1SU3A

X-ray structure of human prommp-1: new insights into collagenase action
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
435
structure length
415
Chain Sequence
DLVQKYLEKYYNLKGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interstitial collagenase
publication title X-ray structure of human proMMP-1: new insights into procollagenase activation and collagen binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 111
structure length 415
sequence length 435
chains with identical sequence B
ec nomenclature ec 3.4.24.7: Interstitial collagenase.
pdb deposition date 2004-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00045 Hemopexin Hemopexin
A PF00413 Peptidase_M10 Matrixin
A PF01471 PG_binding_1 Putative peptidoglycan binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.110.10.10 Mainly Beta 4 Propeller Hemopexin Hemopexin-like domain 1su3A02
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1su3A01
4FXQA 1IAEA 1GE6A 2JNPA 1Y93A 2AIGP 4PKVA 4H3XA 1EB6A 2XS3A 2I47A 4OEIA 3OYOA 1S4BP 5D1SA 1Z3JA 4FU4A 3N2VA 4XBHA 1ATLA 1H71P 3MA2A 4H1QA 1PWQA 1OM7A 3LE9A 4XCTA 5I4OA 3WV1A 1PWUA 4R3VA 1CIZA 3B2ZA 3ZVSA 2Z2DA 1R1JA 2K2GA 2CLTA 1JK3A 3EDZA 1MMRA 3F15A 3Q2HA 3KEKA 4XM7A 4H30A 4PKQA 2POJA 2DDYA 3LJZA 3DNGA 4HSDA 1EUBA 2FV9A 4GF1A 3GBOA 4GUYA 3L0VA 5D2BA 3OHLA 4WKEA 3I7IA 5I12A 3ZXHA 3LK8A 1XFYA 3VI1A 1G4KA 1JIWP 1I73A 3N2UA 1G9KA 1R54A 1JKYA 1YQYA 1PWWA 4ILWD 1BQQM 1UMTA 2WOAA 3LIRA 1D7XA 4JQGA 3LUMA 3F1AA 2JT5A 1QJJA 1L6JA 1OM8A 5D7WA 2YB9A 2L0RA 4A3WA 1XUCA 3BA0A 1UTTA 2O3EA 2KRJA 456CA 1XFWA 1JAPA 1OS2A 2RJQA 1ND1A 3RTSA 1QJSA 4G0DA 3F18A 2WO8A 3HDAP 3B8ZA 3TSKA 1KAPP 1MNCA 3I7GA 4HMAA 4I35A 4IN9A 1D8FA 1J7NA 5B5PA 1ZTQA 3HDBA 1SMPA 1XURA 1BSWA 4H84A 3P24A 1OS9A 1JJ9A 1KUHA 4J4MA 4WZVA 1CK7A 1QJIA 2DW2A 2JT6A 