1STFI

The refined 2.4 angstroms x-ray crystal structure of recombinant human stefin b in complex with the cysteine proteinase papain: a novel type of proteinase inhibitor interaction
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
MMSGAPSATQPATAETQHIADQVRSQLEEKYNKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The refined 2.4 A X-ray crystal structure of recombinant human stefin B in complex with the cysteine proteinase papain: a novel type of proteinase inhibitor interaction.
pubmed rcsb
molecule keywords PAPAIN
molecule tags Hydrolase(sulfhydryl proteinase)
source organism Carica papaya
total genus 21
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1993-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1stfI00
1CEWI 1MOLA 2W9QA 4N6NB 3NX0A 3LH4A 5EQLA 1DVCA 2W9PA 2O9UX 2BO9B 3PYJA 4ZM8A 1GD4A 1G96A 5ELJA 4CCVA 5ELUA 4IT7A 1KWIA 1EQKA 1YVBI 1TIJA 4N6MA 1A90A 3UL5A 1A67A 2CH9A 1LXEA 1MNLA 1R4CA 5LC6A 3S67A 1FA3A 3QRDA 4N6V0 1FUWA 4N6LA 4N6TA 5LC7A 1WNHA 1N5PA 1PFPA 3KFQC 3SVAA 2KXGA 4EYCA 3PXMA 4LZIA 4N6OB 3MWZA 1ROAA 1NB5I 1RN7A 2OCTA 3IMAB 3Q2PA 5A0OB 1IV9A 1DVDA 3K9MC 1STFI 4TX4A 3GAXA 1N5HA 1CYVA 1N9JA 4N6UA 3UL6A 1CYUA 1GD3A 1NB3I 1IV7A 1M9GA 3PS8A 3KSED 3L0RA
chains in the Genus database with same CATH superfamily
4RNTA 1GSPA 4AKZA 4R80A 1MOLA 1BRIA 1T3BA 1VQM3 2W9QA 4N6NB 5CF1A 4KFDA 1UUWB 4RZMA 1UGIA 2GU1A 3D5GA 2P0MA 5EQLA 4KT3B 1VQK3 1IVUA 4BTXA 4HM1B 1W01A 6GSPA 1IQXA 3KZTA 4FMDA 1SARA 3DGOA 1JBRA 2C4BA 3EX9A 2CWVA 1Q40A 1GYBA 4O02B 3FCSB 1FZUA 3MPHA 4XM4A 4BL2A 3AMOB 5D82A 3RGAA 1BSBA 1FUSA 3NM7A 1JBTA 1LOYA 4WP5A 2D42A 3OV4A 1UGHI 5HOHA 3DGMA 1B27A 1PY3A 2R4IA 4HM0B 4K1UA 3Q3FA 5M1AA 1TUHA 1BANA 3PGBA 1VQN3 2P09A 1DE3A 4XBXA 3DM8A 2GEXA 5FGOA 1RNBA 6STDA 3LT9A 1PU4A 3NV0B 1IQ8A 1W00A 1W5ZA 2F5WA 3CCS3 3D9RA 3CCL3 1GY6A 4BTWA 1JJ22 3F14A 4EV5A 1KD14 3JUNA 1IU7A 3HIIA 2RBIA 2AADA 4N6MA 3A5EA 4OVMA 3UL5A 2KF4A 5IW9A 1A67A 1YVSA 3FH1A 4EBGA 3GSPA 1MNLA 4HM2B 1B3SA 2P05A 5LC6A 3X41A 3S67A 4STDA 1S5AA 4MMXB 1Q7Y4 1Q864 3S5CA 1JB5A 5CLKA 1RGEA 1LVNA 2Z6BA 4HKVB 5CXOA 3BLZA 1GMPA 5GSPA 3AHSA 1RGHA 5D83A 1FGOA 3FF2A 2HMOB 1RMSA 1TTOA 1L5GB 5LC7A 1VQ73 1WNHA 1N5PA 4WYKB 1BRGA 1PFPA 2YFLB 1AR0A 2CFKA 2F99A 5IG3A 2IMJA 1SIIA 3RDEA 3T8NA 1PYLA 3KSPA 3AGNA 3X42A 2C11A 1DMNA 2ZDJA 2IUJA 3AMOA 5AIHA 3LTAA 1NB5I 2UGIA 1FW7A 1GMQA 1GY5A 2Z77A 1K8A4 4CJNA 5A0OB 1Q814 2BMQB 2K54A 3EBYA 5BU4A 4IIAA 2GEYA 3GAXA 3HI7A 3NV0A 1IVVA 2CG0A 2CHCA 4IPBA 3ROBA 1N5HA 1IT7A 2D1WA 4N6UA 1D6ZA 1IT8A 4OK0A 1QVF2 1BNFA 4CDLA 7RNTA 2RGQA 3EJVA 3A76A 3VF1A 1BNRA 3LTBA 2BMOB 1NU3A 3JUOA 1E97A 1VQ93 1GD3A 1I2GA 2Y73A 3EN1B 1UI7A 3FG4A 3LYGA 3NBRA 4QWTA 1M904 2F4YA 2P38A 2PNCA 3EC9A 4OUQA 3EHCA 5CK6A 3S27A 5TGNA 4MEIA 3GZBA 9RNTA 5I97A 3LT8A 1AY7A 2M7OA 1N8R4 1Q7HA 1TP6A 2OOVA 3URPA 5AI1A 1VQ53 1W6CA 2FGTA 1UUVB 2JQ5A 2WGOA 4G1MB 1YIJ3 3AHWA 3VGNA 3K0ZA 4WYKA 2E2TA 3WR2A 4XDVA 3CXC2 2HMKB 5IG5A 3LOYA 2W56B 1KSIA 1NJI4 1UCKA 3WOEB 3WODG 1RLSA 1S723 1JB4A 1UI8A 1FYSA 1BNGA 3OWSA 3NUVA 1NNVA 3STDA 3G713 4HM7B 3PYJA 1I2EA 2CG1A 2UX0A 3PCRA 1U5OA 1A2VA 3WOFB 1BUQA 4PEJA 1W2ZA 1K9M4 1JV2B 1MWSA 1W4NA 3CC23 4K90B 4ZM8A 3UB1A 1VQ83 3OX9A 3F7SA 4JF8A 1BAOA 2GU3A 3D4AA 3G6E3 1G0TA 1OPYA 1O7WB 3ZG5A 1Q9EA 1B2SA 2ML5A 2Z7AA 2P0XA 3N9HA 1MWTA 2CW9A 5AYRB 1VQL3 1KWIA 1GMRA 3BNDA 1LOXA 2WGQA 2YFJB 4I4KA 1GY7A 5EVHA 1SJWA 3SOYA 1EQKA 1AVLA 1JZOA 1JRQA 1MWUA 4U13A 3ER7A 1TU5A 2HMJB 5IF6A 4KFFA 4BTYA 8RNTA 2FXTA 4J8TA 1RGCA 3LZAA 2I9WA 3U1WA 1D6YA 4HJLB 4BL3A 1NO3A 3Q90A 1W6GA 1N9EA 4GL6A 2STDA 3JVCA 1FA3A 3FG1A 2E2VA 3CMA3 2LQVA 4AKYA 1JN5B 1WMNA 1NDOB 1VQ63 1EG9B 2QIYA 3G0KA 3GWRA 3B7CA 1I8VA 1X1XA 4FCZA 2XGNA 1AV4A 1OHSA 2XGLA 3BIRA 4RNZA 3NXJA 1BIRA 4I5QA 1OH0A 1Z1SA 2W56A 2IUKA 3M8CA 