1STFI

The refined 2.4 angstroms x-ray crystal structure of recombinant human stefin b in complex with the cysteine proteinase papain: a novel type of proteinase inhibitor interaction
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
MMSGAPSATQPATAETQHIADQVRSQLEEKYNKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAPAIN
publication title The refined 2.4 A X-ray crystal structure of recombinant human stefin B in complex with the cysteine proteinase papain: a novel type of proteinase inhibitor interaction.
pubmed rcsb
source organism Carica papaya
molecule tags Hydrolase(sulfhydryl proteinase)
total genus 21
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1993-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1stfI00
1CYUA 1IV7A 3K9MC 1TIJA 3KSED 1MNLA 3KFQC 1FA3A 3PS8A 3Q2PA 5ELUA 3PXMA 1LXEA 4TX4A 5A0OB 4CCVA 4LZIA 1N9JA 1MOLA 3PYJA 2W9PA 1CEWI 1NB5I 3S67A 5EQLA 1ROAA 3QRDA 2O9UX 1FUWA 3SVAA 2OCTA 3L0RA 4N6TA 1A90A 3IMAB 1DVDA 1RN7A 4N6NB 1KWIA 3UL5A 1A67A 2BO9B 3GAXA 1GD3A 1R4CA 1M9GA 1DVCA 4ZM8A 2W9QA 4N6OB 1NB3I 1PFPA 3NX0A 3LH4A 1N5HA 1EQKA 5LC6A 4N6UA 1CYVA 2CH9A 1YVBI 4N6LA 1GD4A 2KXGA 3MWZA 1G96A 5LC7A 1STFI 1IV9A 4N6MA 1WNHA 3UL6A 5ELJA 1N5PA 4EYCA 4IT7A 4N6V0
chains in the Genus database with same CATH superfamily
3CCU3 3WA3A 5KP3A 1IV7A 1W7CA 3VSYA 1RNTA 2INXA 3KSED 1WTHA 3PZWA 3BNBA 1O7NB 2F5MA 3KSPA 1K41A 3NV0A 5D83A 2HOHA 8CHOA 1ISKA 4XBTA 1ZX2A 5CXOA 3SXXA 1VQO3 1QJGA 1QALA 1VQ83 1ZO2A 3AGOA 4FCJA 4J8TA 3PS8A 4GSPA 1Z1SA 5IG4A 2CIUA 3KZTA 3AMOA 1IVXA 5ELUA 1BNGA 1DYUA 1VQN3 1AVLA 2ZHXB 1LXEA 3GZYB 3MPHA 4TX4A 3FCSB 4HM1B 3K0ZA 5A0OB 5AIIA 2Z7AA 3GZRA 4CCVA 3H3HA 2XR8B 2CHCA 3ALAA 4HKVB 2C4BA 1JBTA 4BTWA 4MMZB 6STDA 2CFDA 5M1AA 2GBWB 3WMDA 2CK3H 2CKFB 7GSPA 1X1WA 1VQ63 4XDWA 5AYSC 1W2ZA 1UGIA 2Y73A 1U5OA 3T8UA 3UB1A 8RNTA 1W5ZA 4AKZA 3NQYA 2H0GA 5CF2A 3WOEB 2F98A 4U13A 1VQK3 1W2B2 2HMKB 1I2FA 3F7SA 1RN7A 4O02B 1GYBA 5AIFA 3ZG0A 1BANA 3STDA 4HAAA 2OTJ3 1LOYA 1BSCA 2KF3A 1A2PA 3VGNA 1JKGB 2FNQA 4J5KA 1GY7A 2W2CA 1YJW3 4ORLA 2MF7A 2ZL8A 5IG3A 1KQS2 1GMPA 5CF1A 1FYSA 3CCS3 2GSPA 5HGRA 3Q90A 3CMA3 1LOWA 3CCQ3 1IT8A 1OF5B 1RGGA 3F40A 1Q864 3O8YA 2OQEC 4H3UA 3CXC2 2L1SA 4HJLB 4LEHA 5AIHA 1M9GA 3GZBA 1TP6A 1V74A 2BNGA 2GXFA 1FGMA 1SARA 4XDVA 1DVCA 1YGWA 1YJ93 1UCLA 4I4KA 3D3LA 2KAAA 4O3VA 1NNVA 4XB5A 1ULIB 4BTXA 2HMJB 2R4IA 3X42A 4ZM8A 4AKYA 3FG4A 4GHOA 1DMNA 3CME3 1JN5A 3SOAA 2K3DA 2CG0A 1BRHA 2CX1A 3DGOA 3DUKA 3CD63 2YX9A 1OHPA 1VQ93 3F14A 4FMBA 1YI23 1RGFA 1LQGC 3N8BA 1OHSA 2P09A 9RNTA 3NX0A 1EKMA 2M7OA 4RNTA 3LH4A 3CC43 4KFEA 1YGEA 3AHWA 1F8NA 4R80A 1IDPA 1EQKA 1JKGA 2FXTA 3PCRA 4N6UA 3EN1B 3J7Yd 1FGQA 2CFWA 1LRAA 1Q7HA 3S27A 3H51A 4CPKA 1R4YA 3X3YA 3RGAA 1D6ZA 4RBNA 3MWZA 1G96A 4WYKA 5M19A 1IV9A 1ASKA 2I9WA 1MGWA 2KCDA 1WNHA 4KFDA 3UJMA 5KP4A 1RGHA 3NM2A 1JB4A 3MKIA 1DETA 3URPA 4EV2A 2BMOB 5IEPA 1WMNA 2IA7A 1I2EA 4WWUC 1BAOA 3EF8A 5IEOA 1IYYA 1U8CB 5BIRA 1B2MA 1IQXA 2CWUA 5STDA 2XH9A 3K9MC 3X40A 3DMCA 2IUKA 2PNCA 3U1WA 3KFQC 1FGOA 2E2UA 4BIRA 1CQSA 1N8QA 1FA3A 2RGQA 1M1XB 1M904 3G16A 3ROBA 1IQYA 1FUTA 4FCZA 2W56A 3SOYA 3DGNA 1QAFA 3D4AA 3SEDA 1Q814 2GBXB 1JV2B 3OX9A 4G1MB 1MWRA 2K0MA 2R41A 1O7MB 2W0QA 2RNTA 3LTAA 3T0UA 3A76A 1Q42A 3PXMA 1BNIA 1FUSA 3LT9A 4X2HA 4PEJA 2WOHA 1ULJB 3DGLA 5D82A 3CCE3 1I3FA 3F7XA 2STDA 4DKIA 3CPOA 4K90B 1JZDA 3FG1A 1YVSA 2XGLA 3CC73 1LOVA 2W9PA 1E97A 4RZMA 3ZG5A 1CEWI 3HOHA 1S723 2YFIB 1Q9EA 2XF3A 2CFKA 1NB5I 3G713 5CLKA 1GSPA 1QAKA 1ROVA 2IMJA 2W03A 4LMIA 3WOFB 3S5CA 2RFRA 3SX1A 4BU4A 3L0RA 2WOFA 5G2GA 5IERA 2IYJA 1LNIA 1YHQ3 1HKXA 3EHCA 2LQVA 2YFLB 3HIGA 5BVBA 4N6NB 2Z77A 4NHFA 2F99A 3CCM3 1IVWA 4HM0B 2LYXA 1UGHI 3UL5A 4CJNA 2BO9B 1W6CA 4FMCA 1Q40B 2KF4A 1T5YA 1E3VA 1BRIA 4LSOA 1OCVA 3HZPA 4XBXA 1NWWA 1ZGXA 