1AKLA 2W13A 5H8XA 2USNA 1CGLA 1MMQA 1QIAA 2MZEA 1CXVA 3E8RA 2W12A 4GWNA 2OXZA 3C7XA 4H82A 2D1OA 1OMJA 1UEAA 3EDIA 1D8MA 1I76A 1ZS0A 2WO9A 3TT4A 2EROA 2E3XA 2X7MA 3WV2A 4WK7A 5CUHA 1WNIA 1BUDA 3DL1A 1CGEA 2OVXA 1I1IP 4JPAA 1HXNA 3LUNA 3ELMA 4PKWA 1SRPA 2D1NA 5CZMA 4XM6A 3EDHA 2AYKA 1KBCA 1JAOA 2FV5A 3TVCA 1ZXCA 3RTTA 2X3AA 3F17A 1HTDA 4AIGA 1QUAA 2JIHA 4PKRA 1PEXA 4JIJA 1SLNA 3HB2P 1IADA 1OM6A 2OXWA 2OVZA 4G9LA 4FXYP 3EHYA 3U1RA 2N8RA 5JMYA 4LL2A 3O64A 3KWVC 1IACA 1A86A 1OO9A 3DPEA 1D5JA 5D3CA 2MLRA 1Y0VA 3P1VA 5L7FA 3SHIA 1PWPA 1IAGA 3AIGA 1G05A 1ZVXA 4DV8A 2CKIA 1SU3A 1C8TA 5LABA 1KUGA 1GENA 4GR3A 2E2DA 5B5OA 2DDFA 1K7QA 1GKDA 4L63A 2XS4A 1XFXA 1JIZA 2YIGA 2TCLA 3WV3A 2Y6CA 1SLMA 1FBLA 1JAQA 1DMTA 2MZHA 2OZRA 4WF6A 4IUWA 2JXYA 4DPEA 4QKZA 3LJTA 830CA 1K7GA 1ITVA 3HYGA 2OW1A 2X3CA 3L0TA 5I43A 4ON1A 2K9CA 4PKUA 4DF9A 3VTGA 3KMCA 3K7NA 3AYUA 3G5CA 4JP4A 1K7IA 1GXDA 1XFUA 3CKIA 2OI0A 3KECA 1BM6A 1R1IA 1BQOA 1ROSA 3EDGA 1QHUA 1HV5A 4H2EA 1UMSA 3NX7A 3OHOA 1UTZA 2OXUA 3LJGA 4HX3A 3EHXA 3DSLA 1DTHA 1XFZA 2JSDA 4L6TA 2J0TA 5I0LA 4FVLA 1HOVA 3KMEA 1CAQA 4A7BA 1XUDA 1MMBA 1Y8JA 3LP9A 1BZSA 1AYKA 2SRTA 2A8HA 1BKCI 2DW0A 3S18A 1BKCA 1YP1A 1KUIA 5I2ZA 1QIBA 1IABA 3B92A 1CQRA 3LEAA 2MLSA 3F19A 1B8YA 1ZP5A 3KHIA 4CTHA 4DD8A 5L79A 3G42A 3KEJA 3LQBA 3K7LA 3HBVP 2DW1A 2W0DA 1PWVA 1HFCA 1GO8P 1GE7A 1ZXVA 2OW0A 1KUKA 3LMCA 1RTGA 5BOTA 2X3BA 4PKSA 4PKTA 5D1UA 4ZR5A 3USNA 1G49A 1GE5A 2W14A 1SATA 5BPAA 1FM1A 3V6NA 4I03A 4H76A 4AXQA 4H49A 4WKIA 4GR8A 1YCMA 4Q1LA 1HY7A 4GWMA 3UVCA 3DWBA 2J83A 2OY2A 3HY9A 2OY4A 4IJOA 3V96B 2OW9A 2QPJA 1RM8A 3LQ0A 3LGPA 2HU6A 3F16A 4GQLA 3LIKA 5CXAA 2PJTA 4L19A 1EAKA 3O2XA 2ERQA 2Y6DA 1C7KA 2MZIA 3DPFA 2O36A 1GKCA 1FLSA 1QICA 1O0TA 1RMZA 3TS4A 1G12A 1R1HA 4GR0A 1B3DA 1MMPA 1Q3AA 1ASTA 2OW2A 1XFVA 4XM8A 2ERPA 3AYKA 3LILA 4JA1A 5BOYA 1AF0A 4YEHA 1A85A 1CGFA 1BUVM 1JH1A 4RT6B 3LKAA 5D1TA 1HFSA 3ZUKA 2RJPA 2MQSA 4EFSA 1JANA 1YOUA 1BKCE 1GO7P 1R55A 1O0QA 1KUFA 2W15A 3EWJA 1C3IA 3Q2GA 4AYKA 1BIWA 1IAAA 3KRYA 4AUOA 3HBUP 3HY7A 5I3MA 1USNA 966CA 2V4BA