1IVWA 3QK9A 1BRJA 3MG3A 4H61A 5FW5A 1JBSA 2XR8B 3GZYB 1FGMA 3CC73 2KF5A 3D79A 1I0XA 1VQP3 1N8QA 4R4KA 3CME3 3WA3A 1K41A 1OHPA 2F56A 1WMPA 1K28A 2CFGA 2KXGA 1RSNA 4HZ9B 1ZO2A 4RNYA 1FGTA 3DUKA 5STDA 1G02A 3KIIA 1X1YA 1ROAA 1T5YA 1JB2A 3O8YA 1AVKA 3DGLA 3X40A 1OGXA 2WOFA 4J9AA 1RCLA 2B1XB 1EEJA 1RN7A 4XBTA 5G1KA 3SLUA 1IYYA 3FSDA 3IMAB 3Q2PA 3KE7A 5EEOA 4LSOA 1V58A 3PCSA 1C7HA 3CD63 3I553 2WO0A 1BOXA 2XFTA 3K5TA 1DVDA 1STFI 2JDIH 4TX4A 2OQEA 3CU3A 5KP4A 2BIRA 2CFWA 1RCKA 4J5KA 3CCM3 5M19A 1MWRA 2RSXA 4EV2A 1RRLA 1VQ43 1D6UA 3MG2A 1X1WA 1I3FA 3OWYA 1GOYA 4NHFA 3CPOA 1CYUA 3CNMA 1EUIC 1UUGB 4FMCA 3MG1A 3EE1A 5CF2A 5AIIA 1NB3I 4JRFA 1RTUA 3NQYA 1IV7A 1JN5A 1V57A 2CX0A 3LTCA 2ZA4A 1QVG2 3X3YA 1CH0A 1DMQA 2L4VA 3KSED 2IY2A 1I2FA 3L0RA 3CCJ3 3K63A 2IYJA 2F98A 4NREA 5G1LA 3IJEB 2CKFB 2KCDA 1CEWI 1DYUA 3EN8A 4WFOA 1BUJA 1MGRA 1YGEA 3GRDA 3EQQB 3SX1A 2HMMB 1YNVX 3D3LA 4MMYB 3B8LA 1SPUA 3GZXB 4HM6B 3H3HA 2GXFA 1BNSA 1RGKA 3I0YA 1IDPA 1B20A 3UJMA 1Q42A 3K7CA 4LYLB 5D81A 3WMDA 3FGYA 1SIHA 2KF6A 7STDA 2W04A 1ZS7A 2ZHXB 2OQEC 1VZZA 5BVBA 2RNTA 4LGQA 1WTHA 1HKXA 5DREA 2CFDA 3F8XA 1YJN3 1OCVA 1BSCA 1RN4A 3N8BA 2W6JH 1BRKA 1FUTA 1NWWA 1WQLB 1X1UA 4FCMA 4HM8B 2O3OA 1RGFA 1GD4A 3ECFA 1G96A 5ELJA 1LQMB 1OHOA 2B24B 4NPBA 2H0HA 4CCVA 2SBLA 3OW22 3NQZA 3SEDA 1US1A 2HOHA 2PZVA 3NBBA 3CCR3 2SARA 3F40A 3MKIA 1Y4KA 1BGSA 1HU9A 1QALA 3MHEA 4HYZA 3V99A 1ULIB 3HX8A 2CWUA 4KZ1A 1A90A 2Z76A 3G16A 3X3XA 2FNQA 3V98A 4K61A 4HZBB 1IQYA 1LNHA 3E99A 3SYUA 1R4YA 4R1KA 4HAAA 2F86B 2GSPA 2F5MA 2XRXB 3BU4A 4N6V0 1LQGC 1EKMA 1VQQA 1W6YA 2INXA 3DXOA 3Q1CA 1DETA 2RFRA 3B4OA 4GB5A 4N6LA 5JBSA 4XB5A 1TRQA 1BRHA 3KCHA 1U8CB 1W02A 1QMAA 5IEPA 2V1LA 1LRAA 2GBXB 4HBRA 1JKGB 3CCQ3 1GOVA 1TFOA 2XH9A 4GSPA 4N6OB 2J8XB 5IENA 5AIFA 3T0UA 1I70A 1Q824 1UDII 2OOVC 1MGWA 4N3VA 5IG0A 3T8UA 1RGAA 1CQSA 1F8NA 2OCTA 3S29A 7GSPA 3WHOA 2ML6A 3JUMA 1J2BA 3LMLA 1OF5B 2XFSA 1UCLA 1RKYA 3KKGA 1TFKA 3ZFZA 1GS3A 2BMRB 3K9MC 1B2UA 4O2HA 1RRHA 3HOHA 4R9LA 1RN1A 4O8SA 2MF7A 1T2IA 1BSEA 1LOWA 2CC3A 3CNXA 3NM2A 3SOAA 5AEUB 2K3DA 1K734 4FR9A 2CWTA 3ALAA 3GZRA 5IG4A 1ROVA 1ZGXA 1RJOA 1B21A 1A2PA 1CYVA 1N9JA 5AYSC 2CIUA 1RGLA 3WDGB 4WWUC 1HZ1A 5KP3A 3F8HA 1FGRA 1O7PB 1O7GB 1TRPA 2CX1A 3JUPA 3EF8A 3OWUA 4KFEA 4H3UA 5G2GA 1STDA 3IPTA 1RHLA 2BNGA 3CC43 1M9GA 2MC8A 3TDGA 1M1XB 3NBJA 2K0MA 4FMAA 1BNEA 4HOHA 3JUQA 3U97A 4BU4A 4XBYA 4XDWA 3HIGA 3RGRA 1YJW3 3PZWA 1ASKA 1BRSA 4RBNA 4EW5A 2H0GA 5KP1A 4LEHA 2HMLB 2XF3A 3FKAA 1BNJA 2QGUA 2Y74A 3NX0A 1B2MA 3LH4A 3BNEA 3BB9A 1DVCA 1O7HB 1I3IA 1OUNA 1T2HA 1JKGA 2W9PA 3V92A 3ZG0A 3HK4A 2O9UX 2W0QA 4L8PA 3H51A 1W7CA 1A2KA 2BO9B 1JZDA 2KF3A 2XSHB 4MJDA 1VQO3 2QEX3 4ILFA 1ZX2A 3N54B 2L1SA 1BSDA 1OF5A 4Q53A 5IERA 1KQS2 3CPW2 3CCV3 4FMBA 1M1K4 2YX9A 3UNLA 3NHXA 3D5IA 3FF0A 1C54A 4BIRA 2LYXA 3DGNA 3FG3A 3B4PA 5ELUA 4AEQA 1BVIA 1UCIA 2KAAA 4IT7A 3CCE3 2CK3H 1YIT3 1ISKA 3FZWA 3RNTA 1YVBI 1ULJB 2IA7A 2OTL3 1TIJA 1BNIA 2BHMA 2GBWB 2OTJ3 1QAKA 1JNQA 1QJGA 6RNTA 4X2HA 4KVHA 3DMCA 3VSYA 1KC84 1V74A 5M18A 1TJDA 3J7Yd 2BT3A 2AAEA 3KN4A 1LOVA 2CH9A 1LXEA 3SXXA 1R4CA 4EC6A 3G4S3 2WOHA 3QRDA 2QA43 1DMMA 1FUWA 4J5GA 4HM4B 5DRVA 2XEPA 1B2ZA 1LNIA 1OACA 2OWPA 3LTDA 4N6TA 3DGYA 3EBTA 4L7KA 2A15A 1AQZA 1FGQA 2CFLA 4ORLA 5JPPA 1YJ93 4K1VA 1I0VA 3CCU3 5JPUA 3BNCA 3EB8A 2HMNB 2XSOB 3KFQC 5BXQA 3SVAA 1RDSA 1UW1A 3LXUX 3AGOA 4GHOA 4EYCA 1IK3A 3PXMA 3MSOA 1O7MB 3MYTA 4LZIA 4L8OA 1OGZA 3MWZA 2UUGC 3HZPA 4R9KA 3DH2A 1RGGA 3F9SA 1Q40B 1SQWA 3F7XA 2H0IA 2E2UA 1IV9A 4HM5B 1GOUA 3WA2X 5BIRA 2KRTA 5AEWB 4WHAA 1QAFA 1BU4A 1YGWA 1WMOA 4O3VA 1E3VA 1B2XA 3S28A 1YI23 2RCDA 1RNTA 5AIGA 2Q07A 4MMZB 3UL6A 2ZL8A 4CPKA 3DZLA 3DY5A 3I563 5RNTA 2C10A 1BSAA 2BU4A 1HYFA 4FCJA 2W03A 1W2B2 1EA2A 3G8ZA 2YFIB 4X2OA 1O7NB 4EXRA 1IVXA 1UCJA 3FLJA 3OXAA 5HGRA 4DKIA 1BRNL 1YHQ3 4HVNA 2W2CA 1E3RA 3PS8A 4HM3B 2R41A 3BNBA 4LMIA 3X3ZA 5IEOA 8CHOA
