1STFI

The refined 2.4 angstroms x-ray crystal structure of recombinant human stefin b in complex with the cysteine proteinase papain: a novel type of proteinase inhibitor interaction
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
b'MMSGAPSATQPATAETQHIADQVRSQLEEKYNKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAPAIN
publication title The refined 2.4 A X-ray crystal structure of recombinant human stefin B in complex with the cysteine proteinase papain: a novel type of proteinase inhibitor interaction.
pubmed rcsb
source organism Carica papaya
molecule tags Hydrolase(sulfhydryl proteinase)
total genus 21
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1993-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1stfI00
1CEWI 3KFQC 5LC7A 1FUWA 5LC6A 4IT7A 1N9JA 4N6TA 3GAXA 3PYJA 3S67A 5ELJA 3PS8A 1EQKA 1CYUA 1NB3I 4N6UA 1PFPA 1FA3A 3SVAA 2CH9A 5EQLA 1DVDA 3Q2PA 1IV9A 1N5PA 1MNLA 3IMAB 5ELUA 3NX0A 1NB5I 1STFI 2BO9B 3PXMA 3QRDA 4TX4A 2OCTA 3L0RA 1DVCA 4CCVA 2O9UX 4LZIA 1A90A 1R4CA 4N6OB 4N6V0 2W9QA 4N6MA 1IV7A 3UL6A 3LH4A 3UL5A 3K9MC 1LXEA 1YVBI 4ZM8A 1RN7A 2KXGA 1ROAA 4EYCA 1MOLA 1M9GA 1G96A 4N6NB 4N6LA 1N5HA 5A0OB 1TIJA 3KSED 1WNHA 2W9PA 3MWZA 1GD4A 1A67A 1GD3A 1KWIA 1CYVA
chains in the Genus database with same CATH superfamily
1TFKA 5KP3A 6RNTA 3VGNA 1GMRA 1FZUA 4NPBA 1RGCA 5CF1A 3RDEA 5M18A 1JBRA 1E97A 2SARA 3J7Yd 1BUQA 1W6YA 3NHXA 1LRAA 1Z1SA 2GEYA 1RNBA 1SIHA 1FGQA 1GY5A 1IVUA 1W6GA 1IYYA 3FSDA 1FUWA 4WYKA 3LMLA 4HZ9B 1WMNA 3GAXA 1V58A 1R4YA 1RGEA 2AADA 1VQQA 2CWVA 2H0HA 3JVCA 3RGRA 3S67A 2UX0A 1VQP3 3LXUX 1BSDA 3GWRA 3PCSA 4HBRA 4KVHA 1VQ63 1VQN3 3T8UA 3DM8A 2JQ5A 4WWUC 2K54A 4I5QA 4J9AA 2YFJB 3SOYA 5DREA 1GMQA 1NB3I 2HMOB 5AYSC 1LNIA 4N6UA 3MG3A 1DMQA 1RGAA 2CX1A 2KF5A 3B4OA 3DGLA 2K0MA 1T2HA 1OACA 3D9RA 1FGOA 1W2ZA 1W7CA 1RMSA 4STDA 3DXOA 3AMOB 2E2UA 1IVWA 3BNCA 4IIAA 3SEDA 2CFGA 3MYTA 5KP4A 1W02A 5M19A 2XF3A 3KKGA 3D3LA 1Q9EA 4FMDA 4LSOA 4TX4A 3DMCA 1YIJ3 1IQXA 1UCIA 1PY3A 2BMOB 3URPA 4H61A 1SPUA 2Y73A 1STDA 1X1YA 3GZXB 3HIIA 1DVCA 1IQYA 1N8QA 4RZMA 4XBXA 4CCVA 1YJ93 1BANA 2WGQA 1D6YA 2A15A 3HIGA 3LTCA 1N8R4 2Z76A 3CCJ3 3SYUA 1I0XA 2CKFB 2IY2A 4J5KA 3CCM3 1DYUA 3T8NA 1LOVA 1RRLA 1I2EA 1W4NA 1PYLA 3EE1A 4AKZA 1GY7A 3NUVA 1X1UA 5D83A 1TJDA 3MPHA 1D6UA 4J5GA 3BNEA 3F14A 3IJEB 1JBSA 1LQGC 2WOFA 4HM0B 3NBJA 1FGRA 4HM1B 2CWUA 2F86B 1UUWB 3CPOA 5CF2A 3CNXA 5G2GA 3DUKA 2PZVA 2W9QA 4LGQA 2E2VA 4MMZB 1IV7A 2R41A 4N3VA 2C4BA 2F99A 3QK9A 1B2XA 1OPYA 2ZA4A 3CMA3 4MMXB 3UL5A 3AMOA 3EBYA 1IT8A 3M8CA 1BOXA 5G1LA 1LOXA 4CJNA 1BSCA 1HKXA 4R4KA 1OCVA 1BRJA 3NV0B 3GRDA 2JDIH 4BU4A 4HM5B 5IG0A 1IQ8A 1ROAA 7GSPA 1JN5B 3ZFZA 6GSPA 4GL6A 1BAOA 3LTAA 3K0ZA 1I2FA 4WFOA 1BNGA 1N5HA 5FW5A 1LNHA 1UCKA 1AVKA 1MWUA 1O7NB 1I3IA 1WMPA 2CX0A 3OWYA 4K1UA 3KSED 3WR2A 3ECFA 2O3OA 4LMIA 2RGQA 1WNHA 3PCRA 5DRVA 2OQEA 1GD4A 1M904 2D1WA 4O3VA 8CHOA 1BRKA 1GD3A 1KWIA 4L7KA 4JF8A 2P09A 3MSOA 1CYVA 1EEJA 4LYLB 2QEX3 2IA7A 3G713 2B1XB 9RNTA 1OH0A 1RGHA 2YFIB 1OF5B 3KFQC 2CFWA 2Z77A 5GSPA 1BRGA 2BIRA 4FMBA 4R80A 1T3BA 4FMCA 1BNEA 4FMAA 1DMNA 4K90B 5LC6A 2FXTA 1NWWA 2GXFA 2C11A 1AR0A 1SJWA 3AHSA 5IENA 2KF6A 3BB9A 3PS8A 2BT3A 4BTWA 4GSPA 1NU3A 1QAFA 3S29A 5BIRA 3MKIA 1EQKA 4EBGA 1CH0A 3B8LA 5STDA 3CCS3 3HZPA 1X1XA 3S27A 3NV0A 3OWUA 2F5WA 1J2BA 2YX9A 5TGNA 1GOUA 2KAAA 5BU4A 7STDA 3MG1A 5JPPA 1Q814 1ROVA 2PNCA 1ZO2A 1TFOA 2RFRA 4EV2A 1JB5A 3ALAA 5M1AA 1UUVB 4RNYA 2OTL3 1IT7A 1TUHA 2UGIA 1Q40B 1T2IA 3GZYB 3Q2PA 3RGAA 4X2OA 5HOHA 1IV9A 3OW22 1DE3A 3MG2A 4GHOA 1RHLA 3GZBA 5ELUA 1STFI 1OHSA 2BO9B 3PXMA 1IDPA 1UUGB 2W2CA 3QRDA 4G1MB 2OCTA 4O8SA 5BXQA 1U5OA 3EBTA 3V99A 4KFEA 1KD14 1Y4KA 2K3DA 3F7SA 1JRQA 5CXOA 3UNLA 1K9M4 5G1KA 2GEXA 2CFLA 1D6ZA 3D79A 3WHOA 2W6JH 3FF0A 2LQVA 1OF5A 4KFFA 4BL3A 1MGRA 