chains in the Genus database with same CATH superfamily
4FXQA 1IAEA 1GE6A 2JNPA 1Y93A 2AIGP 4PKVA 4H3XA 1EB6A 1OZ9A 2XS3A 2I47A 4OEIA 3OYOA 1S4BP 5D1SA 1Z3JA 4FU4A 3N2VA 4XBHA 1ATLA 1H71P 3MA2A 4H1QA 1PWQA 1OM7A 3LE9A 4XCTA 5I4OA 3WV1A 1PWUA 4R3VA 1CIZA 3B2ZA 3ZVSA 2Z2DA 1R1JA 2K2GA 2CLTA 1JK3A 3EDZA 1MMRA 3F15A 3Q2HA 3KEKA 4XM7A 4H30A 4PKQA 2POJA 3DTKA 2DDYA 3LJZA 3DNGA 4HSDA 1EUBA 2FV9A 4GF1A 3GBOA 4GUYA 3L0VA 5D2BA 3OHLA 4WKEA 3I7IA 5I12A 3ZXHA 3LK8A 1XFYA 3VI1A 1G4KA 1JIWP 1I73A 3N2UA 1G9KA 1R54A 1JKYA 1YQYA 1PWWA 4ILWD 1BQQM 1UMTA 2WOAA 3DTEA 3LIRA 1D7XA 4JQGA 3LUMA 3F1AA 2JT5A 1QJJA 1L6JA 1OM8A 5D7WA 2YB9A 2L0RA 4A3WA 1XUCA 3BA0A 1UTTA 2O3EA 2KRJA 456CA 1XFWA 1JAPA 1OS2A 2RJQA 1ND1A 3RTSA 1QJSA 4G0DA 3F18A 2WO8A 3HDAP 3B8ZA 3TSKA 1KAPP 1MNCA 3I7GA 4HMAA 4I35A 4IN9A 1D8FA 1J7NA 5B5PA 1ZTQA 3HDBA 1SMPA 1XURA 1BSWA 4H84A 3P24A 1OS9A 1JJ9A 2YUFA 1KUHA 4J4MA 4WZVA 1CK7A 1QJIA 2DW2A 2JT6A 1AKLA 2W13A 5H8XA 2USNA 1CGLA 1MMQA 1QIAA 2MZEA 1CXVA 3E8RA 2W12A 4GWNA 2OXZA 3C7XA 4H82A 2D1OA 1OMJA 1UEAA 3EDIA 1D8MA 1I76A 1ZS0A 2WO9A 3TT4A 2EROA 2E3XA 2X7MA 3WV2A 4WK7A 5CUHA 1WNIA 1BUDA 3DL1A 1CGEA 2OVXA 1I1IP 4JPAA 1HXNA 3LUNA 3ELMA 1XAXA 4PKWA 1SRPA 2D1NA 5CZMA 4XM6A 3EDHA 2AYKA 1KBCA 1JAOA 2FV5A 3TVCA 1ZXCA 3RTTA 2X3AA 3F17A 1HTDA 4AIGA 1QUAA 2JIHA 4PKRA 1PEXA 4JIJA 1SLNA 3HB2P 1IADA 1OM6A 2OXWA 2OVZA 4G9LA 4FXYP 3EHYA 3U1RA 2N8RA 5JMYA 4LL2A 3O64A 3KWVC 1IACA 1A86A 1OO9A 3DPEA 1D5JA 5D3CA 2MLRA 1Y0VA 3P1VA 5L7FA 3SHIA 1PWPA 1IAGA 3AIGA 1G05A 1ZVXA 4DV8A 2CKIA 1SU3A 1C8TA 5LABA 3DTIA 1KUGA 1GENA 4GR3A 2E2DA 5B5OA 