chains in the Genus database with same CATH topology
4AKZA 4R80A 1MOLA 1VQM3 2W9QA 4N6NB 5CF1A 4KFDA 1UUWB 4RZMA 5EQLA 2GU1A 2P0MA 1VQK3 1IVUA 4BTXA 4HM1B 1W01A 1IQXA 3KZTA 4FMDA 3DGOA 3EX9A 2CWVA 1Q40A 1GYBA 4O02B 3FCSB 3MPHA 4XM4A 3AMOB 5D82A 3RGAA 3NM7A 4WP5A 2D42A 3OV4A 3DGMA 2R4IA 4HM0B 4K1UA 1TUHA 3PGBA 1VQN3 2P09A 4XBXA 3DM8A 2GEXA 5FGOA 6STDA 3LT9A 1PU4A 3NV0B 1IQ8A 1W00A 1W5ZA 3CCS3 3D9RA 3CCL3 1GY6A 4BTWA 1JJ22 3F14A 4EV5A 1KD14 3JUNA 1IU7A 3HIIA 4N6MA 4OVMA 3UL5A 5IW9A 1A67A 3FH1A 4EBGA 1MNLA 4HM2B 2P05A 5LC6A 3X41A 3S67A 4STDA 1S5AA 4MMXB 1Q7Y4 1Q864 3S5CA 1JB5A 5CLKA 1LVNA 2Z6BA 4HKVB 5CXOA 3BLZA 5D83A 1FGOA 3FF2A 2HMOB 1L5GB 5LC7A 1VQ73 1WNHA 1N5PA 4WYKB 1PFPA 2YFLB 1AR0A 2CFKA 2F99A 5IG3A 2IMJA 1SIIA 3RDEA 3T8NA 3KSPA 3X42A 2C11A 1DMNA 2ZDJA 2IUJA 3AMOA 5AIHA 3LTAA 1NB5I 1GY5A 2Z77A 1K8A4 5A0OB 1Q814 2BMQB 2K54A 3EBYA 4IIAA 2GEYA 3GAXA 3HI7A 3NV0A 1IVVA 2CG0A 2CHCA 4IPBA 3ROBA 1N5HA 1IT7A 2D1WA 4N6UA 1D6ZA 1IT8A 4OK0A 1QVF2 4CDLA 2RGQA 3EJVA 3A76A 3VF1A 3LTBA 2BMOB 1NU3A 3JUOA 1E97A 1VQ93 1GD3A 2Y73A 3EN1B 3FG4A 1UI7A 3LYGA 3NBRA 4QWTA 1M904 4OUQA 2P38A 2PNCA 3EC9A 3EHCA 5CK6A 3S27A 5TGNA 4MEIA 3GZBA 5I97A 3LT8A 2M7OA 1N8R4 1TP6A 2OOVA 1VQ53 5AI1A 1W6CA 2FGTA 1UUVB 2JQ5A 2WGOA 4G1MB 1YIJ3 3VGNA 3K0ZA 4WYKA 2E2TA 3CXC2 4XDVA 2HMKB 5IG5A 3LOYA 2W56B 1KSIA 1NJI4 3WOEB 3WODG 1S723 1JB4A 1UI8A 3OWSA 3NUVA 3G713 3STDA 4HM7B 3PYJA 2CG1A 2UX0A 3PCRA 1U5OA 1A2VA 3WOFB 1BUQA 4PEJA 1W2ZA 1K9M4 1JV2B 1W4NA 3CC23 4K90B 4ZM8A 3UB1A 1VQ83 3OX9A 3F7SA 4JF8A 2GU3A 3G6E3 1OPYA 1O7WB 2ML5A 2Z7AA 2P0XA 3N9HA 2CW9A 5AYRB 1VQL3 1KWIA 3BNDA 1LOXA 2WGQA 2YFJB 4I4KA 1GY7A 5EVHA 1SJWA 3SOYA 1EQKA 1AVLA 1JRQA 4U13A 3ER7A 1TU5A 2HMJB 5IF6A 4KFFA 4BTYA 2FXTA 4J8TA 3LZAA 2I9WA 3U1WA 1D6YA 4HJLB 1NO3A 3Q90A 1W6GA 1N9EA 4GL6A 2STDA 3JVCA 1FA3A 3FG1A 2E2VA 3CMA3 2LQVA 4AKYA 1JN5B 1WMNA 1NDOB 1VQ63 1EG9B 2QIYA 3G0KA 3GWRA 3B7CA 4FCZA 2XGNA 1AV4A 1OHSA 2XGLA 4RNZA 3NXJA 1OH0A 1Z1SA 2W56A 2IUKA 3M8CA 1IVWA 3QK9A 3MG3A 5FW5A 4H61A 2XR8B 3GZYB 1FGMA 3CC73 1VQP3 1N8QA 4R4KA 3CME3 3WA3A 1K41A 1OHPA 1WMPA 1K28A 2CFGA 2KXGA 4HZ9B 1ZO2A 4RNYA 1FGTA 3DUKA 5STDA 3KIIA 1ROAA 1T5YA 1JB2A 3O8YA 1AVKA 3DGLA 3X40A 1OGXA 2WOFA 4J9AA 2B1XB 1RN7A 3SLUA 4XBTA 3FSDA 3IMAB 3Q2PA 3KE7A 5EEOA 4LSOA 3PCSA 1C7HA 3CD63 3I553 2WO0A 2XFTA 3K5TA 1DVDA 1STFI 2JDIH 4TX4A 2OQEA 3CU3A 5KP4A 2CFWA 3CCM3 2RSXA 4EV2A 1RRLA 1VQ43 1D6UA 3MG2A 3OWYA 4NHFA 3CPOA 1CYUA 3CNMA 4FMCA 3MG1A 3EE1A 5CF2A 5AIIA 1NB3I 4JRFA 3NQYA 1IV7A 1JN5A 3LTCA 1QVG2 3X3YA 1DMQA 2L4VA 3KSED 3L0RA 3CCJ3 3K63A 2F98A 4NREA 3IJEB 2CKFB 2KCDA 1CEWI 1DYUA 3EN8A 4WFOA 3SX1A 1YGEA 3GRDA 3EQQB 2HMMB 3D3LA 4MMYB 3B8LA 1SPUA 3GZXB 4HM6B 3H3HA 2GXFA 3I0YA 1IDPA 3UJMA 1Q42A 3K7CA 5D81A 3WMDA 3FGYA 1SIHA 7STDA 2W04A 2OQEC 1VZZA 5BVBA 4LGQA 1WTHA 1HKXA 5DREA 2CFDA 3F8XA 1YJN3 1OCVA 3N8BA 2W6JH 1NWWA 1WQLB 4FCMA 4HM8B 2O3OA 1GD4A 3ECFA 1G96A 5ELJA 1OHOA 2B24B 3OW22 4CCVA 2SBLA 3NQZA 3SEDA 1US1A 3NBBA 2PZVA 3CCR3 3F40A 3MKIA 1Y4KA 1HU9A 1QALA 3MHEA 4HYZA 3V99A 1ULIB 3HX8A 2CWUA 4KZ1A 1A90A 2Z76A 3G16A 3X3XA 2FNQA 3V98A 4K61A 4HZBB 1IQYA 1LNHA 3E99A 4R1KA 2F86B 2XRXB 4N6V0 1EKMA 1W6YA 2INXA 3DXOA 3Q1CA 4N6LA 2RFRA 3B4OA 4GB5A 5JBSA 4XB5A 1U8CB 1W02A 1QMAA 5IEPA 2V1LA 2GBXB 4HBRA 1JKGB 3CCQ3 1TFOA 2XH9A 4N6OB 5IENA 5AIFA 3T0UA 1Q824 2OOVC 3T8UA 5IG0A 4N3VA 1CQSA 1F8NA 2OCTA 3S29A 2ML6A 3JUMA 1J2BA 3LMLA 1OF5B 2XFSA 1RKYA 3KKGA 1TFKA 1GS3A 2BMRB 3K9MC 4O2HA 1RRHA 4R9LA 4O8SA 2MF7A 2CC3A 3CNXA 5BXQA 1K734 5AEUB 3NM2A 3SOAA 4FR9A 2CWTA 3ALAA 3GZRA 5IG4A 1ROVA 1RJOA 5AYSC 1CYVA 1N9JA 2CIUA 3WDGB 4WWUC 5KP3A 3F8HA 1FGRA 1O7PB 1O7GB 3OWUA 3JUPA 3EF8A 4KFEA 4H3UA 5G2GA 1STDA 3IPTA 2BNGA 3CC43 