4LZIA 4XM4A 1VQ83 2W03A 2QIYA 1O7WB 3DGOA 2QA43 3ZG0A 3E99A 2HMKB 3LZAA 2KCDA 3BNDA 3LYGA 5AIGA 4R1KA 3F9SA 4KZ1A 2F5MA 1OHPA 1I0VA 1RNTA 4CPKA 1QALA 4XDVA 1VQ43 3CD63 1OGXA 3F40A 2CFDA 1US1A 3OXAA 1KSIA 1IVVA 4N6OB 1V74A 1TTOA 4N6V0 1DETA 2F4YA 2ML5A 2WO0A 4N6MA 4GB5A 1QVG2 1Q824 1EG9B 1NDOB 1Q40A 3EX9A 3LH4A 3CCV3 1BSEA 2CHCA 1JJ22 2BNGA 1LVNA 1RGFA 3K9MC 4K61A 3FG1A 4Q53A 1YHQ3 1X1WA 1DMMA 3PGBA 4BTXA 3TDGA 5IEPA 2OQEC 1Q7HA 1RN7A 4FCMA 5BVBA 3I0YA 2KF3A 2LYXA 3N8BA 4FCZA 1JKGB 2CG0A 4EYCA 4EW5A 1YJN3 1BNSA 3JUMA 2OTJ3 3KSPA 1V57A 1RN4A 1O7HB 4HM7B 1BRNL 1HU9A 4WHAA 1O7PB 3RNTA 1VQK3 3UB1A 1E3VA 1F8NA 3F7XA 3CC73 2KRTA 5JPUA 1BU4A 3B4PA 1I2GA 2W9PA 2H0IA 3BIRA 3MWZA 3BNBA 5EVHA 5IW9A 2ZL8A 2W04A 3UJMA 1IK3A 1RCKA 3I553 1FYSA 1RGGA 3A76A 2FGTA 1AV4A 3NBBA 2IUKA 4MMYB 3CPW2 2ZDJA 2HMNB 2CW9A 1BRSA 2P0MA 4OUQA 3DH2A 1CEWI 6STDA 4WP5A 2Z7AA 3Q1CA 1O7GB 1NNVA 5LC7A 1L5GB 1K734 4EXRA 4IT7A 3SX1A 5AEWB 1LOYA 2CK3H 3S28A 1SIIA 2OOVC 3PYJA 1RCLA 5ELJA 1LOWA 3VSYA 4HOHA 5AIFA 3Q3FA 1ZGXA 5JBSA 3NQYA 1N9EA 1B27A 1RSNA 1BNJA 1S723 4LEHA 4O02B 3CXC2 2B24B 3AHWA 3V98A 1HZ1A 4H3UA 3T0UA 1JKGA 1NO3A 3HX8A 4O2HA 3GSPA 5D82A 1VQ73 3Q90A 1B2MA 1IU7A 4FCJA 3B7CA 5AI1A 2KF4A 1FA3A 3K7CA 3IPTA 3A5EA 5IF6A 2IUJA 3X3XA 3WOEB 1N5PA 1MNLA 3DY5A 2L1SA 3NX0A 3OWSA 3WODG 3V92A 2MC8A 1M1XB 2F56A 2CG1A 2XR8B 4NHFA 1UGHI 3FCSB 1YI23 1W5ZA 4BL2A 1UGIA 2BMQB 4XDWA 3S5CA 4HKVB 1BSAA 1B21A 1JZOA 2O9UX 2J8XB 4L8PA 2P0XA 3N9HA 1RRHA 2R4IA 3DGNA 5CLKA 1BVIA 3HK4A 1AY7A 3EF8A 4AKYA 1SARA 3DZLA 1U8CB 2V1LA 1LQMB 2UUGC 4L8OA 3LT8A 1JN5A 3FZWA 2IMJA 1TRQA 3BLZA 4R9KA 2STDA 3DGYA 1UDII 1VQ53 5AIIA 2OOVA 4HM3B 1B2UA 1GOYA 1CQSA 3SLUA 5EEOA 1RKYA 1UI7A 4RBNA 1ASKA 1UCLA 2F98A 3NM2A 1A2PA 2GU3A 1VQM3 2GBXB 2QGUA 5D81A 3DGMA 1HYFA 1YNVX 3X41A 1RLSA 1JBTA 3ZG5A 5IG5A 4KFDA 3WA2X 3UL6A 4HVNA 7RNTA 1EUIC 3HOHA 3EN8A 4NREA 2BMRB 2MF7A 1RTUA 1T5YA 1GYBA 1YVBI 1M1K4 3KN4A 1G0TA 2W0QA 1B20A 2HMJB 3KIIA 3X3ZA 1RJOA 3ER7A 4FR9A 1FGMA 1FW7A 2XFTA 1JZDA 3CNMA 3HI7A 4XBTA 1MWRA 1TU5A 1WMOA 2XSHB 1K41A 1G96A 3D4AA 1K8A4 2Y74A 4BTYA 1UI8A 3NXJA 3CU3A 4I4KA 5A0OB 1GS3A 2CIUA 2GSPA 3FH1A 4HM8B 5I97A 3LTBA 4XB5A 5AYRB 1VQL3 3CCR3 3F8HA 4DKIA 1YJW3 3KZTA 1AQZA 3H3HA 1FUTA 3EJVA 2CWTA 1ULJB 1Q42A 1QVF2 4MJDA 1WTHA 5HGRA 1SQWA 3FLJA 1ISKA 1W01A 4XBYA 5AIHA 1FUSA 5AEUB 1EA2A 3D5GA 1N9JA 2XSOB 4N6TA 3STDA 2BU4A 1I8VA 1Q864 3I563 2HOHA 1W2B2 1JV2B 3EC9A 4QWTA 3SOAA 1UW1A 4HZBB 1A2KA 1FGTA 3G4S3 1VQ93 1RDSA 1ULIB 3JUQA 2H0GA 3LT9A 4HM6B 4EC6A 1CYUA 3CCL3 2XGLA 4X2HA 3GZRA 1S5AA 2WGOA 3EN1B 2P05A 3FG3A 2WOHA 4HM2B 1PFPA 2I9WA 2GBWB 3JUOA 4OK0A 4EV5A 3JUPA 3SVAA 2CH9A 5EQLA 1DVDA 2YFLB 1RN1A 1BSBA 4HM4B 1MGWA 2SBLA 3IMAB 1NB5I 1AVLA 1RGKA 3NBRA 1G02A 1B2ZA 4CDLA 1VQO3 3FG4A 1K28A 3WDGB 3D5IA 1YGEA 3AGNA 1ZX2A 3L0RA 3O8YA 5FGOA 1KC84 3U97A 1QJGA 2CFKA 1RGLA 1GY6A 2RCDA 1C7HA 2W56B 2XFSA 3ROBA 3F8XA 4J8TA 5IG4A 1MWTA 3AGOA 3H51A 2INXA 3X40A 3EHCA 3CC43 1GMPA 2ML6A 3CCQ3 4HYZA 4R9LA 2XH9A 3WA3A 1WQLB 2Z6BA 1VZZA 2CC3A 2XGNA 1PU4A 1B2SA 3OX9A 4MEIA 3X3YA 3X42A 1YVSA 5IEOA 2P38A 2HMMB 2RNTA 2M7OA 3FKAA 3WMDA 1A90A 5IG3A 1QMAA 2E2TA 1UCJA 2D42A 3FF2A 3KE7A 1BNFA 2XEPA 3N54B 1R4CA 3SXXA 3WOFB 2OWPA 1TRPA 2GU1A 3NM7A 1NJI4 4PEJA 1BUJA 3LTDA 1BIRA 3G16A 1O7MB 2HMLB 3VF1A 1A2VA 3MHEA 1IVXA 5KP1A 1JNQA 2BHMA 2IYJA 3CCE3 3CCU3 4ILFA 4IPBA 1ZS7A 3CME3 4WYKB 3G8ZA 1YIT3 1GSPA 2AAEA 3BU4A 4RNZA 1QAKA 2FNQA 1BNRA 1B3SA 1BGSA 4HAAA 3JUNA 4BIRA 1GOVA 3G0KA 3U1WA 1LXEA 1C54A 1OHOA 2C10A 4JRFA 4ZM8A 4ORLA 3G6E3 1EKMA 3PZWA 1BNIA 4HJLB 3CC23 2KXGA 1BRHA 5CK6A 1I3FA 2XRXB 1JB2A 1MOLA 1I70A 1M9GA 4RNTA 2RBIA 3LOYA 1OGZA 4N6NB 2W56A 1YGWA 3NQZA 4N6LA 3EB8A 1OUNA 2L4VA 4OVMA 3K5TA 1TIJA 2RSXA 4KT3B 1TP6A 4K1VA 3OV4A 3FGYA 1JB4A 4AEQA 8RNTA 2Q07A 5IERA 1Q7Y4 1KQS2 1E3RA 1W6CA 2ZHXB 3KCHA 4U13A 1A67A 1W00A 3EQQB 1BRIA 3K63A 5RNTA 1MWSA