2XSOB 3B7CA 1B2ZA 2HMMB 1AVKA 2BT3A 4K1UA 1V58A 4BL3A 1GD3A 2W04A 2F4YA 5HOHA 2B1XB 2OQEA 4EBGA 4R9KA 1GS3A 1OUNA 1I70A 3GZXB 2RSXA 3Q3FA 4FMAA 1D6YA 1I8VA 2QGUA 5G1LA 4KFFA 1YIT3 1GY6A 1SIIA 4JRFA 3NXJA 1WQLB 1NU3A 1QMAA 1TTOA 4HZBB 1DMMA 4EXRA 1NB3I 1RGEA 5CK6A 1HU9A 1RKYA 2CW9A 5DREA 1PFPA 3E99A 3OXAA 2BIRA 2H0HA 3NQZA 1VQ43 4MMXB 3CC23 2QA43 4WHAA 1RN4A 5EVHA 1AQZA 1TJDA 3EC9A 3I0YA 4FCMA 4FR9A 1B2SA 1CYVA 1KC84 4GL6A 3OW22 3OWUA 1RGAA 1STDA 1A2KA 2P0MA 3IPTA 3F9SA 3T8NA 2MC8A 1RGCA 4HM6B 2W6JH 5LC7A 5JPUA 2XEPA 3F8HA 5DRVA 3UL6A 3MHEA 3ER7A 2CG1A 4EYCA 3ECFA 4Q53A 5IG0A 1MWSA 4IT7A 3HK4A 4N6V0 1IU7A 1SPUA 2F86B 3GSPA 1JBSA 2BU4A 1RHLA 4KT3B 2CWVA 3V99A 3LT8A 4WP5A 4BTYA 1B20A 1I0VA 3FKAA 1CYUA 4XM4A 3KIIA 4EV5A 3CCV3 1RJOA 2KF6A 1BRKA 3RNTA 4AEQA 1KD14 1BOXA 1MNLA 1E3RA 2B24B 3VF1A 1W6YA 1TFKA 3BLZA 1WMPA 3CNXA 1UCJA 1SJWA 2JDIH 2E2VA 1B3SA 3JVCA 1VQ73 2A15A 1RNBA 3V98A 3LTBA 2OTL3 5BU4A 3V92A 2WGOA 6GSPA 4HM8B 1BSDA 1OF5A 2IY2A 1BIRA 1BSBA 1IT7A 2HMNB 3N9HA 4FMDA 1IVUA 1N9EA 1T2HA 2BHMA 1RN1A 1N9JA 1MOLA 2D42A 1D6UA 3DH2A 1JRQA 2JQ5A 3PYJA 1MGRA 5IF6A 1EA2A 1Y4KA 1I0XA 3BNCA 3GRDA 3SLUA 1O7GB 4STDA 3WDGB 1NJI4 1OHOA 1CH0A 2HMLB 1GOVA 2OWPA 5IW9A 3PGBA 3BNDA 5D81A 1TU5A 4L8OA 1RGLA 1DMQA 3ZFZA 4IPBA 3FF2A 5KP1A 1UUGB 1BU4A 2O9UX 4QWTA 3TDGA 5FGOA 1OACA 2OCTA 1K734 1B27A 4HBRA 2KRTA 1AR0A 3EBYA 3IMAB 3NUVA 5EEOA 3G4S3 1JBRA 1A90A 1OH0A 4MEIA 2ZDJA 2IUJA 1JZOA 1PY3A 4O2HA 1W00A 3DGMA 3SYUA 1HYFA 1LOXA 4KZ1A 3BIRA 5AIGA 2PZVA 1KWIA 1UI7A 3NBJA 1HZ1A 3KCHA 4HM2B 3WHOA 1A67A 3DM8A 3MG3A 2ZA4A 3CNMA 3GAXA 1FW7A 1O7HB 3CCL3 1FZUA 1M1K4 3EBTA 1SQWA 1AY7A 1BSEA 3AMOB 1EG9B 1YJN3 3B4PA 4HM7B 1BNFA 1NDOB 4BL2A 1ZS7A 4RNYA 1US1A 1T2IA 1R4CA 1LVNA 3BU4A 1QVG2 3KN4A 1BNEA 4K1VA 1G02A 2ML6A 3G8ZA 2GU3A 3OWYA 3D5GA 1VQP3 1UW1A 3CU3A 3BNEA 2J8XB 4OVMA 2GEXA 4N6OB 3GWRA 2UUGC 1EUIC 5TGNA 3BB9A 3D5IA 5IENA 3X3XA 4LYLB 1TUHA 3G0KA 1BUQA 1BNJA 2UX0A 1N5HA 3AHSA 3EQQB 3MSOA 4HZ9B 3FZWA 3JUPA 5G1KA 4EC6A 1GY5A 3QK9A 2UGIA 5AEUB 1AV4A 1UDII 1MWUA 4NREA 2C10A 2GEYA 3B8LA 2ML5A 5IG5A 5AEWB 1BRJA 1RCKA 4N6LA 1O7WB 4K61A 2KXGA 5JPPA 1VQQA 3I563 1IQ8A 3K7CA 4N6MA 3F8XA 4X2OA 5M18A 4HM5B 1LQMB 1N5PA 4R4KA 5GSPA 2O3OA 2YFJB 4KVHA 3G6E3 3KE7A 2KF5A 2V1LA 1GMQA 2Z6BA 4JF8A 3MG2A 1YIJ3 1OPYA 2F5WA 3FSDA 2OOVA 4MMYB 2Z76A 4HOHA 4H61A 1JJ22 7RNTA 1MWTA 3NBBA 1TIJA 2BMRB 3LYGA 1JNQA 1RMSA 1RSNA 1UI8A 1YNVX 4XBYA 5RNTA 3LTCA 4EW5A 1EEJA 3S28A 2QIYA 3X3ZA 2CX0A 1JN5B 1Q40A 3WODG 1B21A 1X1YA 2E2TA 1FGRA 2QEX3 2HMOB 3NHXA 1K8A4 1RRLA 1FGTA 3Q2PA 1TRPA 3A5EA 3DGYA 3FF0A 2XRXB 4R9LA 1DE3A 2XFSA 1RCLA 3OWSA 1VQM3 1J2BA 1OGZA 2P38A 1PU4A 2CFGA 1VQL3 2CWTA 4LZIA 3M8CA 1C54A 3EB8A 4IIAA 1W4NA 2RBIA 1TFOA 2P0XA 2OOVC 4OK0A 2FGTA 1RLSA 1W01A 2K54A 1GOUA 4WYKB 3JUQA 2P05A 1A2VA 3S67A 5EQLA 1G0TA 2C11A 7STDA 4HM4B 1ROAA 3RDEA 3QRDA 1BNSA 3DXOA 1FUWA 4LGQA 3FG3A 3SVAA 4N6TA 1UCIA 1V57A 3WR2A 1DVDA 1BGSA 1X1XA 2WO0A 1T3BA 3MYTA 2XSHB 5FW5A 1GOYA 3S29A 2SARA 3UNLA 1JB5A 1L5GB 3B4OA 1BVIA 1BSAA 3FLJA 4HVNA 4I5QA 1VZZA 2Y74A 3NBRA 1BUJA 4ILFA 1IK3A 3LTDA 3CCR3 1BNRA 2W56B 3KKGA 3WA2X 3CCJ3 5AI1A 3CPW2 1RRHA 1KSIA 3U97A 3JUOA 2D1WA 3D79A 4HM3B 1UCKA 4GB5A 3LXUX 1RGKA 4J9AA 5AYRB 1NO3A 4NPBA 1S5AA 4L8PA 5JBSA 3N54B 2L4VA 5BXQA 3D9RA 1VQ53 4N3VA 1UUWB 3OV4A 1W6GA 4OUQA 6RNTA 1O7PB 1X1UA 1QVF2 4J5GA 3RGRA 1OGXA 1SIHA 1W02A 2W9QA 3IJEB 1I2GA 3LOYA 2CFLA 5I97A 3K63A 3PCSA 3EX9A 3NV0B 2CC3A 1TRQA 2SBLA 3HI7A 3HIIA 1K9M4 3AGNA 3DZLA 4WFOA 1Q7Y4 2H0IA 4MJDA 3EJVA 1B2UA 3EN8A 3JUMA 3JUNA 3FH1A 2XGNA 3LMLA 1N8R4 1PYLA 2WGQA 2AAEA 1BRGA 5LC6A 1C7HA 1GMRA 1RDSA 2CH9A 3MG1A 4HYZA 1WMOA 3FGYA 3I553 3K5TA 3LZAA 3X41A 1YVBI 3Q1CA 1I3IA 1RTUA 1GD4A 1K28A 1B2XA 4R1KA 3EE1A 1JB2A 1STFI 1UUVB 1BRSA 2RCDA 1LNHA 2AADA 3DY5A 2GU1A 3NM7A 2XFTA 5ELJA 4CDLA 2BMQB 4RNZA 2F56A 2Q07A 3HX8A 4O8SA 1IVVA 1Q824 4L7KA 1BRNL
