1ST7A

Solution structure of acyl coenzyme a binding protein from yeast
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
86
structure length
86
Chain Sequence
VSQLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKEYIALVDQLIAKYSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-CoA-binding protein
publication title Different secondary structure elements as scaffolds for protein folding transition states of two homologous four-helix bundles
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 30
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2004-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1st7A00
2HRJA 2HE7A 2I1KA 2ZPYA 1ST7A 4F7GA 2CB8A 1NVLA 1E5WA 2CQUA 2RQ1A 3IVFA 1ISNA 2FDQA 2J0MA 1HBKA 3AU5A 3PZDA 2J0JA 3X23A 2YVCA 1NTIA 1H4RA 3BINA 3EPYA 2COPA 3QIJA 1Y19B 1GG3A 1MK7B 1HB6A 4P7IA 4YL8A 4CYEA 1ACAA 1MIXA 1EF1A 1MIZB 2AEHA 2LBBA 4ZRIA 4ZRJA 3U8ZA 1J19A 1MK9B 3FP5A 3ZDTA 2D10A 3AU4A 4EKUA 5IJMA 3WA0A 4HDOA 4HDQA 4NY0A 4DXAB 1SGHA 2I1JA 3U7DA 3FLVA 1GC7A 1HB8A 2D2QA 2EMSA 4ZRKA 2AL6A 1NI2A 2EMTA 2FJ9A 2J0KA 2WH5A 3G9WA 3PVLA 1GC6A 2ABDA 2D11A
chains in the Genus database with same CATH superfamily
4JKEA 3E9OA 2HE7A 2I1KA 4JKHA 4JKGA 2CB8A 1E5WA 2R82A 2RQ1A 3E66A 4GXBA 1VBHA 1HBKA 3E9LA 1GG3A 1HB6A 1MIXA 1EF1A 4TKNA 3U8ZA 1KC7A 3E9PA 3ZDTA 4EKUA 3WA0A 4DXAB 3U7DA 1GC7A 1HB8A 2D2QA 4JK9A 5JVLA 3PVLA 2ABDA 2D11A 4F7GA 2CQUA 4ILJA 3X23A 2YVCA 1NTIA 1H4RA 3BINA 1KBLA 4CYEA 1Y19B 4ILHA 1MIZB 2LBBA 4JKAA 1J19A 1MK9B 3FP5A 2D10A 3AU4A 4HDOA 4JK7A 4JKGB 3SBTA 1GC6A 4ILGB 1DIKA 4JKFA 1NVLA 3PZDA 2J0JA 3QIJA 3EPYA 2COPA 1MK7B 2AEHA 4ZRJA 3ENBA 1VBGA 5IJMA 4NY0A 1SGHA 2I1JA 4ZRKA 1NI2A 2FJ9A 2J0KA 2HRJA 2ZPYA 1ST7A 3IVFA 1ISNA 1JDEA 2DIKA 2FDQA 2J0MA 3AU5A 4P7IA 4JKDA 1ACAA 4ZRIA 3SBGA 4JKCA 4HDQA 4JKBA 3FLVA 2X0SA 2EMSA 2AL6A 1GGOA 2EMTA 2WH5A 4JK8A 4YL8A 3G9WA
chains in the Genus database with same CATH topology
4JKEA 3E9OA 2HE7A 2I1KA 4JKHA 4JKGA 2CB8A 1E5WA 2R82A 2RQ1A 3E66A 4GXBA 1VBHA 1HBKA 3E9LA 1GG3A 1HB6A 1MIXA 1EF1A 4TKNA 3U8ZA 1KC7A 3E9PA 3ZDTA 4EKUA 3WA0A 4DXAB 3U7DA 1GC7A 1HB8A 2D2QA 4JK9A 5JVLA 3PVLA 2ABDA 2D11A 4F7GA 2CQUA 4ILJA 3X23A 2YVCA 1NTIA 1H4RA 3BINA 1KBLA 4CYEA 1Y19B 4ILHA 1MIZB 2LBBA 4JKAA 1J19A 1MK9B 3FP5A 2D10A 3AU4A 4HDOA 4JK7A 4JKGB 3SBTA 1GC6A 4ILGB 1DIKA 4JKFA 1NVLA 3PZDA 2J0JA 3QIJA 3EPYA 2COPA 1MK7B 2AEHA 4ZRJA 3ENBA 1VBGA 5IJMA 4NY0A 1SGHA 2I1JA 4ZRKA 1NI2A 2FJ9A 2J0KA 2HRJA 2ZPYA 1ST7A 3IVFA 1ISNA 1JDEA 2DIKA 2FDQA 2J0MA 3AU5A 4P7IA 4JKDA 1ACAA 4ZRIA 3SBGA 4JKCA 4HDQA 4JKBA 3FLVA 2X0SA 2EMSA 2AL6A 1GGOA 2EMTA 2WH5A 4JK8A 4YL8A 3G9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HRJ A;  2HE7 A;  2I1K A;  2ZPY A;  1ST7 A;  4F7G A;  2CB8 A;  1NVL A;  1E5W A;  2CQU A;  2RQ1 A;  3IVF A;  1ISN A;  2FDQ A;  2J0M