chains in the Genus database with same CATH topology
1TFKA 5KP3A 3VGNA 5CF1A 3RDEA 1E97A 3J7Yd 1BUQA 1W6YA 3NHXA 1Z1SA 2GEYA 1SIHA 1FGQA 1GY5A 1IVUA 1W6GA 1FUWA 3FSDA 4WYKA 3LMLA 4HZ9B 1WMNA 3GAXA 3RGRA 3S67A 2CWVA 3JVCA 2UX0A 1VQP3 3LXUX 3GWRA 3PCSA 4HBRA 4KVHA 1VQ63 1VQN3 3T8UA 3DM8A 2JQ5A 4WWUC 2K54A 4J9AA 2YFJB 3SOYA 5DREA 1NB3I 2HMOB 5AYSC 4N6UA 3MG3A 1DMQA 3B4OA 3DGLA 2K0MA 1OACA 3D9RA 1FGOA 1W2ZA 1W7CA 4STDA 3DXOA 3AMOB 2E2UA 1IVWA 3BNCA 4IIAA 3SEDA 2CFGA 3MYTA 5KP4A 1W02A 2XF3A 3KKGA 3D3LA 4FMDA 4LSOA 4TX4A 3DMCA 1YIJ3 1IQXA 2BMOB 4H61A 1SPUA 2Y73A 1STDA 3GZXB 3HIIA 4XBXA 1DVCA 1IQYA 1N8QA 4RZMA 4CCVA 1YJ93 2WGQA 1D6YA 2A15A 3HIGA 3LTCA 1N8R4 2Z76A 3CCJ3 2CKFB 3CCM3 1DYUA 3T8NA 1RRLA 1W4NA 3EE1A 4AKZA 1GY7A 3NUVA 5D83A 3MPHA 1D6UA 3BNEA 3F14A 3IJEB 2WOFA 4HM0B 3NBJA 1FGRA 4HM1B 2CWUA 2F86B 1UUWB 3CPOA 5CF2A 3CNXA 5G2GA 3DUKA 2PZVA 2W9QA 4LGQA 2E2VA 4MMZB 1IV7A 4N3VA 2F99A 3QK9A 1OPYA 3CMA3 4MMXB 3UL5A 3AMOA 3EBYA 1IT8A 3M8CA 1LOXA 1HKXA 4R4KA 1OCVA 3NV0B 3GRDA 2JDIH 4HM5B 5IG0A 1IQ8A 1ROAA 1JN5B 4GL6A 3LTAA 3K0ZA 4WFOA 1N5HA 5FW5A 1LNHA 1AVKA 1WMPA 1O7NB 4K1UA 3OWYA 3KSED 3ECFA 2O3OA 4LMIA 2RGQA 1WNHA 3PCRA 5DRVA 2OQEA 1GD4A 1M904 2D1WA 4O3VA 8CHOA 1GD3A 4L7KA 1KWIA 4JF8A 2P09A 3MSOA 1CYVA 2QEX3 2IA7A 3G713 2B1XB 1OH0A 2YFIB 1OF5B 3KFQC 2CFWA 2Z77A 4R80A 4FMBA 4FMCA 4FMAA 1DMNA 4K90B 5LC6A 2FXTA 1NWWA 2GXFA 2C11A 1AR0A 1SJWA 5IENA 3BB9A 3PS8A 2BT3A 4BTWA 1NU3A 1QAFA 3S29A 1EQKA 3MKIA 4EBGA 3B8LA 5STDA 3CCS3 3HZPA 3S27A 3NV0A 3OWUA 1J2BA 2YX9A 5TGNA 7STDA 3MG1A 5JPPA 1Q814 1ROVA 2PNCA 1ZO2A 1TFOA 2RFRA 4EV2A 1JB5A 3ALAA 1UUVB 4RNYA 2OTL3 1IT7A 1TUHA 3GZYB 1Q40B 3Q2PA 3RGAA 3OW22 4X2OA 1IV9A 3MG2A 3GZBA 5ELUA 1STFI 1OHSA 2BO9B 3PXMA 1IDPA 2W2CA 3QRDA 4G1MB 2OCTA 4O8SA 5BXQA 1U5OA 3EBTA 3V99A 4KFEA 1KD14 1Y4KA 3F7SA 1JRQA 5CXOA 3UNLA 1K9M4 2GEXA 2CFLA 1D6ZA 2W6JH 3FF0A 2LQVA 1OF5A 4KFFA 4LZIA 4XM4A 1VQ83 2W03A 2QIYA 1O7WB 3DGOA 2QA43 3E99A 2HMKB 3LZAA 2KCDA 3BNDA 3LYGA 5AIGA 4R1KA 3F9SA 4KZ1A 1OHPA 1QALA 4XDVA 1VQ43 3CD63 1OGXA 3F40A 2CFDA 1US1A 3OXAA 1KSIA 1IVVA 4N6OB 1V74A 4N6V0 2ML5A 2WO0A 4N6MA 4GB5A 1QVG2 1Q824 1EG9B 1NDOB 1Q40A 3EX9A 3LH4A 3CCV3 2CHCA 1JJ22 2BNGA 1LVNA 3K9MC 4K61A 3FG1A 4Q53A 1YHQ3 1DMMA 3PGBA 4BTXA 3TDGA 5IEPA 2OQEC 1RN7A 4FCMA 5BVBA 3I0YA 2LYXA 3N8BA 4FCZA 1JKGB 2CG0A 4EYCA 1YJN3 3JUMA 2OTJ3 3KSPA 1O7HB 4HM7B 1HU9A 4WHAA 1O7PB 1VQK3 3UB1A 1E3VA 1F8NA 3F7XA 3CC73 2KRTA 5JPUA 3B4PA 2W9PA 3MWZA 5EVHA 5IW9A 3BNBA 2ZL8A 2W04A 3UJMA 1IK3A 3I553 3A76A 2FGTA 1AV4A 3NBBA 2IUKA 4MMYB 3CPW2 2ZDJA 2HMNB 2CW9A 2P0MA 4OUQA 1CEWI 6STDA 4WP5A 2Z7AA 3Q1CA 1O7GB 5LC7A 1L5GB 1K734 4EXRA 4IT7A 3SX1A 5AEWB 2CK3H 3S28A 1SIIA 2OOVC 3PYJA 5ELJA 3VSYA 5AIFA 5JBSA 3NQYA 1N9EA 1S723 4LEHA 4O02B 3CXC2 2B24B 3V98A 4H3UA 3T0UA 1JKGA 1NO3A 3HX8A 4O2HA 5D82A 1VQ73 3Q90A 1IU7A 4FCJA 3B7CA 5AI1A 1FA3A 3K7CA 3IPTA 5IF6A 2IUJA 3X3XA 3WOEB 1N5PA 1MNLA 3DY5A 3NX0A 3OWSA 3WODG 3V92A 2MC8A 1M1XB 2CG1A 2XR8B 4NHFA 3FCSB 1YI23 1W5ZA 2BMQB 4XDWA 3S5CA 4HKVB 2O9UX 4L8PA 2P0XA 3N9HA 1RRHA 2R4IA 3DGNA 5CLKA 3HK4A 3EF8A 4AKYA 3DZLA 1U8CB 2V1LA 4L8OA 3LT8A 1JN5A 3FZWA 2IMJA 3BLZA 4R9KA 2STDA 1VQ53 5AIIA 2OOVA 4HM3B 1CQSA 3SLUA 5EEOA 1RKYA 1UI7A 4RBNA 1ASKA 2F98A 3NM2A 2GU3A 1VQM3 2GBXB 2QGUA 5D81A 3DGMA 3X41A 5IG5A 4KFDA 3WA2X 3UL6A 4HVNA 3EN8A 4NREA 2BMRB 2MF7A 1T5YA 1GYBA 1YVBI 1M1K4 3KN4A 2W0QA 3KIIA 2HMJB 3X3ZA 1RJOA 3ER7A 4FR9A 1FGMA 2XFTA 3HI7A 3CNMA 4XBTA 1TU5A 1K8A4 1WMOA 2XSHB 1K41A 1G96A 2Y74A 4BTYA 1UI8A 3NXJA 3CU3A 4I4KA 5A0OB 1GS3A 2CIUA 3FH1A 4HM8B 5I97A 3LTBA 4XB5A 5AYRB 1VQL3 3CCR3 3F8HA 1YJW3 3KZTA 3H3HA 3EJVA 2CWTA 1ULJB 1Q42A 1QVF2 4MJDA 1WTHA 5HGRA 1SQWA 3FLJA 1ISKA 1W01A 4XBYA 5AIHA 