1M9GA 2MC8A 3TDGA 1M1XB 3NBJA 2K0MA 4FMAA 3U97A 3JUQA 4XBYA 4XDWA 3HIGA 3RGRA 1YJW3 3PZWA 1ASKA 4RBNA 5KP1A 4LEHA 2HMLB 2XF3A 3FKAA 2QGUA 2Y74A 3NX0A 3LH4A 3BNEA 3BB9A 1DVCA 1O7HB 1OUNA 2W9PA 1JKGA 3V92A 3HK4A 2O9UX 2W0QA 4L8PA 3H51A 1W7CA 1A2KA 2BO9B 2XSHB 4MJDA 1VQO3 2QEX3 1ZX2A 3N54B 1OF5A 4Q53A 5IERA 1KQS2 3CPW2 3CCV3 4FMBA 1M1K4 2YX9A 3UNLA 3NHXA 3FF0A 2LYXA 3DGNA 3FG3A 3B4PA 5ELUA 4AEQA 3CCE3 4IT7A 1YIT3 2CK3H 1ISKA 3FZWA 2IA7A 1YVBI 1ULJB 2OTL3 1TIJA 2GBWB 2BHMA 2OTJ3 1QAKA 1JNQA 1QJGA 4X2HA 4KVHA 3DMCA 3VSYA 1KC84 1V74A 3J7Yd 2BT3A 3KN4A 2CH9A 1LXEA 3SXXA 1R4CA 4EC6A 3G4S3 2WOHA 3QRDA 2QA43 1DMMA 1FUWA 4HM4B 5DRVA 2XEPA 1OACA 2OWPA 3LTDA 4N6TA 3EBTA 4L7KA 2A15A 1FGQA 2CFLA 4ORLA 5JPPA 1YJ93 4K1VA 3CCU3 5JPUA 3BNCA 3EB8A 2HMNB 2XSOB 3KFQC 3SVAA 1UW1A 3LXUX 1IK3A 4EYCA 3PXMA 3MSOA 1O7MB 3MYTA 4LZIA 4L8OA 1OGZA 3MWZA 3HZPA 4R9KA 3F9SA 1Q40B 1SQWA 3F7XA 2E2UA 1IV9A 4HM5B 3WA2X 2KRTA 5AEWB 4WHAA 1QAFA 1WMOA 4O3VA 1E3VA 3S28A 1YI23 2RCDA 5AIGA 2Q07A 4MMZB 3UL6A 2ZL8A 3DZLA 3DY5A 3I563 2C10A 4FCJA 2W03A 1W2B2 1EA2A 3G8ZA 2YFIB 4X2OA 1O7NB 4EXRA 1IVXA 3FLJA 3OXAA 5HGRA 1YHQ3 4HVNA 2W2CA 1E3RA 3PS8A 4HM3B 3BNBA 4LMIA 3X3ZA 5IEOA 8CHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CEW I;  1MOL A;  2W9Q A;  4N6N B;  3NX0 A;  3LH4 A;  5EQL A;  1DVC A;  2W9P A;  2O9U X;  2BO9 B;  3PYJ A;  4ZM8 A;  1GD4 A;  1G96 A;  5ELJ A;  4CCV A;  5ELU A;  4IT7 A;  1KWI A;  1EQK A;  1YVB I;  1TIJ A;  4N6M A;  1A90 A;  3UL5 A;  1A67 A;  2CH9 A;  1LXE A;  1MNL A;  1R4C A;  5LC6 A;  3S67 A;  1FA3 A;  3QRD A;  4N6V 0;  1FUW A;  4N6L A;  4N6T A;  5LC7 A;  1WNH A;  1N5P A;  1PFP A;  3KFQ C;  3SVA A;  2KXG A;  4EYC A;  3PXM A;  4LZI A;  4N6O B;  3MWZ A;  1ROA A;  1NB5 I;  1RN7 A;  2OCT A;  3IMA B;  3Q2P A;  5A0O B;  1IV9 A;  1DVD A;  3K9M C;  1STF I;  4TX4 A;  3GAX A;  1N5H A;  1CYV A;  1N9J A;  4N6U A;  3UL6 A;  1CYU A;  1GD3 A;  1NB3 I;  1IV7 A;  1M9G A;  3PS8 A;  3KSE D;  3L0R A; 
#chains in the Genus database with same CATH topology
 4RNT A;  1GSP A;  4AKZ A;  4R80 A;  1MOL A;  1BRI A;  1T3B A;  1VQM 3;  2W9Q A;  4N6N B;  5CF1 A;  4KFD A;  1UUW B;  4RZM A;  1UGI A;  2GU1 A;  3D5G A;  2P0M A;  5EQL A;  4KT3 B;  1VQK 3;  1IVU A;  4BTX A;  4HM1 B;  1W01 A;  6GSP A;  1IQX A;  3KZT A;  4FMD A;  1SAR A;  3DGO A;  1JBR A;  2C4B A;  3EX9 A;  2CWV A;  1Q40 A;  1GYB A;  4O02 B;  3FCS B;  1FZU A;  3MPH A;  4XM4 A;  4BL2 A;  3AMO B;  5D82 A;  3RGA A;  1BSB A;  1FUS A;  3NM7 A;  1JBT A;  1LOY A;  4WP5 A;  2D42 A;  3OV4 A;  1UGH I;  5HOH A;  3DGM A;  1B27 A;  1PY3 A;  2R4I A;  4HM0 B;  4K1U A;  3Q3F A;  5M1A A;  1TUH A;  1BAN A;  3PGB A;  1VQN 3;  2P09 A;  1DE3 A;  4XBX A;  3DM8 A;  2GEX A;  5FGO A;  1RNB A;  6STD A;  3LT9 A;  1PU4 A;  3NV0 B;  1IQ8 A;  1W00 A;  1W5Z A;  2F5W A;  3CCS 3;  3D9R A;  3CCL 3;  1GY6 A;  4BTW A;  1JJ2 2;  3F14 A;  4EV5 A;  1KD1 4;  3JUN A;  1IU7 A;  3HII A;  2RBI A;  2AAD A;  4N6M A;  3A5E A;  4OVM A;  3UL5 A;  2KF4 A;  5IW9 A;  1A67 A;  1YVS A;  3FH1 A;  4EBG A;  3GSP A;  1MNL A;  4HM2 B;  1B3S A;  2P05 A;  5LC6 A;  3X41 A;  3S67 A;  4STD A;  1S5A A;  4MMX B;  1Q7Y 4;  1Q86 4;  3S5C A;  1JB5 A;  5CLK A;  1RGE A;  1LVN A;  2Z6B A;  4HKV B;  5CXO A;  3BLZ A;  1GMP A;  5GSP A;  3AHS A;  1RGH A;  5D83 A;  1FGO A;  3FF2 A;  2HMO B;  1RMS A;  1TTO A;  1L5G B;  5LC7 A;  1VQ7 3;  1WNH A;  1N5P A;  4WYK B;  1BRG A;  1PFP A;  2YFL B;  1AR0 A;  2CFK A;  2F99 A;  5IG3 A;  2IMJ A;  1SII A;  3RDE A;  3T8N A;  1PYL A;  3KSP A;  3AGN A;  3X42 A;  2C11 A;  1DMN A;  2ZDJ A;  2IUJ A;  3AMO A;  5AIH A;  3LTA A;  1NB5 I;  2UGI A;  1FW7 A;  1GMQ A;  1GY5 A;  2Z77 A;  1K8A 4;  4CJN A;  5A0O B;  1Q81 4;  2BMQ B;  2K54 A;  3EBY A;  5BU4 A;  4IIA A;  2GEY A;  3GAX A;  3HI7 A;  3NV0 A;  1IVV