chains in the Genus database with same CATH topology
3CCU3 3WA3A 5KP3A 1IV7A 1W7CA 3VSYA 2INXA 3KSED 1WTHA 3PZWA 3BNBA 1O7NB 3KSPA 3NV0A 1K41A 5D83A 8CHOA 1ISKA 4XBTA 1ZX2A 5CXOA 3SXXA 1VQO3 1QJGA 1QALA 1VQ83 1ZO2A 4FCJA 4J8TA 3PS8A 1Z1SA 5IG4A 2CIUA 3KZTA 3AMOA 1IVXA 5ELUA 1VQN3 1DYUA 1AVLA 1LXEA 3GZYB 3MPHA 4TX4A 3FCSB 4HM1B 3K0ZA 5A0OB 5AIIA 2Z7AA 3GZRA 4CCVA 3H3HA 2XR8B 2CHCA 3ALAA 4HKVB 4BTWA 4MMZB 6STDA 2CFDA 2GBWB 3WMDA 2CK3H 2CKFB 1VQ63 4XDWA 5AYSC 1W2ZA 2Y73A 1U5OA 3T8UA 3UB1A 1W5ZA 4AKZA 3NQYA 5CF2A 3WOEB 2F98A 4U13A 1VQK3 1W2B2 2HMKB 3F7SA 1RN7A 4O02B 1GYBA 5AIFA 3STDA 2OTJ3 3VGNA 1JKGB 2FNQA 1GY7A 2W2CA 1YJW3 4ORLA 2MF7A 2ZL8A 5IG3A 1KQS2 5CF1A 3CCS3 5HGRA 3Q90A 3CMA3 3CCQ3 1IT8A 1OF5B 3F40A 1Q864 3O8YA 2OQEC 4H3UA 3CXC2 4HJLB 4LEHA 5AIHA 1M9GA 3GZBA 1TP6A 1V74A 2BNGA 2GXFA 1FGMA 4XDVA 1DVCA 1YJ93 4I4KA 3D3LA 4O3VA 4XB5A 1ULIB 4BTXA 2HMJB 2R4IA 3X42A 4ZM8A 4AKYA 3FG4A 1DMNA 3CME3 1JN5A 3SOAA 2CG0A 3DGOA 3CD63 3DUKA 2YX9A 1OHPA 1VQ93 3F14A 4FMBA 1YI23 3N8BA 1OHSA 2P09A 3NX0A 1EKMA 2M7OA 3LH4A 3CC43 4KFEA 1YGEA 1F8NA 4R80A 1IDPA 1EQKA 1JKGA 2FXTA 3PCRA 4N6UA 3EN1B 3J7Yd 1FGQA 2CFWA 3S27A 3H51A 3X3YA 3RGAA 1D6ZA 4RBNA 3MWZA 1G96A 4WYKA 1IV9A 1ASKA 2I9WA 2KCDA 1WNHA 4KFDA 3UJMA 5KP4A 3NM2A 1JB4A 3MKIA 4EV2A 2BMOB 5IEPA 1WMNA 2IA7A 4WWUC 3EF8A 5IEOA 1U8CB 1IQXA 2CWUA 5STDA 2XH9A 3K9MC 3X40A 3DMCA 2IUKA 2PNCA 3U1WA 3KFQC 1FGOA 2E2UA 1CQSA 1N8QA 1FA3A 2RGQA 1M1XB 1M904 3G16A 3ROBA 1IQYA 4FCZA 3SOYA 2W56A 3DGNA 1QAFA 3SEDA 1Q814 2GBXB 1JV2B 3OX9A 4G1MB 2K0MA 2W0QA 1O7MB 3LTAA 3T0UA 3A76A 1Q42A 3PXMA 3LT9A 4X2HA 4PEJA 2WOHA 1ULJB 3DGLA 5D82A 3CCE3 3F7XA 2STDA 3CPOA 4K90B 3FG1A 2XGLA 3CC73 2W9PA 1E97A 4RZMA 1CEWI 1S723 2YFIB 2XF3A 2CFKA 1NB5I 3G713 5CLKA 1ROVA 1QAKA 2IMJA 2W03A 4LMIA 3WOFB 3S5CA 2RFRA 3SX1A 3L0RA 2WOFA 5G2GA 5IERA 1YHQ3 1HKXA 3EHCA 2LQVA 2YFLB 3HIGA 5BVBA 4N6NB 2Z77A 4NHFA 2F99A 3CCM3 1IVWA 4HM0B 2LYXA 3UL5A 2BO9B 1W6CA 4FMCA 1Q40B 1T5YA 1E3VA 4LSOA 1OCVA 3HZPA 4XBXA 1NWWA 2XSOB 3B7CA 2HMMB 1AVKA 2BT3A 4K1UA 1GD3A 2W04A 2B1XB 2OQEA 4EBGA 4R9KA 1GS3A 1OUNA 3GZXB 2RSXA 4FMAA 1D6YA 2QGUA 1YIT3 4KFFA 1GY6A 1SIIA 4JRFA 3NXJA 1WQLB 1NU3A 1QMAA 4HZBB 1DMMA 4EXRA 1NB3I 1RKYA 5CK6A 1HU9A 2CW9A 5DREA 1PFPA 3E99A 3OXAA 3NQZA 1VQ43 4MMXB 3CC23 2QA43 4WHAA 5EVHA 3I0YA 3EC9A 4FCMA 4FR9A 1CYVA 1KC84 4GL6A 3OW22 3OWUA 1STDA 1A2KA 2P0MA 3IPTA 3F9SA 3T8NA 2MC8A 4HM6B 2W6JH 5LC7A 5JPUA 2XEPA 3F8HA 5DRVA 3UL6A 3MHEA 3ER7A 2CG1A 4EYCA 3ECFA 4Q53A 5IG0A 4IT7A 3HK4A 4N6V0 1IU7A 1SPUA 2F86B 3V99A 2CWVA 3LT8A 4WP5A 4BTYA 3FKAA 1CYUA 4XM4A 3KIIA 4EV5A 3CCV3 1RJOA 4AEQA 1KD14 1MNLA 1E3RA 2B24B 3VF1A 1W6YA 1TFKA 3BLZA 1WMPA 3CNXA 2JDIH 1SJWA 2E2VA 3JVCA 1VQ73 2A15A 3V98A 3LTBA 2OTL3 3V92A 2WGOA 4HM8B 1OF5A 1IT7A 2HMNB 3N9HA 4FMDA 1IVUA 1N9EA 2BHMA 1N9JA 1MOLA 2D42A 1D6UA 1JRQA 2JQ5A 3PYJA 5IF6A 1EA2A 1Y4KA 3BNCA 3GRDA 3SLUA 1O7GB 4STDA 3WDGB 1NJI4 1OHOA 2HMLB 2OWPA 5IW9A 3PGBA 3BNDA 5D81A 1TU5A 4L8OA 1DMQA 4IPBA 3FF2A 5KP1A 2O9UX 4QWTA 3TDGA 5FGOA 1OACA 2OCTA 1K734 4HBRA 2KRTA 1AR0A 3EBYA 3IMAB 3NUVA 5EEOA 3G4S3 1A90A 1OH0A 4MEIA 2ZDJA 2IUJA 4O2HA 1W00A 3DGMA 1LOXA 4KZ1A 5AIGA 2PZVA 1KWIA 1UI7A 3NBJA 4HM2B 1A67A 3DM8A 3MG3A 3CNMA 3GAXA 1O7HB 3CCL3 1M1K4 3EBTA 1SQWA 3AMOB 1EG9B 1YJN3 3B4PA 4HM7B 1NDOB 4RNYA 1US1A 1R4CA 1LVNA 1QVG2 3KN4A 4K1VA 2ML6A 3G8ZA 2GU3A 3OWYA 1VQP3 1UW1A 3CU3A 3BNEA 4OVMA 2GEXA 4N6OB 3GWRA 5TGNA 3BB9A 5IENA 3X3XA 1TUHA 3G0KA 1BUQA 2UX0A 1N5HA 3MSOA 3EQQB 4HZ9B 3FZWA 3JUPA 4EC6A 1GY5A 3QK9A 5AEUB 1AV4A 4NREA 2C10A 2GEYA 3B8LA 2ML5A 5IG5A 5AEWB 4N6LA 1O7WB 4K61A 2KXGA 5JPPA 3I563 1IQ8A 3K7CA 4N6MA 3F8XA 4X2OA 4HM5B 1N5PA 4R4KA 2O3OA 2YFJB 4KVHA 3G6E3 3KE7A 2V1LA 4JF8A 2Z6BA 