5AEUB 1EA2A 1N9JA 2XSOB 4N6TA 3STDA 1Q864 3I563 1W2B2 1JV2B 3EC9A 4QWTA 3SOAA 1UW1A 4HZBB 1A2KA 1FGTA 3G4S3 1VQ93 1ULIB 3JUQA 3LT9A 4HM6B 4EC6A 1CYUA 3CCL3 2XGLA 4X2HA 3GZRA 1S5AA 2WGOA 3EN1B 2P05A 3FG3A 2WOHA 4HM2B 1PFPA 2I9WA 2GBWB 3JUOA 4OK0A 4EV5A 3JUPA 3SVAA 2CH9A 5EQLA 1DVDA 2YFLB 4HM4B 2SBLA 3IMAB 1NB5I 1AVLA 3NBRA 4CDLA 1VQO3 3FG4A 1K28A 3WDGB 1YGEA 3L0RA 1ZX2A 3O8YA 5FGOA 1KC84 3U97A 1QJGA 2CFKA 1GY6A 2RCDA 1C7HA 2W56B 2XFSA 3ROBA 3F8XA 4J8TA 5IG4A 3H51A 2INXA 3X40A 3EHCA 3CC43 2ML6A 3CCQ3 4HYZA 4R9LA 2XH9A 3WA3A 1WQLB 2Z6BA 1VZZA 2CC3A 2XGNA 1PU4A 3OX9A 4MEIA 3X3YA 3X42A 5IEOA 2P38A 2HMMB 2M7OA 3FKAA 3WMDA 1A90A 5IG3A 1QMAA 2E2TA 2D42A 3FF2A 3KE7A 3N54B 2XEPA 3SXXA 1R4CA 3WOFB 2OWPA 2GU1A 3NM7A 1NJI4 4PEJA 3LTDA 3G16A 1O7MB 2HMLB 3VF1A 1A2VA 3MHEA 1IVXA 5KP1A 1JNQA 2BHMA 3CCE3 3CCU3 4IPBA 3CME3 4WYKB 3G8ZA 1YIT3 4RNZA 1QAKA 2FNQA 3JUNA 3G0KA 3U1WA 1LXEA 1OHOA 2C10A 4JRFA 4ZM8A 4ORLA 3G6E3 1EKMA 3PZWA 4HJLB 3CC23 2KXGA 5CK6A 2XRXB 1JB2A 1MOLA 1M9GA 3LOYA 1OGZA 4N6NB 2W56A 3NQZA 4N6LA 3EB8A 1OUNA 2L4VA 4OVMA 3K5TA 1TIJA 2RSXA 1TP6A 4K1VA 3OV4A 3FGYA 1JB4A 4AEQA 2Q07A 5IERA 1Q7Y4 1KQS2 1E3RA 1W6CA 1A67A 4U13A 1W00A 3EQQB 3K63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CEW I;  3KFQ C;  5LC7 A;  1FUW A;  5LC6 A;  4IT7 A;  1N9J A;  4N6T A;  3GAX A;  3PYJ A;  3S67 A;  5ELJ A;  3PS8 A;  1EQK A;  1CYU A;  1NB3 I;  4N6U A;  1PFP A;  1FA3 A;  3SVA A;  2CH9 A;  5EQL A;  1DVD A;  3Q2P A;  1IV9 A;  1N5P A;  1MNL A;  3IMA B;  5ELU A;  3NX0 A;  1NB5 I;  1STF I;  2BO9 B;  3PXM A;  3QRD A;  4TX4 A;  2OCT A;  3L0R A;  1DVC A;  4CCV A;  2O9U X;  4LZI A;  1A90 A;  1R4C A;  4N6O B;  4N6V 0;  2W9Q A;  4N6M A;  1IV7 A;  3UL6 A;  3LH4 A;  3UL5 A;  3K9M C;  1LXE A;  1YVB I;  4ZM8 A;  1RN7 A;  2KXG A;  1ROA A;  4EYC A;  1MOL A;  1M9G A;  1G96 A;  4N6N B;  4N6L A;  1N5H A;  5A0O B;  1TIJ A;  3KSE D;  1WNH A;  2W9P A;  3MWZ A;  1GD4 A;  1A67 A;  1GD3 A;  1KWI A;  1CYV A; 
#chains in the Genus database with same CATH topology
 1TFK A;  5KP3 A;  6RNT A;  3VGN A;  1GMR A;  1FZU A;  4NPB A;  1RGC A;  5CF1 A;  3RDE A;  5M18 A;  1JBR A;  1E97 A;  2SAR A;  3J7Y d;  1BUQ A;  1W6Y A;  3NHX A;  1LRA A;  1Z1S A;  2GEY A;  1RNB A;  1SIH A;  1FGQ A;  1GY5 A;  1IVU A;  1W6G A;  1IYY A;  3FSD A;  1FUW A;  4WYK A;  3LML A;  4HZ9 B;  1WMN A;  3GAX A;  1V58 A;  1R4Y A;  1RGE A;  2AAD A;  1VQQ A;  2CWV A;  2H0H A;  3JVC A;  3RGR A;  3S67 A;  2UX0 A;  1VQP 3;  3LXU X;  1BSD A;  3GWR A;  3PCS A;  4HBR A;  4KVH A;  1VQ6 3;  1VQN 3;  3T8U A;  3DM8 A;  2JQ5 A;  4WWU C;  2K54 A;  4I5Q A;  4J9A A;  2YFJ B;  3SOY A;  5DRE A;  1GMQ A;  1NB3 I;  2HMO B;  5AYS C;  1LNI A;  4N6U A;  3MG3 A;  1DMQ A;  1RGA A;  2CX1 A;  2KF5 A;  3B4O A;  3DGL A;  2K0M A;  1T2H A;  1OAC A;  3D9R A;  1FGO A;  1W2Z A;  1W7C A;  1RMS A;  4STD A;  3DXO A;  3AMO B;  2E2U A;  1IVW A;  3BNC A;  4IIA A;  3SED A;  2CFG A;  3MYT A;  5KP4 A;  1W02 A;  5M19 A;  2XF3 A;  3KKG A;  3D3L A;  1Q9E A;  4FMD A;  4LSO A;  4TX4 A;  3DMC A;  1YIJ 3;  1IQX A;  1UCI A;  1PY3 A;  2BMO B;  3URP A;  4H61 A;  1SPU A;  2Y73 A;  1STD A;  1X1Y A;  3GZX B;  3HII A;  1DVC A;  1IQY A;  1N8Q A;  4RZM A;  4XBX A;  4CCV A;  1YJ9 3;  1BAN A;  2WGQ A;  1D6Y A;  2A15 A;  3HIG A;  3LTC A;  1N8R 4;  2Z76 A;  3CCJ 3;  3SYU A;  1I0X A;  2CKF B;  2IY2 A;  4J5K A;  3CCM 3;  1DYU A;  3T8N A;  1LOV A;  1RRL A;  1I2E A;  1W4N A;  1PYL A;  3EE1 A;  4AKZ A;  1GY7 A;  3NUV A;  1X1U A;  5D83 A;  1TJD A;  3MPH A;  1D6U A;  4J5G A;  3BNE A;  3F14 A;  3IJE B;  1JBS A;  1LQG C;  2WOF A;  4HM0 B;  3NBJ A;  1FGR A;  4HM1 B;  2CWU A;  2F86 B;  1UUW B;  3CPO A;  5CF2 A;  3CNX A;  5G2G A;  3DUK A;  2PZV A;  2W9Q A;  4LGQ A;  2E2V A;  4MMZ B;  1IV7 A;  2R41 A;  4N3V A;  2C4B A;  2F99 