A;  2CG0 A;  2CHC A;  4IPB A;  3ROB A;  1N5H A;  1IT7 A;  2D1W A;  4N6U A;  1D6Z A;  1IT8 A;  4OK0 A;  1QVF 2;  1BNF A;  4CDL A;  7RNT A;  2RGQ A;  3EJV A;  3A76 A;  3VF1 A;  1BNR A;  3LTB A;  2BMO B;  1NU3 A;  3JUO A;  1E97 A;  1VQ9 3;  1GD3 A;  1I2G A;  2Y73 A;  3EN1 B;  1UI7 A;  3FG4 A;  3LYG A;  3NBR A;  4QWT A;  1M90 4;  2F4Y A;  2P38 A;  2PNC A;  3EC9 A;  4OUQ A;  3EHC A;  5CK6 A;  3S27 A;  5TGN A;  4MEI A;  3GZB A;  9RNT A;  5I97 A;  3LT8 A;  1AY7 A;  2M7O A;  1N8R 4;  1Q7H A;  1TP6 A;  2OOV A;  3URP A;  5AI1 A;  1VQ5 3;  1W6C A;  2FGT A;  1UUV B;  2JQ5 A;  2WGO A;  4G1M B;  1YIJ 3;  3AHW A;  3VGN A;  3K0Z A;  4WYK A;  2E2T A;  3WR2 A;  4XDV A;  3CXC 2;  2HMK B;  5IG5 A;  3LOY A;  2W56 B;  1KSI A;  1NJI 4;  1UCK A;  3WOE B;  3WOD G;  1RLS A;  1S72 3;  1JB4 A;  1UI8 A;  1FYS A;  1BNG A;  3OWS A;  3NUV A;  1NNV A;  3STD A;  3G71 3;  4HM7 B;  3PYJ A;  1I2E A;  2CG1 A;  2UX0 A;  3PCR A;  1U5O A;  1A2V A;  3WOF B;  1BUQ A;  4PEJ A;  1W2Z A;  1K9M 4;  1JV2 B;  1MWS A;  1W4N A;  3CC2 3;  4K90 B;  4ZM8 A;  3UB1 A;  1VQ8 3;  3OX9 A;  3F7S A;  4JF8 A;  1BAO A;  2GU3 A;  3D4A A;  3G6E 3;  1G0T A;  1OPY A;  1O7W B;  3ZG5 A;  1Q9E A;  1B2S A;  2ML5 A;  2Z7A A;  2P0X A;  3N9H A;  1MWT A;  2CW9 A;  5AYR B;  1VQL 3;  1KWI A;  1GMR A;  3BND A;  1LOX A;  2WGQ A;  2YFJ B;  4I4K A;  1GY7 A;  5EVH A;  1SJW A;  3SOY A;  1EQK A;  1AVL A;  1JZO A;  1JRQ A;  1MWU A;  4U13 A;  3ER7 A;  1TU5 A;  2HMJ B;  5IF6 A;  4KFF A;  4BTY A;  8RNT A;  2FXT A;  4J8T A;  1RGC A;  3LZA A;  2I9W A;  3U1W A;  1D6Y A;  4HJL B;  4BL3 A;  1NO3 A;  3Q90 A;  1W6G A;  1N9E A;  4GL6 A;  2STD A;  3JVC A;  1FA3 A;  3FG1 A;  2E2V A;  3CMA 3;  2LQV A;  4AKY A;  1JN5 B;  1WMN A;  1NDO B;  1VQ6 3;  1EG9 B;  2QIY A;  3G0K A;  3GWR A;  3B7C A;  1I8V A;  1X1X A;  4FCZ A;  2XGN A;  1AV4 A;  1OHS A;  2XGL A;  3BIR A;  4RNZ A;  3NXJ A;  1BIR A;  4I5Q A;  1OH0 A;  1Z1S A;  2W56 A;  2IUK A;  3M8C A;  1IVW A;  3QK9 A;  1BRJ A;  3MG3 A;  4H61 A;  5FW5 A;  1JBS A;  2XR8 B;  3GZY B;  1FGM A;  3CC7 3;  2KF5 A;  3D79 A;  1I0X A;  1VQP 3;  1N8Q A;  4R4K A;  3CME 3;  3WA3 A;  1K41 A;  1OHP A;  2F56 A;  1WMP A;  1K28 A;  2CFG A;  2KXG A;  1RSN A;  4HZ9 B;  1ZO2 A;  4RNY A;  1FGT A;  3DUK A;  5STD A;  1G02 A;  3KII A;  1X1Y A;  1ROA A;  1T5Y A;  1JB2 A;  3O8Y A;  1AVK A;  3DGL A;  3X40 A;  1OGX A;  2WOF A;  4J9A A;  1RCL A;  2B1X B;  1EEJ A;  1RN7 A;  4XBT A;  5G1K A;  3SLU A;  1IYY A;  3FSD A;  3IMA B;  3Q2P A;  3KE7 A;  5EEO A;  4LSO A;  1V58 A;  3PCS A;  1C7H A;  3CD6 3;  3I55 3;  2WO0 A;  1BOX A;  2XFT A;  3K5T A;  1DVD A;  1STF I;  2JDI H;  4TX4 A;  2OQE A;  3CU3 A;  5KP4 A;  2BIR A;  2CFW A;  1RCK A;  4J5K A;  3CCM 3;  5M19 A;  1MWR A;  2RSX A;  4EV2 A;  1RRL A;  1VQ4 3;  1D6U A;  3MG2 A;  1X1W A;  1I3F A;  3OWY A;  1GOY A;  4NHF A;  3CPO A;  1CYU A;  3CNM A;  1EUI C;  1UUG B;  4FMC A;  3MG1 A;  3EE1 A;  5CF2 A;  5AII A;  1NB3 I;  4JRF A;  1RTU A;  3NQY A;  1IV7 A;  1JN5 A;  1V57 A;  2CX0 A;  3LTC A;  2ZA4 A;  1QVG 2;  3X3Y A;  1CH0 A;  1DMQ A;  2L4V A;  3KSE D;  2IY2 A;  1I2F A;  3L0R A;  3CCJ 3;  3K63 A;  2IYJ A;  2F98 A;  4NRE A;  5G1L A;  3IJE B;  2CKF B;  2KCD A;  1CEW I;  1DYU A;  3EN8 A;  4WFO A;  1BUJ A;  1MGR A;  1YGE A;  3GRD A;  3EQQ B;  3SX1 A;  2HMM B;  1YNV X;  3D3L A;  4MMY B;  3B8L A;  1SPU A;  3GZX B;  4HM6 B;  3H3H A;  2GXF A;  1BNS A;  1RGK A;  3I0Y A;  1IDP A;  1B20 A;  3UJM A;  1Q42 A;  3K7C A;  4LYL B;  5D81 A;  3WMD A;  3FGY A;  1SIH A;  2KF6 A;  7STD A;  2W04 A;  1ZS7 A;  2ZHX B;  2OQE C;  1VZZ A;  5BVB A;  2RNT A;  4LGQ A;  1WTH A;  1HKX A;  5DRE A;  2CFD A;  3F8X A;  1YJN 3;  1OCV A;  1BSC A;  1RN4 A;  3N8B A;  2W6J H;  1BRK A;  1FUT A;  1NWW A;  1WQL B;  1X1U A;  4FCM A;  4HM8 B;  2O3O A;  1RGF A;  