1YIJ3 3MG2A 1OPYA 3FSDA 2OOVA 4MMYB 2Z76A 4H61A 1JJ22 3NBBA 1TIJA 2BMRB 3LYGA 1JNQA 1UI8A 4XBYA 3LTCA 3S28A 2QIYA 3X3ZA 1JN5B 1Q40A 3WODG 2E2TA 1FGRA 2QEX3 2HMOB 3NHXA 1K8A4 1RRLA 1FGTA 3Q2PA 3FF0A 2XRXB 4R9LA 2XFSA 3OWSA 1VQM3 1J2BA 1OGZA 2P38A 1PU4A 2CFGA 1VQL3 2CWTA 4LZIA 3M8CA 3EB8A 4IIAA 1W4NA 1TFOA 2P0XA 2OOVC 4OK0A 2FGTA 1W01A 4WYKB 2K54A 3JUQA 2P05A 1A2VA 3S67A 5EQLA 2C11A 7STDA 4HM4B 1ROAA 3RDEA 3QRDA 3DXOA 1FUWA 4LGQA 3FG3A 3SVAA 4N6TA 1DVDA 2WO0A 3MYTA 2XSHB 5FW5A 3S29A 3UNLA 1JB5A 1L5GB 3B4OA 3FLJA 4HVNA 1VZZA 2Y74A 3NBRA 1IK3A 3LTDA 3CCR3 2W56B 3KKGA 3WA2X 3CCJ3 5AI1A 3CPW2 1RRHA 1KSIA 3U97A 3JUOA 2D1WA 4HM3B 4GB5A 3LXUX 4J9AA 5AYRB 1NO3A 1S5AA 4L8PA 5JBSA 3N54B 2L4VA 5BXQA 3D9RA 1VQ53 4N3VA 1UUWB 3OV4A 1W6GA 4OUQA 1O7PB 1QVF2 3RGRA 1OGXA 1SIHA 1W02A 2W9QA 3IJEB 3LOYA 2CFLA 5I97A 3K63A 3PCSA 3EX9A 3NV0B 2CC3A 2SBLA 3HI7A 3HIIA 1K9M4 3DZLA 4WFOA 1Q7Y4 4MJDA 3EJVA 3EN8A 3JUMA 3JUNA 3FH1A 2XGNA 3LMLA 1N8R4 2WGQA 5LC6A 1C7HA 2CH9A 3MG1A 4HYZA 1WMOA 3FGYA 3I553 3K5TA 3LZAA 3X41A 1YVBI 3Q1CA 1GD4A 1K28A 4R1KA 3EE1A 1JB2A 1STFI 1UUVB 2RCDA 1LNHA 3DY5A 3NM7A 2GU1A 2XFTA 5ELJA 4CDLA 2BMQB 4RNZA 2Q07A 4O8SA 3HX8A 1IVVA 1Q824 4L7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CYU A;  1IV7 A;  3K9M C;  1TIJ A;  3KSE D;  1MNL A;  3KFQ C;  1FA3 A;  3PS8 A;  3Q2P A;  5ELU A;  3PXM A;  1LXE A;  4TX4 A;  5A0O B;  4CCV A;  4LZI A;  1N9J A;  1MOL A;  3PYJ A;  2W9P A;  1CEW I;  1NB5 I;  3S67 A;  5EQL A;  1ROA A;  3QRD A;  2O9U X;  1FUW A;  3SVA A;  2OCT A;  3L0R A;  4N6T A;  1A90 A;  3IMA B;  1DVD A;  1RN7 A;  4N6N B;  1KWI A;  3UL5 A;  1A67 A;  2BO9 B;  3GAX A;  1GD3 A;  1R4C A;  1M9G A;  1DVC A;  4ZM8 A;  2W9Q A;  4N6O B;  1NB3 I;  1PFP A;  3NX0 A;  3LH4 A;  1N5H A;  1EQK A;  5LC6 A;  4N6U A;  1CYV A;  2CH9 A;  1YVB I;  4N6L A;  1GD4 A;  2KXG A;  3MWZ A;  1G96 A;  5LC7 A;  1STF I;  1IV9 A;  4N6M A;  1WNH A;  3UL6 A;  5ELJ A;  1N5P A;  4EYC A;  4IT7 A;  4N6V 0; 
#chains in the Genus database with same CATH topology
 3CCU 3;  3WA3 A;  5KP3 A;  1IV7 A;  1W7C A;  3VSY A;  1RNT A;  2INX A;  3KSE D;  1WTH A;  3PZW A;  3BNB A;  1O7N B;  2F5M A;  3KSP A;  1K41 A;  3NV0 A;  5D83 A;  2HOH A;  8CHO A;  1ISK A;  4XBT A;  1ZX2 A;  5CXO A;  3SXX A;  1VQO 3;  1QJG A;  1QAL A;  1VQ8 3;  1ZO2 A;  3AGO A;  4FCJ A;  4J8T A;  3PS8 A;  4GSP A;  1Z1S A;  5IG4 A;  2CIU A;  3KZT A;  3AMO A;  1IVX A;  5ELU A;  1BNG A;  1DYU A;  1VQN 3;  1AVL A;  2ZHX B;  1LXE A;  3GZY B;  3MPH A;  4TX4 A;  3FCS B;  4HM1 B;  3K0Z A;  5A0O B;  5AII A;  2Z7A A;  3GZR A;  4CCV A;  3H3H A;  2XR8 B;  2CHC A;  3ALA A;  4HKV B;  2C4B A;  1JBT A;  4BTW A;  4MMZ B;  6STD A;  2CFD A;  5M1A A;  2GBW B;  3WMD A;  2CK3 H;  2CKF B;  7GSP A;  1X1W A;  1VQ6 3;  4XDW A;  5AYS C;  1W2Z A;  1UGI A;  2Y73 A;  1U5O A;  3T8U A;  3UB1 A;  8RNT A;  1W5Z A;  4AKZ A;  3NQY A;  2H0G A;  5CF2 A;  3WOE B;  2F98 A;  4U13 A;  1VQK 3;  1W2B 2;  2HMK B;  1I2F A;  3F7S A;  1RN7 A;  4O02 B;  1GYB A;  5AIF A;  3ZG0 A;  1BAN A;  3STD A;  4HAA A;  2OTJ 3;  1LOY A;  1BSC A;  2KF3 A;  1A2P A;  3VGN A;  1JKG B;  2FNQ A;  4J5K A;  1GY7 A;  2W2C A;  1YJW 3;  4ORL A;  2MF7 A;  2ZL8 A;  5IG3 A;  1KQS 2;  1GMP A;  5CF1 A;  1FYS A;  3CCS 3;  2GSP A;  5HGR A;  3Q90 A;  3CMA 3;  1LOW A;  3CCQ 3;  1IT8 A;  1OF5 B;  1RGG A;  3F40 A;  1Q86 4;  3O8Y A;  2OQE C;  4H3U A;  3CXC 2;  2L1S A;  4HJL B;  4LEH A;  5AIH A;  1M9G A;  3GZB A;  1TP6 A;  1V74 A;  2BNG A;  2GXF A;  1FGM A;  1SAR A;  4XDV A;  1DVC A;  1YGW A;  1YJ9 3;  1UCL A;  4I4K A;  3D3L A;  2KAA A;  4O3V A;  1NNV A;  4XB5 A;  1ULI B;  4BTX A;  2HMJ B;  2R4I A;  3X42 A;  4ZM8 A;  4AKY A;  3FG4 A;  4GHO A;  1DMN A;  3CME 3;  1JN5 A;  3SOA A;  2K3D A;  2CG0 A;  1BRH A;  2CX1 A;  3DGO A;  3DUK A;  3CD6 