A;  3QK9 A;  1B2X A;  1OPY A;  2ZA4 A;  3CMA 3;  4MMX B;  3UL5 A;  3AMO A;  3EBY A;  1IT8 A;  3M8C A;  1BOX A;  5G1L A;  1LOX A;  4CJN A;  1BSC A;  1HKX A;  4R4K A;  1OCV A;  1BRJ A;  3NV0 B;  3GRD A;  2JDI H;  4BU4 A;  4HM5 B;  5IG0 A;  1IQ8 A;  1ROA A;  7GSP A;  1JN5 B;  3ZFZ A;  6GSP A;  4GL6 A;  1BAO A;  3LTA A;  3K0Z A;  1I2F A;  4WFO A;  1BNG A;  1N5H A;  5FW5 A;  1LNH A;  1UCK A;  1AVK A;  1MWU A;  1O7N B;  1I3I A;  1WMP A;  2CX0 A;  3OWY A;  4K1U A;  3KSE D;  3WR2 A;  3ECF A;  2O3O A;  4LMI A;  2RGQ A;  1WNH A;  3PCR A;  5DRV A;  2OQE A;  1GD4 A;  1M90 4;  2D1W A;  4O3V A;  8CHO A;  1BRK A;  1GD3 A;  1KWI A;  4L7K A;  4JF8 A;  2P09 A;  3MSO A;  1CYV A;  1EEJ A;  4LYL B;  2QEX 3;  2IA7 A;  3G71 3;  2B1X B;  9RNT A;  1OH0 A;  1RGH A;  2YFI B;  1OF5 B;  3KFQ C;  2CFW A;  2Z77 A;  5GSP A;  1BRG A;  2BIR A;  4FMB A;  4R80 A;  1T3B A;  4FMC A;  1BNE A;  4FMA A;  1DMN A;  4K90 B;  5LC6 A;  2FXT A;  1NWW A;  2GXF A;  2C11 A;  1AR0 A;  1SJW A;  3AHS A;  5IEN A;  2KF6 A;  3BB9 A;  3PS8 A;  2BT3 A;  4BTW A;  4GSP A;  1NU3 A;  1QAF A;  3S29 A;  5BIR A;  3MKI A;  1EQK A;  4EBG A;  1CH0 A;  3B8L A;  5STD A;  3CCS 3;  3HZP A;  1X1X A;  3S27 A;  3NV0 A;  3OWU A;  2F5W A;  1J2B A;  2YX9 A;  5TGN A;  1GOU A;  2KAA A;  5BU4 A;  7STD A;  3MG1 A;  5JPP A;  1Q81 4;  1ROV A;  2PNC A;  1ZO2 A;  1TFO A;  2RFR A;  4EV2 A;  1JB5 A;  3ALA A;  5M1A A;  1UUV B;  4RNY A;  2OTL 3;  1IT7 A;  1TUH A;  2UGI A;  1Q40 B;  1T2I A;  3GZY B;  3Q2P A;  3RGA A;  4X2O A;  5HOH A;  1IV9 A;  3OW2 2;  1DE3 A;  3MG2 A;  4GHO A;  1RHL A;  3GZB A;  5ELU A;  1STF I;  1OHS A;  2BO9 B;  3PXM A;  1IDP A;  1UUG B;  2W2C A;  3QRD A;  4G1M B;  2OCT A;  4O8S A;  5BXQ A;  1U5O A;  3EBT A;  3V99 A;  4KFE A;  1KD1 4;  1Y4K A;  2K3D A;  3F7S A;  1JRQ A;  5CXO A;  3UNL A;  1K9M 4;  5G1K A;  2GEX A;  2CFL A;  1D6Z A;  3D79 A;  3WHO A;  2W6J H;  3FF0 A;  2LQV A;  1OF5 A;  4KFF A;  4BL3 A;  1MGR A;  4LZI A;  4XM4 A;  1VQ8 3;  2W03 A;  2QIY A;  1O7W B;  3DGO A;  2QA4 3;  3ZG0 A;  3E99 A;  2HMK B;  3LZA A;  2KCD A;  3BND A;  3LYG A;  5AIG A;  4R1K A;  3F9S A;  4KZ1 A;  2F5M A;  1OHP A;  1I0V A;  1RNT A;  4CPK A;  1QAL A;  4XDV A;  1VQ4 3;  3CD6 3;  1OGX A;  3F40 A;  2CFD A;  1US1 A;  3OXA A;  1KSI A;  1IVV A;  4N6O B;  1V74 A;  1TTO A;  4N6V 0;  1DET A;  2F4Y A;  2ML5 A;  2WO0 A;  4N6M A;  4GB5 A;  1QVG 2;  1Q82 4;  1EG9 B;  1NDO B;  1Q40 A;  3EX9 A;  3LH4 A;  3CCV 3;  1BSE A;  2CHC A;  1JJ2 2;  2BNG A;  1LVN A;  1RGF A;  3K9M C;  4K61 A;  3FG1 A;  4Q53 A;  1YHQ 3;  1X1W A;  1DMM A;  3PGB A;  4BTX A;  3TDG A;  5IEP A;  2OQE C;  1Q7H A;  1RN7 A;  4FCM A;  5BVB A;  3I0Y A;  2KF3 A;  2LYX A;  3N8B A;  4FCZ A;  1JKG B;  2CG0 A;  4EYC A;  4EW5 A;  1YJN 3;  1BNS A;  3JUM A;  2OTJ 3;  3KSP A;  1V57 A;  1RN4 A;  1O7H B;  4HM7 B;  1BRN L;  1HU9 A;  4WHA A;  1O7P B;  3RNT A;  1VQK 3;  3UB1 A;  1E3V A;  1F8N A;  3F7X A;  3CC7 3;  2KRT A;  5JPU A;  1BU4 A;  3B4P A;  1I2G A;  2W9P A;  2H0I A;  3BIR A;  3MWZ A;  3BNB A;  5EVH A;  5IW9 A;  2ZL8 A;  2W04 A;  3UJM A;  1IK3 A;  1RCK A;  3I55 3;  1FYS A;  1RGG A;  3A76 A;  2FGT A;  1AV4 A;  3NBB A;  2IUK A;  4MMY B;  3CPW 2;  2ZDJ A;  2HMN B;  2CW9 A;  1BRS A;  2P0M A;  4OUQ A;  3DH2 A;  1CEW I;  6STD A;  4WP5 A;  2Z7A A;  3Q1C A;  1O7G B;  1NNV A;  5LC7 A;  1L5G B;  1K73 4;  4EXR A;  4IT7 A;  3SX1 A;  5AEW B;  1LOY A;  2CK3 H;  3S28 A;  1SII A;  2OOV C;  3PYJ A;  1RCL A;  5ELJ A;  1LOW A;  3VSY A;  4HOH A;  5AIF A;  3Q3F A;  1ZGX A;  5JBS A;  3NQY A;  1N9E A;  1B27 A;  1RSN A;  1BNJ A;  1S72 3;  4LEH A;  4O02 B;  3CXC 2;  2B24 B;  3AHW A;  3V98 A;  1HZ1 A;  4H3U A;  3T0U A;  1JKG A;  1NO3 A;  3HX8 A;  4O2H A;  3GSP A;  5D82 A;  1VQ7 3;  3Q90 A;  1B2M A;  1IU7 A;  4FCJ A;  3B7C A;  5AI1 A;  