1GD4 A;  3ECF A;  1G96 A;  5ELJ A;  1LQM B;  1OHO A;  2B24 B;  4NPB A;  2H0H A;  4CCV A;  2SBL A;  3OW2 2;  3NQZ A;  3SED A;  1US1 A;  2HOH A;  2PZV A;  3NBB A;  3CCR 3;  2SAR A;  3F40 A;  3MKI A;  1Y4K A;  1BGS A;  1HU9 A;  1QAL A;  3MHE A;  4HYZ A;  3V99 A;  1ULI B;  3HX8 A;  2CWU A;  4KZ1 A;  1A90 A;  2Z76 A;  3G16 A;  3X3X A;  2FNQ A;  3V98 A;  4K61 A;  4HZB B;  1IQY A;  1LNH A;  3E99 A;  3SYU A;  1R4Y A;  4R1K A;  4HAA A;  2F86 B;  2GSP A;  2F5M A;  2XRX B;  3BU4 A;  4N6V 0;  1LQG C;  1EKM A;  1VQQ A;  1W6Y A;  2INX A;  3DXO A;  3Q1C A;  1DET A;  2RFR A;  3B4O A;  4GB5 A;  4N6L A;  5JBS A;  4XB5 A;  1TRQ A;  1BRH A;  3KCH A;  1U8C B;  1W02 A;  1QMA A;  5IEP A;  2V1L A;  1LRA A;  2GBX B;  4HBR A;  1JKG B;  3CCQ 3;  1GOV A;  1TFO A;  2XH9 A;  4GSP A;  4N6O B;  2J8X B;  5IEN A;  5AIF A;  3T0U A;  1I70 A;  1Q82 4;  1UDI I;  2OOV C;  1MGW A;  4N3V A;  5IG0 A;  3T8U A;  1RGA A;  1CQS A;  1F8N A;  2OCT A;  3S29 A;  7GSP A;  3WHO A;  2ML6 A;  3JUM A;  1J2B A;  3LML A;  1OF5 B;  2XFS A;  1UCL A;  1RKY A;  3KKG A;  1TFK A;  3ZFZ A;  1GS3 A;  2BMR B;  3K9M C;  1B2U A;  4O2H A;  1RRH A;  3HOH A;  4R9L A;  1RN1 A;  4O8S A;  2MF7 A;  1T2I A;  1BSE A;  1LOW A;  2CC3 A;  3CNX A;  3NM2 A;  3SOA A;  5AEU B;  2K3D A;  1K73 4;  4FR9 A;  2CWT A;  3ALA A;  3GZR A;  5IG4 A;  1ROV A;  1ZGX A;  1RJO A;  1B21 A;  1A2P A;  1CYV A;  1N9J A;  5AYS C;  2CIU A;  1RGL A;  3WDG B;  4WWU C;  1HZ1 A;  5KP3 A;  3F8H A;  1FGR A;  1O7P B;  1O7G B;  1TRP A;  2CX1 A;  3JUP A;  3EF8 A;  3OWU A;  4KFE A;  4H3U A;  5G2G A;  1STD A;  3IPT A;  1RHL A;  2BNG A;  3CC4 3;  1M9G A;  2MC8 A;  3TDG A;  1M1X B;  3NBJ A;  2K0M A;  4FMA A;  1BNE A;  4HOH A;  3JUQ A;  3U97 A;  4BU4 A;  4XBY A;  4XDW A;  3HIG A;  3RGR A;  1YJW 3;  3PZW A;  1ASK A;  1BRS A;  4RBN A;  4EW5 A;  2H0G A;  5KP1 A;  4LEH A;  2HML B;  2XF3 A;  3FKA A;  1BNJ A;  2QGU A;  2Y74 A;  3NX0 A;  1B2M A;  3LH4 A;  3BNE A;  3BB9 A;  1DVC A;  1O7H B;  1I3I A;  1OUN A;  1T2H A;  1JKG A;  2W9P A;  3V92 A;  3ZG0 A;  3HK4 A;  2O9U X;  2W0Q A;  4L8P A;  3H51 A;  1W7C A;  1A2K A;  2BO9 B;  1JZD A;  2KF3 A;  2XSH B;  4MJD A;  1VQO 3;  2QEX 3;  4ILF A;  1ZX2 A;  3N54 B;  2L1S A;  1BSD A;  1OF5 A;  4Q53 A;  5IER A;  1KQS 2;  3CPW 2;  3CCV 3;  4FMB A;  1M1K 4;  2YX9 A;  3UNL A;  3NHX A;  3D5I A;  3FF0 A;  1C54 A;  4BIR A;  2LYX A;  3DGN A;  3FG3 A;  3B4P A;  5ELU A;  4AEQ A;  1BVI A;  1UCI A;  2KAA A;  4IT7 A;  3CCE 3;  2CK3 H;  1YIT 3;  1ISK A;  3FZW A;  3RNT A;  1YVB I;  1ULJ B;  2IA7 A;  2OTL 3;  1TIJ A;  1BNI A;  2BHM A;  2GBW B;  2OTJ 3;  1QAK A;  1JNQ A;  1QJG A;  6RNT A;  4X2H A;  4KVH A;  3DMC A;  3VSY A;  1KC8 4;  1V74 A;  5M18 A;  1TJD A;  3J7Y d;  2BT3 A;  2AAE A;  3KN4 A;  1LOV A;  2CH9 A;  1LXE A;  3SXX A;  1R4C A;  4EC6 A;  3G4S 3;  2WOH A;  3QRD A;  2QA4 3;  1DMM A;  1FUW A;  4J5G A;  4HM4 B;  5DRV A;  2XEP A;  1B2Z A;  1LNI A;  1OAC A;  2OWP A;  3LTD A;  4N6T A;  3DGY A;  3EBT A;  4L7K A;  2A15 A;  1AQZ A;  1FGQ A;  2CFL A;  4ORL A;  5JPP A;  1YJ9 3;  4K1V A;  1I0V A;  3CCU 3;  5JPU A;  3BNC A;  3EB8 A;  2HMN B;  2XSO B;  3KFQ C;  5BXQ A;  3SVA A;  1RDS A;  1UW1 A;  3LXU X;  3AGO A;  4GHO A;  4EYC A;  1IK3 A;  3PXM A;  3MSO A;  1O7M B;  3MYT A;  4LZI A;  4L8O A;  1OGZ A;  3MWZ A;  2UUG C;  3HZP A;  4R9K A;  3DH2 A;  1RGG A;  3F9S A;  1Q40 B;  1SQW A;  3F7X A;  2H0I A;  2E2U A;  1IV9 A;  4HM5 B;  1GOU A;  3WA2 X;  5BIR A;  2KRT A;  5AEW B;  4WHA A;  1QAF A;  1BU4 A;  1YGW A;  1WMO A;  4O3V A;  1E3V A;  1B2X A;  3S28 A;  1YI2 3;  2RCD A;  1RNT A;  5AIG A;  2Q07 A;  4MMZ B;  3UL6 A;  2ZL8 A;  4CPK A;  3DZL A;  3DY5 A;  3I56 3;  5RNT A;  2C10 A;  1BSA A;  2BU4 A;  1HYF A;  4FCJ A;  2W03 A;  1W2B 2;  1EA2 A;  3G8Z A;  2YFI B;  4X2O A;  1O7N B;  4EXR A;  1IVX A;  1UCJ A;  3FLJ A;  3OXA A;  5HGR A;  4DKI A;  1BRN L;  1YHQ 3;  4HVN A;  2W2C A;  1E3R A;  3PS8 A;  4HM3 B;  2R41 A;  3BNB A;  4LMI A;  3X3Z A;  5IEO A;  8CHO A; 