3;  2YX9 A;  1OHP A;  1VQ9 3;  3F14 A;  4FMB A;  1YI2 3;  1RGF A;  1LQG C;  3N8B A;  1OHS A;  2P09 A;  9RNT A;  3NX0 A;  1EKM A;  2M7O A;  4RNT A;  3LH4 A;  3CC4 3;  4KFE A;  1YGE A;  3AHW A;  1F8N A;  4R80 A;  1IDP A;  1EQK A;  1JKG A;  2FXT A;  3PCR A;  4N6U A;  3EN1 B;  3J7Y d;  1FGQ A;  2CFW A;  1LRA A;  1Q7H A;  3S27 A;  3H51 A;  4CPK A;  1R4Y A;  3X3Y A;  3RGA A;  1D6Z A;  4RBN A;  3MWZ A;  1G96 A;  4WYK A;  5M19 A;  1IV9 A;  1ASK A;  2I9W A;  1MGW A;  2KCD A;  1WNH A;  4KFD A;  3UJM A;  5KP4 A;  1RGH A;  3NM2 A;  1JB4 A;  3MKI A;  1DET A;  3URP A;  4EV2 A;  2BMO B;  5IEP A;  1WMN A;  2IA7 A;  1I2E A;  4WWU C;  1BAO A;  3EF8 A;  5IEO A;  1IYY A;  1U8C B;  5BIR A;  1B2M A;  1IQX A;  2CWU A;  5STD A;  2XH9 A;  3K9M C;  3X40 A;  3DMC A;  2IUK A;  2PNC A;  3U1W A;  3KFQ C;  1FGO A;  2E2U A;  4BIR A;  1CQS A;  1N8Q A;  1FA3 A;  2RGQ A;  1M1X B;  1M90 4;  3G16 A;  3ROB A;  1IQY A;  1FUT A;  4FCZ A;  2W56 A;  3SOY A;  3DGN A;  1QAF A;  3D4A A;  3SED A;  1Q81 4;  2GBX B;  1JV2 B;  3OX9 A;  4G1M B;  1MWR A;  2K0M A;  2R41 A;  1O7M B;  2W0Q A;  2RNT A;  3LTA A;  3T0U A;  3A76 A;  1Q42 A;  3PXM A;  1BNI A;  1FUS A;  3LT9 A;  4X2H A;  4PEJ A;  2WOH A;  1ULJ B;  3DGL A;  5D82 A;  3CCE 3;  1I3F A;  3F7X A;  2STD A;  4DKI A;  3CPO A;  4K90 B;  1JZD A;  3FG1 A;  1YVS A;  2XGL A;  3CC7 3;  1LOV A;  2W9P A;  1E97 A;  4RZM A;  3ZG5 A;  1CEW I;  3HOH A;  1S72 3;  2YFI B;  1Q9E A;  2XF3 A;  2CFK A;  1NB5 I;  3G71 3;  5CLK A;  1GSP A;  1QAK A;  1ROV A;  2IMJ A;  2W03 A;  4LMI A;  3WOF B;  3S5C A;  2RFR A;  3SX1 A;  4BU4 A;  3L0R A;  2WOF A;  5G2G A;  5IER A;  2IYJ A;  1LNI A;  1YHQ 3;  1HKX A;  3EHC A;  2LQV A;  2YFL B;  3HIG A;  5BVB A;  4N6N B;  2Z77 A;  4NHF A;  2F99 A;  3CCM 3;  1IVW A;  4HM0 B;  2LYX A;  1UGH I;  3UL5 A;  4CJN A;  2BO9 B;  1W6C A;  4FMC A;  1Q40 B;  2KF4 A;  1T5Y A;  1E3V A;  1BRI A;  4LSO A;  1OCV A;  3HZP A;  4XBX A;  1NWW A;  1ZGX A;  2XSO B;  3B7C A;  1B2Z A;  2HMM B;  1AVK A;  2BT3 A;  4K1U A;  1V58 A;  4BL3 A;  1GD3 A;  2W04 A;  2F4Y A;  5HOH A;  2B1X B;  2OQE A;  4EBG A;  4R9K A;  1GS3 A;  1OUN A;  1I70 A;  3GZX B;  2RSX A;  3Q3F A;  4FMA A;  1D6Y A;  1I8V A;  2QGU A;  5G1L A;  4KFF A;  1YIT 3;  1GY6 A;  1SII A;  4JRF A;  3NXJ A;  1WQL B;  1NU3 A;  1QMA A;  1TTO A;  4HZB B;  1DMM A;  4EXR A;  1NB3 I;  1RGE A;  5CK6 A;  1HU9 A;  1RKY A;  2CW9 A;  5DRE A;  1PFP A;  3E99 A;  3OXA A;  2BIR A;  2H0H A;  3NQZ A;  1VQ4 3;  4MMX B;  3CC2 3;  2QA4 3;  4WHA A;  1RN4 A;  5EVH A;  1AQZ A;  1TJD A;  3EC9 A;  3I0Y A;  4FCM A;  4FR9 A;  1B2S A;  1CYV A;  1KC8 4;  4GL6 A;  3OW2 2;  3OWU A;  1RGA A;  1STD A;  1A2K A;  2P0M A;  3IPT A;  3F9S A;  3T8N A;  2MC8 A;  1RGC A;  4HM6 B;  2W6J H;  5LC7 A;  5JPU A;  2XEP A;  3F8H A;  5DRV A;  3UL6 A;  3MHE A;  3ER7 A;  2CG1 A;  4EYC A;  3ECF A;  4Q53 A;  5IG0 A;  1MWS A;  4IT7 A;  3HK4 A;  4N6V 0;  1IU7 A;  1SPU A;  2F86 B;  3GSP A;  1JBS A;  2BU4 A;  1RHL A;  4KT3 B;  2CWV A;  3V99 A;  3LT8 A;  4WP5 A;  4BTY A;  1B20 A;  1I0V A;  3FKA A;  1CYU A;  4XM4 A;  3KII A;  4EV5 A;  3CCV 3;  1RJO A;  2KF6 A;  1BRK A;  3RNT A;  4AEQ A;  1KD1 4;  1BOX A;  1MNL A;  1E3R A;  2B24 B;  3VF1 A;  1W6Y A;  1TFK A;  3BLZ A;  1WMP A;  3CNX A;  1UCJ A;  1SJW A;  2JDI H;  2E2V A;  1B3S A;  3JVC A;  1VQ7 3;  2A15 A;  1RNB A;  3V98 A;  3LTB A;  2OTL 3;  5BU4 A;  3V92 A;  2WGO A;  6GSP A;  4HM8 B;  1BSD A;  1OF5 A;  2IY2 A;  1BIR A;  1BSB A;  1IT7 A;  2HMN B;  3N9H A;  4FMD A;  1IVU A;  1N9E A;  1T2H A;  2BHM A;  1RN1 A;  1N9J A;  1MOL A;  2D42 A;  1D6U A;  3DH2 A;  1JRQ A;  2JQ5 A;  3PYJ A;  1MGR A;  5IF6 A;  1EA2 A;  1Y4K A;  1I0X A;  3BNC A;  3GRD A;  3SLU A;  1O7G B;  4STD A;  3WDG B;  1NJI 4;  1OHO A;  1CH0 A;  2HML B;  1GOV A;  2OWP A;  5IW9 A;  