2KF4 A;  1FA3 A;  3K7C A;  3IPT A;  3A5E A;  5IF6 A;  2IUJ A;  3X3X A;  3WOE B;  1N5P A;  1MNL A;  3DY5 A;  2L1S A;  3NX0 A;  3OWS A;  3WOD G;  3V92 A;  2MC8 A;  1M1X B;  2F56 A;  2CG1 A;  2XR8 B;  4NHF A;  1UGH I;  3FCS B;  1YI2 3;  1W5Z A;  4BL2 A;  1UGI A;  2BMQ B;  4XDW A;  3S5C A;  4HKV B;  1BSA A;  1B21 A;  1JZO A;  2O9U X;  2J8X B;  4L8P A;  2P0X A;  3N9H A;  1RRH A;  2R4I A;  3DGN A;  5CLK A;  1BVI A;  3HK4 A;  1AY7 A;  3EF8 A;  4AKY A;  1SAR A;  3DZL A;  1U8C B;  2V1L A;  1LQM B;  2UUG C;  4L8O A;  3LT8 A;  1JN5 A;  3FZW A;  2IMJ A;  1TRQ A;  3BLZ A;  4R9K A;  2STD A;  3DGY A;  1UDI I;  1VQ5 3;  5AII A;  2OOV A;  4HM3 B;  1B2U A;  1GOY A;  1CQS A;  3SLU A;  5EEO A;  1RKY A;  1UI7 A;  4RBN A;  1ASK A;  1UCL A;  2F98 A;  3NM2 A;  1A2P A;  2GU3 A;  1VQM 3;  2GBX B;  2QGU A;  5D81 A;  3DGM A;  1HYF A;  1YNV X;  3X41 A;  1RLS A;  1JBT A;  3ZG5 A;  5IG5 A;  4KFD A;  3WA2 X;  3UL6 A;  4HVN A;  7RNT A;  1EUI C;  3HOH A;  3EN8 A;  4NRE A;  2BMR B;  2MF7 A;  1RTU A;  1T5Y A;  1GYB A;  1YVB I;  1M1K 4;  3KN4 A;  1G0T A;  2W0Q A;  1B20 A;  2HMJ B;  3KII A;  3X3Z A;  1RJO A;  3ER7 A;  4FR9 A;  1FGM A;  1FW7 A;  2XFT A;  1JZD A;  3CNM A;  3HI7 A;  4XBT A;  1MWR A;  1TU5 A;  1WMO A;  2XSH B;  1K41 A;  1G96 A;  3D4A A;  1K8A 4;  2Y74 A;  4BTY A;  1UI8 A;  3NXJ A;  3CU3 A;  4I4K A;  5A0O B;  1GS3 A;  2CIU A;  2GSP A;  3FH1 A;  4HM8 B;  5I97 A;  3LTB A;  4XB5 A;  5AYR B;  1VQL 3;  3CCR 3;  3F8H A;  4DKI A;  1YJW 3;  3KZT A;  1AQZ A;  3H3H A;  1FUT A;  3EJV A;  2CWT A;  1ULJ B;  1Q42 A;  1QVF 2;  4MJD A;  1WTH A;  5HGR A;  1SQW A;  3FLJ A;  1ISK A;  1W01 A;  4XBY A;  5AIH A;  1FUS A;  5AEU B;  1EA2 A;  3D5G A;  1N9J A;  2XSO B;  4N6T A;  3STD A;  2BU4 A;  1I8V A;  1Q86 4;  3I56 3;  2HOH A;  1W2B 2;  1JV2 B;  3EC9 A;  4QWT A;  3SOA A;  1UW1 A;  4HZB B;  1A2K A;  1FGT A;  3G4S 3;  1VQ9 3;  1RDS A;  1ULI B;  3JUQ A;  2H0G A;  3LT9 A;  4HM6 B;  4EC6 A;  1CYU A;  3CCL 3;  2XGL A;  4X2H A;  3GZR A;  1S5A A;  2WGO A;  3EN1 B;  2P05 A;  3FG3 A;  2WOH A;  4HM2 B;  1PFP A;  2I9W A;  2GBW B;  3JUO A;  4OK0 A;  4EV5 A;  3JUP A;  3SVA A;  2CH9 A;  5EQL A;  1DVD A;  2YFL B;  1RN1 A;  1BSB A;  4HM4 B;  1MGW A;  2SBL A;  3IMA B;  1NB5 I;  1AVL A;  1RGK A;  3NBR A;  1G02 A;  1B2Z A;  4CDL A;  1VQO 3;  3FG4 A;  1K28 A;  3WDG B;  3D5I A;  1YGE A;  3AGN A;  1ZX2 A;  3L0R A;  3O8Y A;  5FGO A;  1KC8 4;  3U97 A;  1QJG A;  2CFK A;  1RGL A;  1GY6 A;  2RCD A;  1C7H A;  2W56 B;  2XFS A;  3ROB A;  3F8X A;  4J8T A;  5IG4 A;  1MWT A;  3AGO A;  3H51 A;  2INX A;  3X40 A;  3EHC A;  3CC4 3;  1GMP A;  2ML6 A;  3CCQ 3;  4HYZ A;  4R9L A;  2XH9 A;  3WA3 A;  1WQL B;  2Z6B A;  1VZZ A;  2CC3 A;  2XGN A;  1PU4 A;  1B2S A;  3OX9 A;  4MEI A;  3X3Y A;  3X42 A;  1YVS A;  5IEO A;  2P38 A;  2HMM B;  2RNT A;  2M7O A;  3FKA A;  3WMD A;  1A90 A;  5IG3 A;  1QMA A;  2E2T A;  1UCJ A;  2D42 A;  3FF2 A;  3KE7 A;  1BNF A;  2XEP A;  3N54 B;  1R4C A;  3SXX A;  3WOF B;  2OWP A;  1TRP A;  2GU1 A;  3NM7 A;  1NJI 4;  4PEJ A;  1BUJ A;  3LTD A;  1BIR A;  3G16 A;  1O7M B;  2HML B;  3VF1 A;  1A2V A;  3MHE A;  1IVX A;  5KP1 A;  1JNQ A;  2BHM A;  2IYJ A;  3CCE 3;  3CCU 3;  4ILF A;  4IPB A;  1ZS7 A;  3CME 3;  4WYK B;  3G8Z A;  1YIT 3;  1GSP A;  2AAE A;  3BU4 A;  4RNZ A;  1QAK A;  2FNQ A;  1BNR A;  1B3S A;  1BGS A;  4HAA A;  3JUN A;  4BIR A;  1GOV A;  3G0K A;  3U1W A;  1LXE A;  1C54 A;  1OHO A;  2C10 A;  4JRF A;  4ZM8 A;  4ORL A;  3G6E 3;  1EKM A;  3PZW A;  1BNI A;  4HJL B;  3CC2 3;  2KXG A;  1BRH A;  5CK6 A;  1I3F A;  2XRX B;  1JB2 A;  1MOL A;  1I70 A;  1M9G A;  4RNT A;  2RBI A;  3LOY A;  1OGZ A;  4N6N B;  2W56 A;  1YGW A;  3NQZ A;  4N6L A;  3EB8 A;  1OUN A;  2L4V A;  4OVM A;  3K5T A;  1TIJ A;  2RSX A;  4KT3 B;  1TP6 A;  4K1V A;  3OV4 A;  3FGY A;  1JB4 A;  4AEQ A;  8RNT A;  2Q07 A;  5IER A;  1Q7Y 4;  1KQS 2;  1E3R A;  1W6C A;  2ZHX B;  3KCH A;  4U13 A;  1A67 A;  1W00 A;  3EQQ B;  1BRI A;  3K63 A;  5RNT A;  1MWS A; 
