LF8B 4B4OA 1ACMA 4C2BA 1HZJA 1O96B 3WICA 1SVMA 3DBLB 1VKZA 1RW4A 1VMDA 4HHEA 1QO0D 2YWFA 1SZCA 5AOCA 5THKA 1TCVA 2ZBRA 1IPHA 3L7CA 3FX2A 2MSEB 3BE4A 3JZIA 4JC4A 4MPPA 1PX0A 4TSKA 4C06A 3D8HA 1TVMA 4R68A 4YAOA 2IOQA 4GOLD 1EUDB 2ID7A 4PAWA 5CVDA 4DWVA 1S01A 2ZPAA 3CUKA 5JZ9A 1JG2A 2XRZA 1X7YB 1L7OA 2OPHA 5AJVB 5BN5A 4C6SA 3FGPA 4BLUA 4PCAA 3MA0A 3LWNA 3ZIAA 4ZVNA 4DM3A 5KQRA 4MS3A 5BMVB 4TMTA 1NF9A 4INAA 2J5XA 3FHCB 3EVNA 4JBHA 1TEHA 3GEHA 4ZMSA 4A9AA 3DV0A 2X5KO 3WVNA 2YWCA 4OGWA 3MCAA 3KYJB 4G8JA 5ALYA 4YUVA 1F8YA 3BTVA 3TMAA 4K9NA 1U0OC 2BSAA 3E1SA 3TOCA 4DMKA 5J2UF 3VXKA 3RUPA 2HU2A 4O0LA 5CW1A 3ISVA 5JY1A 1AKWA 5A02A 3VYSB 1DKUA 2BJHA 2EERA 1JECA 1ULHA 1S2DA 3O3NB 1SXIA 1U9IA 4OYLA 5CT6A 2D1TA 4ZYXA 1G3RA 5ER6A 1JA0A 1PZFA 5LP6C 2I3GA 3E2MA 4H6VA 3T38A 2QT9A 1NDQA 4KE9A 2Z4SA 3Q3VA 2C5FA 3AY3A 4REQB 3SU8A 4KKVA 2CJWB 5IBPA 3ZIUA 2XA1A 1MQ8B 3V34A 4OXRA 1YS4A 1DOAA 4R9SA 5H02A 3R75A 4FXPA 3UHJA 3ETEA 3RH0A 3QKRA 1P1IA 1BMQA 4JOBA 3UUGA 1RKUA 4AT1A 3M9WA 4F5DA 3B3QA 1J4AA 5LMCA 2HGSA 2PMBA 2OZEA 2ZBVA 2G1UA 1SIUA 3L8EA 5AK3A 1SY7A 3NTOA 1EUCA 4M1TA 1NQTA 5IM4A 3BA1A 2F9MA 5GZ1A 2YYYA 3A70A 1A8IA 4EF6A 1E1RA 2QI9C 3DHNA 2WG0A 3GF4A 3HGTA 3PA6A 4RMIA 5ALTA 4P84A 1G59A 1NYTA 3NJ8A 4ESOA 5DBHX 3RKRA 3UC5A 3BQNB 1PVOA 4BLOA 2Q1XA 4Z5XA 1B93A 1UINA 2JLQA 4PHTA 1K75A 1MNAA 4TVOA 3C6ZA 3K3PA 1QIEA 2YWHA 2VBGA 3QOFA 3RHFA 4CLEA 1UOOA 2ZJ4A 4MGYR 1MTOA 1Q3TA 2C4VA 3C3KA 3KJEA 4AICA 4D0GA 2HLHA 4LOKA 3Q9NA 1GNSA 4AROA 1M5UA 1Q3HA 4IO0A 3SHVA 1NJGA 5REQB 1Z2PX 4MUKA 1LBEA 3GO4A 4IF4A 5SYNA 1FVXA 4CG1A 5G0VA 2P78A 2W6OA 5FPKA 4C4RA 2ZE8A 5EIAA 1RAFA 1QFZA 2FNAA 2RG1A 1OIVA 4PTZA 2YV4A 1KJ9A 1VPDA 1VECA 3U44A 3HUFA 5FBKA 1F2TB 1NKVA 1KVQA 2HD4A 1Q7CA 3LY5A 4TT3D 2A1TS 1GUAA 4N03A 2P2LA 4X00A 2WVAA 4URYR 1PQ4A 1A9TA 3HZOA 5FL7A 4PRYA 2QL5A 2YUTA 4Z2YA 1HDZA 2B37A 4YT5A 3GGGA 5KYXA 5DI9A 2GXUA 2H1RA 5E6SB 2Z2IA 5FT9A 2OCLA 1E7SA 1E5TA 3M5WA 1AN9A 3WYAA 5AK0A 1C9KA 5EJ4A 2BCJQ 1ID8A 1EBBA 3C3XA 1E0AA 4K7JA 2G1JA 4ALMA 2CWWA 1N78A 1IZ9A 3LT2A 2J6CA 1F8GA 1DTEA 2FR8A 3HC7A 1YBFA 3U3KA 1ORVA 5IWCA 1Q14A 4IFEA 1T36B 4EMTA 5D5HA 3TW8A 1KRWA 3T5CA 4HNVA <