A;  1HBK A;  3AU5 A;  3PZD A;  2J0J A;  3X23 A;  2YVC A;  1NTI A;  1H4R A;  3BIN A;  3EPY A;  2COP A;  3QIJ A;  1Y19 B;  1GG3 A;  1MK7 B;  1HB6 A;  4P7I A;  4YL8 A;  4CYE A;  1ACA A;  1MIX A;  1EF1 A;  1MIZ B;  2AEH A;  2LBB A;  4ZRI A;  4ZRJ A;  3U8Z A;  1J19 A;  1MK9 B;  3FP5 A;  3ZDT A;  2D10 A;  3AU4 A;  4EKU A;  5IJM A;  3WA0 A;  4HDO A;  4HDQ A;  4NY0 A;  4DXA B;  1SGH A;  2I1J A;  3U7D A;  3FLV A;  1GC7 A;  1HB8 A;  2D2Q A;  2EMS A;  4ZRK A;  2AL6 A;  1NI2 A;  2EMT A;  2FJ9 A;  2J0K A;  2WH5 A;  3G9W A;  3PVL A;  1GC6 A;  2ABD A;  2D11 A; 
#chains in the Genus database with same CATH topology
 4JKE A;  3E9O A;  2HE7 A;  2I1K A;  4JKH A;  4JKG A;  2CB8 A;  1E5W A;  2R82 A;  2RQ1 A;  3E66 A;  4GXB A;  1VBH A;  1HBK A;  3E9L A;  1GG3 A;  1HB6 A;  1MIX A;  1EF1 A;  4TKN A;  3U8Z A;  1KC7 A;  3E9P A;  3ZDT A;  4EKU A;  3WA0 A;  4DXA B;  3U7D A;  1GC7 A;  1HB8 A;  2D2Q A;  4JK9 A;  5JVL A;  3PVL A;  2ABD A;  2D11 A;  4F7G A;  2CQU A;  4ILJ A;  3X23 A;  2YVC A;  1NTI A;  1H4R A;  3BIN A;  1KBL A;  4CYE A;  1Y19 B;  4ILH A;  1MIZ B;  2LBB A;  4JKA A;  1J19 A;  1MK9 B;  3FP5 A;  2D10 A;  3AU4 A;  4HDO A;  4JK7 A;  4JKG B;  3SBT A;  1GC6 A;  4ILG B;  1DIK A;  4JKF A;  1NVL A;  3PZD A;  2J0J A;  3QIJ A;  3EPY A;  2COP A;  1MK7 B;  2AEH A;  4ZRJ A;  3ENB A;  1VBG A;  5IJM A;  4NY0 A;  1SGH A;  2I1J A;  4ZRK A;  1NI2 A;  2FJ9 A;  2J0K A;  2HRJ A;  2ZPY A;  1ST7 A;  3IVF A;  1ISN A;  1JDE A;  2DIK A;  2FDQ A;  2J0M A;  3AU5 A;  4P7I A;  4JKD A;  1ACA A;  4ZRI A;  3SBG A;  4JKC A;  4HDQ A;  4JKB A;  3FLV A;  2X0S A;  2EMS A;  2AL6 A;  1GGO A;  2EMT A;  2WH5 A;  4JK8 A;  4YL8 A;  3G9W A; 
#chains in the Genus database with same CATH homology
 4JKE A;  3E9O A;  2HE7 A;  2I1K A;  4JKH A;  4JKG A;  2CB8 A;  1E5W A;  2R82 A;  2RQ1 A;  3E66 A;  4GXB A;  1VBH A;  1HBK A;  3E9L A;  1GG3 A;  1HB6 A;  1MIX A;  1EF1 A;  4TKN A;  3U8Z A;  1KC7 A;  3E9P A;  3ZDT A;  4EKU A;  3WA0 A;  4DXA B;  3U7D A;  1GC7 A;  1HB8 A;  2D2Q A;  4JK9 A;  5JVL A;  3PVL A;  2ABD A;  2D11 A;  4F7G A;  2CQU A;  4ILJ A;  3X23 A;  2YVC A;  1NTI A;  1H4R A;  3BIN A;  1KBL A;  4CYE A;  1Y19 B;  4ILH A;  1MIZ B;  2LBB A;  4JKA A;  1J19 A;  1MK9 B;  3FP5 A;  2D10 A;  3AU4 A;  4HDO A;  4JK7 A;  4JKG B;  3SBT A;  1GC6 A;  4ILG B;  1DIK A;  4JKF A;  1NVL A;  3PZD A;  2J0J A;  3QIJ A;  3EPY A;  2COP A;  1MK7 B;  2AEH A;  4ZRJ A;  3ENB A;  1VBG A;  5IJM A;  4NY0 A;  1SGH A;  2I1J A;  4ZRK A;  1NI2 A;  2FJ9 A;  2J0K A;  2HRJ A;  2ZPY A;  1ST7 A;  3IVF A;  1ISN A;  1JDE A;  2DIK A;  2FDQ A;  2J0M A;  3AU5 A;  4P7I A;  4JKD A;  1ACA A;  4ZRI A;  3SBG A;  4JKC A;  4HDQ A;  4JKB A;  3FLV A;  2X0S A;  2EMS A;  2AL6 A;  1GGO A;  2EMT A;  2WH5 A;  4JK8 A;  4YL8 A;  3G9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...