#chains in the Genus database with same CATH homology
 1TFK A;  5KP3 A;  3VGN A;  5CF1 A;  3RDE A;  1E97 A;  3J7Y d;  1BUQ A;  1W6Y A;  3NHX A;  1Z1S A;  2GEY A;  1SIH A;  1FGQ A;  1GY5 A;  1IVU A;  1W6G A;  1FUW A;  3FSD A;  4WYK A;  3LML A;  4HZ9 B;  1WMN A;  3GAX A;  3RGR A;  3S67 A;  2CWV A;  3JVC A;  2UX0 A;  1VQP 3;  3LXU X;  3GWR A;  3PCS A;  4HBR A;  4KVH A;  1VQ6 3;  1VQN 3;  3T8U A;  3DM8 A;  2JQ5 A;  4WWU C;  2K54 A;  4J9A A;  2YFJ B;  3SOY A;  5DRE A;  1NB3 I;  2HMO B;  5AYS C;  4N6U A;  3MG3 A;  1DMQ A;  3B4O A;  3DGL A;  2K0M A;  1OAC A;  3D9R A;  1FGO A;  1W2Z A;  1W7C A;  4STD A;  3DXO A;  3AMO B;  2E2U A;  1IVW A;  3BNC A;  4IIA A;  3SED A;  2CFG A;  3MYT A;  5KP4 A;  1W02 A;  2XF3 A;  3KKG A;  3D3L A;  4FMD A;  4LSO A;  4TX4 A;  3DMC A;  1YIJ 3;  1IQX A;  2BMO B;  4H61 A;  1SPU A;  2Y73 A;  1STD A;  3GZX B;  3HII A;  4XBX A;  1DVC A;  1IQY A;  1N8Q A;  4RZM A;  4CCV A;  1YJ9 3;  2WGQ A;  1D6Y A;  2A15 A;  3HIG A;  3LTC A;  1N8R 4;  2Z76 A;  3CCJ 3;  2CKF B;  3CCM 3;  1DYU A;  3T8N A;  1RRL A;  1W4N A;  3EE1 A;  4AKZ A;  1GY7 A;  3NUV A;  5D83 A;  3MPH A;  1D6U A;  3BNE A;  3F14 A;  3IJE B;  2WOF A;  4HM0 B;  3NBJ A;  1FGR A;  4HM1 B;  2CWU A;  2F86 B;  1UUW B;  3CPO A;  5CF2 A;  3CNX A;  5G2G A;  3DUK A;  2PZV A;  2W9Q A;  4LGQ A;  2E2V A;  4MMZ B;  1IV7 A;  4N3V A;  2F99 A;  3QK9 A;  1OPY A;  3CMA 3;  4MMX B;  3UL5 A;  3AMO A;  3EBY A;  1IT8 A;  3M8C A;  1LOX A;  1HKX A;  4R4K A;  1OCV A;  3NV0 B;  3GRD A;  2JDI H;  4HM5 B;  5IG0 A;  1IQ8 A;  1ROA A;  1JN5 B;  4GL6 A;  3LTA A;  3K0Z A;  4WFO A;  1N5H A;  5FW5 A;  1LNH A;  1AVK A;  1WMP A;  1O7N B;  4K1U A;  3OWY A;  3KSE D;  3ECF A;  2O3O A;  4LMI A;  2RGQ A;  1WNH A;  3PCR A;  5DRV A;  2OQE A;  1GD4 A;  1M90 4;  2D1W A;  4O3V A;  8CHO A;  1GD3 A;  4L7K A;  1KWI A;  4JF8 A;  2P09 A;  3MSO A;  1CYV A;  2QEX 3;  2IA7 A;  3G71 3;  2B1X B;  1OH0 A;  2YFI B;  1OF5 B;  3KFQ C;  2CFW A;  2Z77 A;  4R80 A;  4FMB A;  4FMC A;  4FMA A;  1DMN A;  4K90 B;  5LC6 A;  2FXT A;  1NWW A;  2GXF A;  2C11 A;  1AR0 A;  1SJW A;  5IEN A;  3BB9 A;  3PS8 A;  2BT3 A;  4BTW A;  1NU3 A;  1QAF A;  3S29 A;  1EQK A;  3MKI A;  4EBG A;  3B8L A;  5STD A;  3CCS 3;  3HZP A;  3S27 A;  3NV0 A;  3OWU A;  1J2B A;  2YX9 A;  5TGN A;  7STD A;  3MG1 A;  5JPP A;  1Q81 4;  1ROV A;  2PNC A;  1ZO2 A;  1TFO A;  2RFR A;  4EV2 A;  1JB5 A;  3ALA A;  1UUV B;  4RNY A;  2OTL 3;  1IT7 A;  1TUH A;  3GZY B;  1Q40 B;  3Q2P A;  3RGA A;  3OW2 2;  4X2O A;  1IV9 A;  3MG2 A;  3GZB A;  5ELU A;  1STF I;  1OHS A;  2BO9 B;  3PXM A;  1IDP A;  2W2C A;  3QRD A;  4G1M B;  2OCT A;  4O8S A;  5BXQ A;  1U5O A;  3EBT A;  3V99 A;  4KFE A;  1KD1 4;  1Y4K A;  3F7S A;  1JRQ A;  5CXO A;  3UNL A;  1K9M 4;  2GEX A;  2CFL A;  1D6Z A;  2W6J H;  3FF0 A;  2LQV A;  1OF5 A;  4KFF A;  4LZI A;  4XM4 A;  1VQ8 3;  2W03 A;  2QIY A;  1O7W B;  3DGO A;  2QA4 3;  3E99 A;  2HMK B;  3LZA A;  2KCD A;  3BND A;  3LYG A;  5AIG A;  4R1K A;  3F9S A;  4KZ1 A;  1OHP A;  1QAL A;  4XDV A;  1VQ4 3;  3CD6 3;  1OGX A;  3F40 A;  2CFD A;  1US1 A;  3OXA A;  1KSI A;  1IVV A;  4N6O B;  1V74 A;  4N6V 0;  2ML5 A;  2WO0 A;  4N6M A;  4GB5 A;  1QVG 2;  1Q82 4;  1EG9 B;  1NDO B;  1Q40 A;  3EX9 A;  3LH4 A;  3CCV 3;  2CHC A;  1JJ2 2;  2BNG A;  1LVN A;  3K9M C;  4K61 A;  3FG1 A;  4Q53 A;  1YHQ 3;  1DMM A;  3PGB A;  4BTX A;  3TDG A;  5IEP A;  2OQE C;  1RN7 A;  4FCM A;  5BVB A;  3I0Y A;  2LYX A;  3N8B A;  4FCZ A;  1JKG B;  2CG0 A;  4EYC A;  1YJN 3;  3JUM A;  2OTJ 3;  3KSP A;  1O7H B;  4HM7 B;  1HU9 A;  4WHA A;  1O7P B;  1VQK 3;  3UB1 A;  1E3V A;  1F8N