3PGB A;  3BND A;  5D81 A;  1TU5 A;  4L8O A;  1RGL A;  1DMQ A;  3ZFZ A;  4IPB A;  3FF2 A;  5KP1 A;  1UUG B;  1BU4 A;  2O9U X;  4QWT A;  3TDG A;  5FGO A;  1OAC A;  2OCT A;  1K73 4;  1B27 A;  4HBR A;  2KRT A;  1AR0 A;  3EBY A;  3IMA B;  3NUV A;  5EEO A;  3G4S 3;  1JBR A;  1A90 A;  1OH0 A;  4MEI A;  2ZDJ A;  2IUJ A;  1JZO A;  1PY3 A;  4O2H A;  1W00 A;  3DGM A;  3SYU A;  1HYF A;  1LOX A;  4KZ1 A;  3BIR A;  5AIG A;  2PZV A;  1KWI A;  1UI7 A;  3NBJ A;  1HZ1 A;  3KCH A;  4HM2 B;  3WHO A;  1A67 A;  3DM8 A;  3MG3 A;  2ZA4 A;  3CNM A;  3GAX A;  1FW7 A;  1O7H B;  3CCL 3;  1FZU A;  1M1K 4;  3EBT A;  1SQW A;  1AY7 A;  1BSE A;  3AMO B;  1EG9 B;  1YJN 3;  3B4P A;  4HM7 B;  1BNF A;  1NDO B;  4BL2 A;  1ZS7 A;  4RNY A;  1US1 A;  1T2I A;  1R4C A;  1LVN A;  3BU4 A;  1QVG 2;  3KN4 A;  1BNE A;  4K1V A;  1G02 A;  2ML6 A;  3G8Z A;  2GU3 A;  3OWY A;  3D5G A;  1VQP 3;  1UW1 A;  3CU3 A;  3BNE A;  2J8X B;  4OVM A;  2GEX A;  4N6O B;  3GWR A;  2UUG C;  1EUI C;  5TGN A;  3BB9 A;  3D5I A;  5IEN A;  3X3X A;  4LYL B;  1TUH A;  3G0K A;  1BUQ A;  1BNJ A;  2UX0 A;  1N5H A;  3AHS A;  3EQQ B;  3MSO A;  4HZ9 B;  3FZW A;  3JUP A;  5G1K A;  4EC6 A;  1GY5 A;  3QK9 A;  2UGI A;  5AEU B;  1AV4 A;  1UDI I;  1MWU A;  4NRE A;  2C10 A;  2GEY A;  3B8L A;  2ML5 A;  5IG5 A;  5AEW B;  1BRJ A;  1RCK A;  4N6L A;  1O7W B;  4K61 A;  2KXG A;  5JPP A;  1VQQ A;  3I56 3;  1IQ8 A;  3K7C A;  4N6M A;  3F8X A;  4X2O A;  5M18 A;  4HM5 B;  1LQM B;  1N5P A;  4R4K A;  5GSP A;  2O3O A;  2YFJ B;  4KVH A;  3G6E 3;  3KE7 A;  2KF5 A;  2V1L A;  1GMQ A;  2Z6B A;  4JF8 A;  3MG2 A;  1YIJ 3;  1OPY A;  2F5W A;  3FSD A;  2OOV A;  4MMY B;  2Z76 A;  4HOH A;  4H61 A;  1JJ2 2;  7RNT A;  1MWT A;  3NBB A;  1TIJ A;  2BMR B;  3LYG A;  1JNQ A;  1RMS A;  1RSN A;  1UI8 A;  1YNV X;  4XBY A;  5RNT A;  3LTC A;  4EW5 A;  1EEJ A;  3S28 A;  2QIY A;  3X3Z A;  2CX0 A;  1JN5 B;  1Q40 A;  3WOD G;  1B21 A;  1X1Y A;  2E2T A;  1FGR A;  2QEX 3;  2HMO B;  3NHX A;  1K8A 4;  1RRL A;  1FGT A;  3Q2P A;  1TRP A;  3A5E A;  3DGY A;  3FF0 A;  2XRX B;  4R9L A;  1DE3 A;  2XFS A;  1RCL A;  3OWS A;  1VQM 3;  1J2B A;  1OGZ A;  2P38 A;  1PU4 A;  2CFG A;  1VQL 3;  2CWT A;  4LZI A;  3M8C A;  1C54 A;  3EB8 A;  4IIA A;  1W4N A;  2RBI A;  1TFO A;  2P0X A;  2OOV C;  4OK0 A;  2FGT A;  1RLS A;  1W01 A;  2K54 A;  1GOU A;  4WYK B;  3JUQ A;  2P05 A;  1A2V A;  3S67 A;  5EQL A;  1G0T A;  2C11 A;  7STD A;  4HM4 B;  1ROA A;  3RDE A;  3QRD A;  1BNS A;  3DXO A;  1FUW A;  4LGQ A;  3FG3 A;  3SVA A;  4N6T A;  1UCI A;  1V57 A;  3WR2 A;  1DVD A;  1BGS A;  1X1X A;  2WO0 A;  1T3B A;  3MYT A;  2XSH B;  5FW5 A;  1GOY A;  3S29 A;  2SAR A;  3UNL A;  1JB5 A;  1L5G B;  3B4O A;  1BVI A;  1BSA A;  3FLJ A;  4HVN A;  4I5Q A;  1VZZ A;  2Y74 A;  3NBR A;  1BUJ A;  4ILF A;  1IK3 A;  3LTD A;  3CCR 3;  1BNR A;  2W56 B;  3KKG A;  3WA2 X;  3CCJ 3;  5AI1 A;  3CPW 2;  1RRH A;  1KSI A;  3U97 A;  3JUO A;  2D1W A;  3D79 A;  4HM3 B;  1UCK A;  4GB5 A;  3LXU X;  1RGK A;  4J9A A;  5AYR B;  1NO3 A;  4NPB A;  1S5A A;  4L8P A;  5JBS A;  3N54 B;  2L4V A;  5BXQ A;  3D9R A;  1VQ5 3;  4N3V A;  1UUW B;  3OV4 A;  1W6G A;  4OUQ A;  6RNT A;  1O7P B;  1X1U A;  1QVF 2;  4J5G A;  3RGR A;  1OGX A;  1SIH A;  1W02 A;  2W9Q A;  3IJE B;  1I2G A;  3LOY A;  2CFL A;  5I97 A;  3K63 A;  3PCS A;  3EX9 A;  3NV0 B;  2CC3 A;  1TRQ A;  2SBL A;  3HI7 A;  3HII A;  1K9M 4;  3AGN A;  3DZL A;  4WFO A;  1Q7Y 4;  2H0I A;  4MJD A;  3EJV A;  1B2U A;  3EN8 A;  3JUM A;  3JUN A;  3FH1 A;  2XGN A;  3LML A;  1N8R 4;  1PYL A;  2WGQ A;  2AAE A;  1BRG A;  5LC6 A;  1C7H A;  1GMR A;  1RDS A;  2CH9 A;  3MG1 A;  4HYZ A;  1WMO A;  3FGY A;  3I55 3;  3K5T A;  3LZA A;  3X41 A;  1YVB I;  3Q1C A;  1I3I A;  1RTU A;  1GD4 A;  1K28 A;  1B2X A;  4R1K A;  3EE1 A;  1JB2 A;  1STF I;  1UUV B;  1BRS A;  2RCD A;  1LNH A;  2AAD A;  3DY5 A;  2GU1 A;  3NM7 A;  2XFT A;  5ELJ A;  4CDL A;  2BMQ B;  4RNZ A;  2F56 A;  2Q07 A;  3HX8 A;  4O8S A;  1IVV A;  1Q82 4;  4L7K A;  1BRN L; 