#chains in the Genus database with same CATH homology
 4AKZ A;  4R80 A;  1MOL A;  1VQM 3;  2W9Q A;  4N6N B;  5CF1 A;  4KFD A;  1UUW B;  4RZM A;  5EQL A;  2GU1 A;  2P0M A;  1VQK 3;  1IVU A;  4BTX A;  4HM1 B;  1W01 A;  1IQX A;  3KZT A;  4FMD A;  3DGO A;  3EX9 A;  2CWV A;  1Q40 A;  1GYB A;  4O02 B;  3FCS B;  3MPH A;  4XM4 A;  3AMO B;  5D82 A;  3RGA A;  3NM7 A;  4WP5 A;  2D42 A;  3OV4 A;  3DGM A;  2R4I A;  4HM0 B;  4K1U A;  1TUH A;  3PGB A;  1VQN 3;  2P09 A;  4XBX A;  3DM8 A;  2GEX A;  5FGO A;  6STD A;  3LT9 A;  1PU4 A;  3NV0 B;  1IQ8 A;  1W00 A;  1W5Z A;  3CCS 3;  3D9R A;  3CCL 3;  1GY6 A;  4BTW A;  1JJ2 2;  3F14 A;  4EV5 A;  1KD1 4;  3JUN A;  1IU7 A;  3HII A;  4N6M A;  4OVM A;  3UL5 A;  5IW9 A;  1A67 A;  3FH1 A;  4EBG A;  1MNL A;  4HM2 B;  2P05 A;  5LC6 A;  3X41 A;  3S67 A;  4STD A;  1S5A A;  4MMX B;  1Q7Y 4;  1Q86 4;  3S5C A;  1JB5 A;  5CLK A;  1LVN A;  2Z6B A;  4HKV B;  5CXO A;  3BLZ A;  5D83 A;  1FGO A;  3FF2 A;  2HMO B;  1L5G B;  5LC7 A;  1VQ7 3;  1WNH A;  1N5P A;  4WYK B;  1PFP A;  2YFL B;  1AR0 A;  2CFK A;  2F99 A;  5IG3 A;  2IMJ A;  1SII A;  3RDE A;  3T8N A;  3KSP A;  3X42 A;  2C11 A;  1DMN A;  2ZDJ A;  2IUJ A;  3AMO A;  5AIH A;  3LTA A;  1NB5 I;  1GY5 A;  2Z77 A;  1K8A 4;  5A0O B;  1Q81 4;  2BMQ B;  2K54 A;  3EBY A;  4IIA A;  2GEY A;  3GAX A;  3HI7 A;  3NV0 A;  1IVV A;  2CG0 A;  2CHC A;  4IPB A;  3ROB A;  1N5H A;  1IT7 A;  2D1W A;  4N6U A;  1D6Z A;  1IT8 A;  4OK0 A;  1QVF 2;  4CDL A;  2RGQ A;  3EJV A;  3A76 A;  3VF1 A;  3LTB A;  2BMO B;  1NU3 A;  3JUO A;  1E97 A;  1VQ9 3;  1GD3 A;  2Y73 A;  3EN1 B;  3FG4 A;  1UI7 A;  3LYG A;  3NBR A;  4QWT A;  1M90 4;  4OUQ A;  2P38 A;  2PNC A;  3EC9 A;  3EHC A;  5CK6 A;  3S27 A;  5TGN A;  4MEI A;  3GZB A;  5I97 A;  3LT8 A;  2M7O A;  1N8R 4;  1TP6 A;  2OOV A;  1VQ5 3;  5AI1 A;  1W6C A;  2FGT A;  1UUV B;  2JQ5 A;  2WGO A;  4G1M B;  1YIJ 3;  3VGN A;  3K0Z A;  4WYK A;  2E2T A;  3CXC 2;  4XDV A;  2HMK B;  5IG5 A;  3LOY A;  2W56 B;  1KSI A;  1NJI 4;  3WOE B;  3WOD G;  1S72 3;  1JB4 A;  1UI8 A;  3OWS A;  3NUV A;  3G71 3;  3STD A;  4HM7 B;  3PYJ A;  2CG1 A;  2UX0 A;  3PCR A;  1U5O A;  1A2V A;  3WOF B;  1BUQ A;  4PEJ A;  1W2Z A;  1K9M 4;  1JV2 B;  1W4N A;  3CC2 3;  4K90 B;  4ZM8 A;  3UB1 A;  1VQ8 3;  3OX9 A;  3F7S A;  4JF8 A;  2GU3 A;  3G6E 3;  1OPY A;  1O7W B;  2ML5 A;  2Z7A A;  2P0X A;  3N9H A;  2CW9 A;  5AYR B;  1VQL 3;  1KWI A;  3BND A;  1LOX A;  2WGQ A;  2YFJ B;  4I4K A;  1GY7 A;  5EVH A;  1SJW A;  3SOY A;  1EQK A;  1AVL A;  1JRQ A;  4U13 A;  3ER7 A;  1TU5 A;  2HMJ B;  5IF6 A;  4KFF A;  4BTY A;  2FXT A;  4J8T A;  3LZA A;  2I9W A;  3U1W A;  1D6Y A;  4HJL B;  1NO3 A;  3Q90 A;  1W6G A;  1N9E A;  4GL6 A;  2STD A;  3JVC A;  1FA3 A;  3FG1 A;  2E2V A;  3CMA 3;  2LQV A;  4AKY A;  1JN5 B;  1WMN A;  1NDO B;  1VQ6 3;  1EG9 B;  2QIY A;  3G0K A;  3GWR A;  3B7C A;  4FCZ A;  2XGN A;  1AV4 A;  1OHS A;  2XGL A;  4RNZ A;  3NXJ A;  1OH0 A;  1Z1S A;  2W56 A;  2IUK A;  3M8C A;  1IVW A;  3QK9 A;  3MG3 A;  5FW5 A;  4H61 A;  2XR8 B;  3GZY B;  1FGM A;  3CC7 3;  1VQP 3;  1N8Q A;  4R4K A;  3CME 3;  3WA3 A;  1K41 A;  1OHP A;  1WMP A;  1K28 A;  2CFG A;  2KXG A;  4HZ9 B;  1ZO2 A;  4RNY A;  1FGT A;  3DUK A;  5STD A;  3KII A;  1ROA A;  1T5Y A;  1JB2 A;  3O8Y A;  1AVK A;  3DGL A;  3X40 A;  1OGX A;  2WOF A;  4J9A A;  2B1X B;  1RN7 A;  3SLU A;  4XBT A;  3FSD A;  3IMA B;  3Q2P A;  3KE7 A;  5EEO A;  4LSO A;  3PCS A;  1C7H A;  3CD6 3;  3I55 3;  2WO0 A;  2XFT A;  3K5T A;  1DVD A;  1STF I;  2JDI H;  4TX4 A;  2OQE A;  3CU3 A;  5KP4 A;  2CFW A;  3CCM 3;  2RSX A;  4EV2 A;  1RRL A;  1VQ4 3;  1D6U