A;  3F7X A;  3CC7 3;  2KRT A;  5JPU A;  3B4P A;  2W9P A;  3MWZ A;  5EVH A;  5IW9 A;  3BNB A;  2ZL8 A;  2W04 A;  3UJM A;  1IK3 A;  3I55 3;  3A76 A;  2FGT A;  1AV4 A;  3NBB A;  2IUK A;  4MMY B;  3CPW 2;  2ZDJ A;  2HMN B;  2CW9 A;  2P0M A;  4OUQ A;  1CEW I;  6STD A;  4WP5 A;  2Z7A A;  3Q1C A;  1O7G B;  5LC7 A;  1L5G B;  1K73 4;  4EXR A;  4IT7 A;  3SX1 A;  5AEW B;  2CK3 H;  3S28 A;  1SII A;  2OOV C;  3PYJ A;  5ELJ A;  3VSY A;  5AIF A;  5JBS A;  3NQY A;  1N9E A;  1S72 3;  4LEH A;  4O02 B;  3CXC 2;  2B24 B;  3V98 A;  4H3U A;  3T0U A;  1JKG A;  1NO3 A;  3HX8 A;  4O2H A;  5D82 A;  1VQ7 3;  3Q90 A;  1IU7 A;  4FCJ A;  3B7C A;  5AI1 A;  1FA3 A;  3K7C A;  3IPT A;  5IF6 A;  2IUJ A;  3X3X A;  3WOE B;  1N5P A;  1MNL A;  3DY5 A;  3NX0 A;  3OWS A;  3WOD G;  3V92 A;  2MC8 A;  1M1X B;  2CG1 A;  2XR8 B;  4NHF A;  3FCS B;  1YI2 3;  1W5Z A;  2BMQ B;  4XDW A;  3S5C A;  4HKV B;  2O9U X;  4L8P A;  2P0X A;  3N9H A;  1RRH A;  2R4I A;  3DGN A;  5CLK A;  3HK4 A;  3EF8 A;  4AKY A;  3DZL A;  1U8C B;  2V1L A;  4L8O A;  3LT8 A;  1JN5 A;  3FZW A;  2IMJ A;  3BLZ A;  4R9K A;  2STD A;  1VQ5 3;  5AII A;  2OOV A;  4HM3 B;  1CQS A;  3SLU A;  5EEO A;  1RKY A;  1UI7 A;  4RBN A;  1ASK A;  2F98 A;  3NM2 A;  2GU3 A;  1VQM 3;  2GBX B;  2QGU A;  5D81 A;  3DGM A;  3X41 A;  5IG5 A;  4KFD A;  3WA2 X;  3UL6 A;  4HVN A;  3EN8 A;  4NRE A;  2BMR B;  2MF7 A;  1T5Y A;  1GYB A;  1YVB I;  1M1K 4;  3KN4 A;  2W0Q A;  3KII A;  2HMJ B;  3X3Z A;  1RJO A;  3ER7 A;  4FR9 A;  1FGM A;  2XFT A;  3HI7 A;  3CNM A;  4XBT A;  1TU5 A;  1K8A 4;  1WMO A;  2XSH B;  1K41 A;  1G96 A;  2Y74 A;  4BTY A;  1UI8 A;  3NXJ A;  3CU3 A;  4I4K A;  5A0O B;  1GS3 A;  2CIU A;  3FH1 A;  4HM8 B;  5I97 A;  3LTB A;  4XB5 A;  5AYR B;  1VQL 3;  3CCR 3;  3F8H A;  1YJW 3;  3KZT A;  3H3H A;  3EJV A;  2CWT A;  1ULJ B;  1Q42 A;  1QVF 2;  4MJD A;  1WTH A;  5HGR A;  1SQW A;  3FLJ A;  1ISK A;  1W01 A;  4XBY A;  5AIH A;  5AEU B;  1EA2 A;  1N9J A;  2XSO B;  4N6T A;  3STD A;  1Q86 4;  3I56 3;  1W2B 2;  1JV2 B;  3EC9 A;  4QWT A;  3SOA A;  1UW1 A;  4HZB B;  1A2K A;  1FGT A;  3G4S 3;  1VQ9 3;  1ULI B;  3JUQ A;  3LT9 A;  4HM6 B;  4EC6 A;  1CYU A;  3CCL 3;  2XGL A;  4X2H A;  3GZR A;  1S5A A;  2WGO A;  3EN1 B;  2P05 A;  3FG3 A;  2WOH A;  4HM2 B;  1PFP A;  2I9W A;  2GBW B;  3JUO A;  4OK0 A;  4EV5 A;  3JUP A;  3SVA A;  2CH9 A;  5EQL A;  1DVD A;  2YFL B;  4HM4 B;  2SBL A;  3IMA B;  1NB5 I;  1AVL A;  3NBR A;  4CDL A;  1VQO 3;  3FG4 A;  1K28 A;  3WDG B;  1YGE A;  3L0R A;  1ZX2 A;  3O8Y A;  5FGO A;  1KC8 4;  3U97 A;  1QJG A;  2CFK A;  1GY6 A;  2RCD A;  1C7H A;  2W56 B;  2XFS A;  3ROB A;  3F8X A;  4J8T A;  5IG4 A;  3H51 A;  2INX A;  3X40 A;  3EHC A;  3CC4 3;  2ML6 A;  3CCQ 3;  4HYZ A;  4R9L A;  2XH9 A;  3WA3 A;  1WQL B;  2Z6B A;  1VZZ A;  2CC3 A;  2XGN A;  1PU4 A;  3OX9 A;  4MEI A;  3X3Y A;  3X42 A;  5IEO A;  2P38 A;  2HMM B;  2M7O A;  3FKA A;  3WMD A;  1A90 A;  5IG3 A;  1QMA A;  2E2T A;  2D42 A;  3FF2 A;  3KE7 A;  3N54 B;  2XEP A;  3SXX A;  1R4C A;  3WOF B;  2OWP A;  2GU1 A;  3NM7 A;  1NJI 4;  4PEJ A;  3LTD A;  3G16 A;  1O7M B;  2HML B;  3VF1 A;  1A2V A;  3MHE A;  1IVX A;  5KP1 A;  1JNQ A;  2BHM A;  3CCE 3;  3CCU 3;  4IPB A;  3CME 3;  4WYK B;  3G8Z A;  1YIT 3;  4RNZ A;  1QAK A;  2FNQ A;  3JUN A;  3G0K A;  3U1W A;  1LXE A;  1OHO A;  2C10 A;  4JRF A;  4ZM8 A;  4ORL A;  3G6E 3;  1EKM A;  3PZW A;  4HJL B;  3CC2 3;  2KXG A;  5CK6 A;  2XRX B;  1JB2 A;  1MOL A;  1M9G A;  3LOY A;  1OGZ A;  4N6N B;  2W56 A;  3NQZ A;  4N6L A;  3EB8 A;  1OUN A;  2L4V A;  4OVM A;  3K5T A;  1TIJ A;  2RSX A;  1TP6 A;  4K1V A;  3OV4 A;  3FGY A;  1JB4 A;  4AEQ A;  2Q07 A;  5IER A;  1Q7Y 4;  1KQS 2;  1E3R A;  1W6C A;  1A67 A;  4U13 A;  1W00 A;  3EQQ B;  3K63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...