#chains in the Genus database with same CATH homology
 3CCU 3;  3WA3 A;  5KP3 A;  1IV7 A;  1W7C A;  3VSY A;  2INX A;  3KSE D;  1WTH A;  3PZW A;  3BNB A;  1O7N B;  3KSP A;  3NV0 A;  1K41 A;  5D83 A;  8CHO A;  1ISK A;  4XBT A;  1ZX2 A;  5CXO A;  3SXX A;  1VQO 3;  1QJG A;  1QAL A;  1VQ8 3;  1ZO2 A;  4FCJ A;  4J8T A;  3PS8 A;  1Z1S A;  5IG4 A;  2CIU A;  3KZT A;  3AMO A;  1IVX A;  5ELU A;  1VQN 3;  1DYU A;  1AVL A;  1LXE A;  3GZY B;  3MPH A;  4TX4 A;  3FCS B;  4HM1 B;  3K0Z A;  5A0O B;  5AII A;  2Z7A A;  3GZR A;  4CCV A;  3H3H A;  2XR8 B;  2CHC A;  3ALA A;  4HKV B;  4BTW A;  4MMZ B;  6STD A;  2CFD A;  2GBW B;  3WMD A;  2CK3 H;  2CKF B;  1VQ6 3;  4XDW A;  5AYS C;  1W2Z A;  2Y73 A;  1U5O A;  3T8U A;  3UB1 A;  1W5Z A;  4AKZ A;  3NQY A;  5CF2 A;  3WOE B;  2F98 A;  4U13 A;  1VQK 3;  1W2B 2;  2HMK B;  3F7S A;  1RN7 A;  4O02 B;  1GYB A;  5AIF A;  3STD A;  2OTJ 3;  3VGN A;  1JKG B;  2FNQ A;  1GY7 A;  2W2C A;  1YJW 3;  4ORL A;  2MF7 A;  2ZL8 A;  5IG3 A;  1KQS 2;  5CF1 A;  3CCS 3;  5HGR A;  3Q90 A;  3CMA 3;  3CCQ 3;  1IT8 A;  1OF5 B;  3F40 A;  1Q86 4;  3O8Y A;  2OQE C;  4H3U A;  3CXC 2;  4HJL B;  4LEH A;  5AIH A;  1M9G A;  3GZB A;  1TP6 A;  1V74 A;  2BNG A;  2GXF A;  1FGM A;  4XDV A;  1DVC A;  1YJ9 3;  4I4K A;  3D3L A;  4O3V A;  4XB5 A;  1ULI B;  4BTX A;  2HMJ B;  2R4I A;  3X42 A;  4ZM8 A;  4AKY A;  3FG4 A;  1DMN A;  3CME 3;  1JN5 A;  3SOA A;  2CG0 A;  3DGO A;  3CD6 3;  3DUK A;  2YX9 A;  1OHP A;  1VQ9 3;  3F14 A;  4FMB A;  1YI2 3;  3N8B A;  1OHS A;  2P09 A;  3NX0 A;  1EKM A;  2M7O A;  3LH4 A;  3CC4 3;  4KFE A;  1YGE A;  1F8N A;  4R80 A;  1IDP A;  1EQK A;  1JKG A;  2FXT A;  3PCR A;  4N6U A;  3EN1 B;  3J7Y d;  1FGQ A;  2CFW A;  3S27 A;  3H51 A;  3X3Y A;  3RGA A;  1D6Z A;  4RBN A;  3MWZ A;  1G96 A;  4WYK A;  1IV9 A;  1ASK A;  2I9W A;  2KCD A;  1WNH A;  4KFD A;  3UJM A;  5KP4 A;  3NM2 A;  1JB4 A;  3MKI A;  4EV2 A;  2BMO B;  5IEP A;  1WMN A;  2IA7 A;  4WWU C;  3EF8 A;  5IEO A;  1U8C B;  1IQX A;  2CWU A;  5STD A;  2XH9 A;  3K9M C;  3X40 A;  3DMC A;  2IUK A;  2PNC A;  3U1W A;  3KFQ C;  1FGO A;  2E2U A;  1CQS A;  1N8Q A;  1FA3 A;  2RGQ A;  1M1X B;  1M90 4;  3G16 A;  3ROB A;  1IQY A;  4FCZ A;  3SOY A;  2W56 A;  3DGN A;  1QAF A;  3SED A;  1Q81 4;  2GBX B;  1JV2 B;  3OX9 A;  4G1M B;  2K0M A;  2W0Q A;  1O7M B;  3LTA A;  3T0U A;  3A76 A;  1Q42 A;  3PXM A;  3LT9 A;  4X2H A;  4PEJ A;  2WOH A;  1ULJ B;  3DGL A;  5D82 A;  3CCE 3;  3F7X A;  2STD A;  3CPO A;  4K90 B;  3FG1 A;  2XGL A;  3CC7 3;  2W9P A;  1E97 A;  4RZM A;  1CEW I;  1S72 3;  2YFI B;  2XF3 A;  2CFK A;  1NB5 I;  3G71 3;  5CLK A;  1ROV A;  1QAK A;  2IMJ A;  2W03 A;  4LMI A;  3WOF B;  3S5C A;  2RFR A;  3SX1 A;  3L0R A;  2WOF A;  5G2G A;  5IER A;  1YHQ 3;  1HKX A;  3EHC A;  2LQV A;  2YFL B;  3HIG A;  5BVB A;  4N6N B;  2Z77 A;  4NHF A;  2F99 A;  3CCM 3;  1IVW A;  4HM0 B;  2LYX A;  3UL5 A;  2BO9 B;  1W6C A;  4FMC A;  1Q40 B;  1T5Y A;  1E3V A;  4LSO A;  1OCV A;  3HZP A;  4XBX A;  1NWW A;  2XSO B;  3B7C A;  2HMM B;  1AVK A;  2BT3 A;  4K1U A;  1GD3 A;  2W04 A;  2B1X B;  2OQE A;  4EBG A;  4R9K A;  1GS3 A;  1OUN A;  3GZX B;  2RSX A;  4FMA A;  1D6Y A;  2QGU A;  1YIT 3;  4KFF A;  1GY6 A;  1SII A;  4JRF A;  3NXJ A;  1WQL B;  1NU3 A;  1QMA A;  4HZB B;  1DMM A;  4EXR A;  1NB3 I;  1RKY A;  5CK6 A;  1HU9 A;  2CW9 A;  5DRE A;  1PFP A;  3E99 A;  3OXA A;  3NQZ A;  1VQ4 3;  4MMX B;  3CC2 3;  2QA4 3;  4WHA A;  5EVH A;  3I0Y A;  3EC9 A;  4FCM A;  4FR9 A;  1CYV A;  1KC8 4;  4GL6 A;  3OW2 2;  3OWU A;  1STD A;  1A2K A;  2P0M A;  3IPT A;  3F9S A;  3T8N A;  2MC8 A;  4HM6 B;  2W6J H;  5LC7 