A;  3MG2 A;  3OWY A;  4NHF A;  3CPO A;  1CYU A;  3CNM A;  4FMC A;  3MG1 A;  3EE1 A;  5CF2 A;  5AII A;  1NB3 I;  4JRF A;  3NQY A;  1IV7 A;  1JN5 A;  3LTC A;  1QVG 2;  3X3Y A;  1DMQ A;  2L4V A;  3KSE D;  3L0R A;  3CCJ 3;  3K63 A;  2F98 A;  4NRE A;  3IJE B;  2CKF B;  2KCD A;  1CEW I;  1DYU A;  3EN8 A;  4WFO A;  3SX1 A;  1YGE A;  3GRD A;  3EQQ B;  2HMM B;  3D3L A;  4MMY B;  3B8L A;  1SPU A;  3GZX B;  4HM6 B;  3H3H A;  2GXF A;  3I0Y A;  1IDP A;  3UJM A;  1Q42 A;  3K7C A;  5D81 A;  3WMD A;  3FGY A;  1SIH A;  7STD A;  2W04 A;  2OQE C;  1VZZ A;  5BVB A;  4LGQ A;  1WTH A;  1HKX A;  5DRE A;  2CFD A;  3F8X A;  1YJN 3;  1OCV A;  3N8B A;  2W6J H;  1NWW A;  1WQL B;  4FCM A;  4HM8 B;  2O3O A;  1GD4 A;  3ECF A;  1G96 A;  5ELJ A;  1OHO A;  2B24 B;  3OW2 2;  4CCV A;  2SBL A;  3NQZ A;  3SED A;  1US1 A;  3NBB A;  2PZV A;  3CCR 3;  3F40 A;  3MKI A;  1Y4K A;  1HU9 A;  1QAL A;  3MHE A;  4HYZ A;  3V99 A;  1ULI B;  3HX8 A;  2CWU A;  4KZ1 A;  1A90 A;  2Z76 A;  3G16 A;  3X3X A;  2FNQ A;  3V98 A;  4K61 A;  4HZB B;  1IQY A;  1LNH A;  3E99 A;  4R1K A;  2F86 B;  2XRX B;  4N6V 0;  1EKM A;  1W6Y A;  2INX A;  3DXO A;  3Q1C A;  4N6L A;  2RFR A;  3B4O A;  4GB5 A;  5JBS A;  4XB5 A;  1U8C B;  1W02 A;  1QMA A;  5IEP A;  2V1L A;  2GBX B;  4HBR A;  1JKG B;  3CCQ 3;  1TFO A;  2XH9 A;  4N6O B;  5IEN A;  5AIF A;  3T0U A;  1Q82 4;  2OOV C;  3T8U A;  5IG0 A;  4N3V A;  1CQS A;  1F8N A;  2OCT A;  3S29 A;  2ML6 A;  3JUM A;  1J2B A;  3LML A;  1OF5 B;  2XFS A;  1RKY A;  3KKG A;  1TFK A;  1GS3 A;  2BMR B;  3K9M C;  4O2H A;  1RRH A;  4R9L A;  4O8S A;  2MF7 A;  2CC3 A;  3CNX A;  5BXQ A;  1K73 4;  5AEU B;  3NM2 A;  3SOA A;  4FR9 A;  2CWT A;  3ALA A;  3GZR A;  5IG4 A;  1ROV A;  1RJO A;  5AYS C;  1CYV A;  1N9J A;  2CIU A;  3WDG B;  4WWU C;  5KP3 A;  3F8H A;  1FGR A;  1O7P B;  1O7G B;  3OWU A;  3JUP A;  3EF8 A;  4KFE A;  4H3U A;  5G2G A;  1STD A;  3IPT A;  2BNG A;  3CC4 3;  1M9G A;  2MC8 A;  3TDG A;  1M1X B;  3NBJ A;  2K0M A;  4FMA A;  3U97 A;  3JUQ A;  4XBY A;  4XDW A;  3HIG A;  3RGR A;  1YJW 3;  3PZW A;  1ASK A;  4RBN A;  5KP1 A;  4LEH A;  2HML B;  2XF3 A;  3FKA A;  2QGU A;  2Y74 A;  3NX0 A;  3LH4 A;  3BNE A;  3BB9 A;  1DVC A;  1O7H B;  1OUN A;  2W9P A;  1JKG A;  3V92 A;  3HK4 A;  2O9U X;  2W0Q A;  4L8P A;  3H51 A;  1W7C A;  1A2K A;  2BO9 B;  2XSH B;  4MJD A;  1VQO 3;  2QEX 3;  1ZX2 A;  3N54 B;  1OF5 A;  4Q53 A;  5IER A;  1KQS 2;  3CPW 2;  3CCV 3;  4FMB A;  1M1K 4;  2YX9 A;  3UNL A;  3NHX A;  3FF0 A;  2LYX A;  3DGN A;  3FG3 A;  3B4P A;  5ELU A;  4AEQ A;  3CCE 3;  4IT7 A;  1YIT 3;  2CK3 H;  1ISK A;  3FZW A;  2IA7 A;  1YVB I;  1ULJ B;  2OTL 3;  1TIJ A;  2GBW B;  2BHM A;  2OTJ 3;  1QAK A;  1JNQ A;  1QJG A;  4X2H A;  4KVH A;  3DMC A;  3VSY A;  1KC8 4;  1V74 A;  3J7Y d;  2BT3 A;  3KN4 A;  2CH9 A;  1LXE A;  3SXX A;  1R4C A;  4EC6 A;  3G4S 3;  2WOH A;  3QRD A;  2QA4 3;  1DMM A;  1FUW A;  4HM4 B;  5DRV A;  2XEP A;  1OAC A;  2OWP A;  3LTD A;  4N6T A;  3EBT A;  4L7K A;  2A15 A;  1FGQ A;  2CFL A;  4ORL A;  5JPP A;  1YJ9 3;  4K1V A;  3CCU 3;  5JPU A;  3BNC A;  3EB8 A;  2HMN B;  2XSO B;  3KFQ C;  3SVA A;  1UW1 A;  3LXU X;  1IK3 A;  4EYC A;  3PXM A;  3MSO A;  1O7M B;  3MYT A;  4LZI A;  4L8O A;  1OGZ A;  3MWZ A;  3HZP A;  4R9K A;  3F9S A;  1Q40 B;  1SQW A;  3F7X A;  2E2U A;  1IV9 A;  4HM5 B;  3WA2 X;  2KRT A;  5AEW B;  4WHA A;  1QAF A;  1WMO A;  4O3V A;  1E3V A;  3S28 A;  1YI2 3;  2RCD A;  5AIG A;  2Q07 A;  4MMZ B;  3UL6 A;  2ZL8 A;  3DZL A;  3DY5 A;  3I56 3;  2C10 A;  4FCJ A;  2W03 A;  1W2B 2;  1EA2 A;  3G8Z A;  2YFI B;  4X2O A;  1O7N B;  4EXR A;  1IVX A;  3FLJ A;  3OXA A;  5HGR A;  1YHQ 3;  4HVN A;  2W2C A;  1E3R A;  3PS8 A;  4HM3 B;  3BNB A;  4LMI A;  3X3Z A;  5IEO A;  8CHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...