A;  5JPU A;  2XEP A;  3F8H A;  5DRV A;  3UL6 A;  3MHE A;  3ER7 A;  2CG1 A;  4EYC A;  3ECF A;  4Q53 A;  5IG0 A;  4IT7 A;  3HK4 A;  4N6V 0;  1IU7 A;  1SPU A;  2F86 B;  3V99 A;  2CWV A;  3LT8 A;  4WP5 A;  4BTY A;  3FKA A;  1CYU A;  4XM4 A;  3KII A;  4EV5 A;  3CCV 3;  1RJO A;  4AEQ A;  1KD1 4;  1MNL A;  1E3R A;  2B24 B;  3VF1 A;  1W6Y A;  1TFK A;  3BLZ A;  1WMP A;  3CNX A;  2JDI H;  1SJW A;  2E2V A;  3JVC A;  1VQ7 3;  2A15 A;  3V98 A;  3LTB A;  2OTL 3;  3V92 A;  2WGO A;  4HM8 B;  1OF5 A;  1IT7 A;  2HMN B;  3N9H A;  4FMD A;  1IVU A;  1N9E A;  2BHM A;  1N9J A;  1MOL A;  2D42 A;  1D6U A;  1JRQ A;  2JQ5 A;  3PYJ A;  5IF6 A;  1EA2 A;  1Y4K A;  3BNC A;  3GRD A;  3SLU A;  1O7G B;  4STD A;  3WDG B;  1NJI 4;  1OHO A;  2HML B;  2OWP A;  5IW9 A;  3PGB A;  3BND A;  5D81 A;  1TU5 A;  4L8O A;  1DMQ A;  4IPB A;  3FF2 A;  5KP1 A;  2O9U X;  4QWT A;  3TDG A;  5FGO A;  1OAC A;  2OCT A;  1K73 4;  4HBR A;  2KRT A;  1AR0 A;  3EBY A;  3IMA B;  3NUV A;  5EEO A;  3G4S 3;  1A90 A;  1OH0 A;  4MEI A;  2ZDJ A;  2IUJ A;  4O2H A;  1W00 A;  3DGM A;  1LOX A;  4KZ1 A;  5AIG A;  2PZV A;  1KWI A;  1UI7 A;  3NBJ A;  4HM2 B;  1A67 A;  3DM8 A;  3MG3 A;  3CNM A;  3GAX A;  1O7H B;  3CCL 3;  1M1K 4;  3EBT A;  1SQW A;  3AMO B;  1EG9 B;  1YJN 3;  3B4P A;  4HM7 B;  1NDO B;  4RNY A;  1US1 A;  1R4C A;  1LVN A;  1QVG 2;  3KN4 A;  4K1V A;  2ML6 A;  3G8Z A;  2GU3 A;  3OWY A;  1VQP 3;  1UW1 A;  3CU3 A;  3BNE A;  4OVM A;  2GEX A;  4N6O B;  3GWR A;  5TGN A;  3BB9 A;  5IEN A;  3X3X A;  1TUH A;  3G0K A;  1BUQ A;  2UX0 A;  1N5H A;  3MSO A;  3EQQ B;  4HZ9 B;  3FZW A;  3JUP A;  4EC6 A;  1GY5 A;  3QK9 A;  5AEU B;  1AV4 A;  4NRE A;  2C10 A;  2GEY A;  3B8L A;  2ML5 A;  5IG5 A;  5AEW B;  4N6L A;  1O7W B;  4K61 A;  2KXG A;  5JPP A;  3I56 3;  1IQ8 A;  3K7C A;  4N6M A;  3F8X A;  4X2O A;  4HM5 B;  1N5P A;  4R4K A;  2O3O A;  2YFJ B;  4KVH A;  3G6E 3;  3KE7 A;  2V1L A;  4JF8 A;  2Z6B A;  1YIJ 3;  3MG2 A;  1OPY A;  3FSD A;  2OOV A;  4MMY B;  2Z76 A;  4H61 A;  1JJ2 2;  3NBB A;  1TIJ A;  2BMR B;  3LYG A;  1JNQ A;  1UI8 A;  4XBY A;  3LTC A;  3S28 A;  2QIY A;  3X3Z A;  1JN5 B;  1Q40 A;  3WOD G;  2E2T A;  1FGR A;  2QEX 3;  2HMO B;  3NHX A;  1K8A 4;  1RRL A;  1FGT A;  3Q2P A;  3FF0 A;  2XRX B;  4R9L A;  2XFS A;  3OWS A;  1VQM 3;  1J2B A;  1OGZ A;  2P38 A;  1PU4 A;  2CFG A;  1VQL 3;  2CWT A;  4LZI A;  3M8C A;  3EB8 A;  4IIA A;  1W4N A;  1TFO A;  2P0X A;  2OOV C;  4OK0 A;  2FGT A;  1W01 A;  4WYK B;  2K54 A;  3JUQ A;  2P05 A;  1A2V A;  3S67 A;  5EQL A;  2C11 A;  7STD A;  4HM4 B;  1ROA A;  3RDE A;  3QRD A;  3DXO A;  1FUW A;  4LGQ A;  3FG3 A;  3SVA A;  4N6T A;  1DVD A;  2WO0 A;  3MYT A;  2XSH B;  5FW5 A;  3S29 A;  3UNL A;  1JB5 A;  1L5G B;  3B4O A;  3FLJ A;  4HVN A;  1VZZ A;  2Y74 A;  3NBR A;  1IK3 A;  3LTD A;  3CCR 3;  2W56 B;  3KKG A;  3WA2 X;  3CCJ 3;  5AI1 A;  3CPW 2;  1RRH A;  1KSI A;  3U97 A;  3JUO A;  2D1W A;  4HM3 B;  4GB5 A;  3LXU X;  4J9A A;  5AYR B;  1NO3 A;  1S5A A;  4L8P A;  5JBS A;  3N54 B;  2L4V A;  5BXQ A;  3D9R A;  1VQ5 3;  4N3V A;  1UUW B;  3OV4 A;  1W6G A;  4OUQ A;  1O7P B;  1QVF 2;  3RGR A;  1OGX A;  1SIH A;  1W02 A;  2W9Q A;  3IJE B;  3LOY A;  2CFL A;  5I97 A;  3K63 A;  3PCS A;  3EX9 A;  3NV0 B;  2CC3 A;  2SBL A;  3HI7 A;  3HII A;  1K9M 4;  3DZL A;  4WFO A;  1Q7Y 4;  4MJD A;  3EJV A;  3EN8 A;  3JUM A;  3JUN A;  3FH1 A;  2XGN A;  3LML A;  1N8R 4;  2WGQ A;  5LC6 A;  1C7H A;  2CH9 A;  3MG1 A;  4HYZ A;  1WMO A;  3FGY A;  3I55 3;  3K5T A;  3LZA A;  3X41 A;  1YVB I;  3Q1C A;  1GD4 A;  1K28 A;  4R1K A;  3EE1 A;  1JB2 A;  1STF I;  1UUV B;  2RCD A;  1LNH A;  3DY5 A;  3NM7 A;  2GU1 A;  2XFT A;  5ELJ A;  4CDL A;  2BMQ B;  4RNZ A;  2Q07 A;  4O8S A;  3HX8 A;  1IVV A;  1Q82 4;  4L7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...