2DDFA 1K7QA 1GKDA 4L63A 2XS4A 1XFXA 1JIZA 2YIGA 2TCLA 3WV3A 2Y6CA 1SLMA 1FBLA 1JAQA 1DMTA 2MZHA 2OZRA 4WF6A 4IUWA 2JXYA 4DPEA 4QKZA 3LJTA 830CA 1K7GA 1ITVA 4L7AA 3HYGA 2OW1A 2X3CA 3L0TA 5I43A 4ON1A 2K9CA 4PKUA 4DF9A 3VTGA 3KMCA 3K7NA 3AYUA 3G5CA 4JP4A 1K7IA 1GXDA 1XFUA 3CKIA 2OI0A 3KECA 1BM6A 1R1IA 1BQOA 1ROSA 3EDGA 1QHUA 1HV5A 4H2EA 1UMSA 3NX7A 3OHOA 1UTZA 2OXUA 3LJGA 4HX3A 3EHXA 3DSLA 1DTHA 1XFZA 2JSDA 4L6TA 2J0TA 5I0LA 4FVLA 1HOVA 3KMEA 1CAQA 4A7BA 1XUDA 1MMBA 1Y8JA 3LP9A 1BZSA 1AYKA 2SRTA 2A8HA 1BKCI 2DW0A 3S18A 1BKCA 1YP1A 1KUIA 5I2ZA 1QIBA 1IABA 3B92A 1CQRA 3LEAA 2MLSA 3F19A 1B8YA 1ZP5A 3KHIA 4CTHA 4DD8A 5L79A 3G42A 1XM5A 3KEJA 3LQBA 3K7LA 3HBVP 2DW1A 2W0DA 1PWVA 1HFCA 1GO8P 1GE7A 1ZXVA 2OW0A 1KUKA 3LMCA 1RTGA 5BOTA 2X3BA 4PKSA 4PKTA 5D1UA 4ZR5A 3USNA 1G49A 1GE5A 2W14A 1SATA 5BPAA 1FM1A 3V6NA 4I03A 4H76A 4AXQA 4H49A 4WKIA 4GR8A 1YCMA 4Q1LA 1HY7A 4GWMA 3UVCA 1TVIA 3DWBA 2J83A 2OY2A 3HY9A 2OY4A 4IJOA 3V96B 2OW9A 2QPJA 1RM8A 3LQ0A 3LGPA 2HU6A 3F16A 4GQLA 3LIKA 5CXAA 2PJTA 4L19A 1EAKA 3O2XA 2ERQA 2Y6DA 1C7KA 2MZIA 3DPFA 2O36A 1GKCA 1FLSA 1QICA 1O0TA 1RMZA 3TS4A 1G12A 1R1HA 4GR0A 1B3DA 1MMPA 1Q3AA 1ASTA 2OW2A 1XFVA 4XM8A 2ERPA 3AYKA 3LILA 4JA1A 5BOYA 1AF0A 4YEHA 1A85A 1CGFA 1BUVM 1JH1A 4RT6B 3LKAA 5D1TA 1HFSA 3ZUKA 2RJPA 2MQSA 4EFSA 1JANA 1YOUA 1BKCE 1GO7P 1R55A 1O0QA 1KUFA 2W15A 3EWJA 1C3IA 3Q2GA 4AYKA 1BIWA 1IAAA 3KRYA 4AUOA 3HBUP 3HY7A 5I3MA 1USNA 966CA 2V4BA
chains in the Genus database with same CATH topology
4FXQA 1IAEA 1GE6A 2JNPA 1Y93A 2AIGP 4PKVA 4H3XA 1EB6A 2XS3A 2I47A 4OEIA 3OYOA 1S4BP 5D1SA 1Z3JA 4FU4A 3N2VA 4XBHA 1ATLA 1H71P 3MA2A 4H1QA 1PWQA 1OM7A 3LE9A 4XCTA 5I4OA 3WV1A 1PWUA 4R3VA 1CIZA 3B2ZA 3ZVSA 2Z2DA 1R1JA 2K2GA 2CLTA 1JK3A 3EDZA 1MMRA 3F15A 3Q2HA 3KEKA 4XM7A 4H30A 4PKQA 2POJA 3DTKA 2DDYA 3LJZA 3DNGA 4HSDA 1EUBA 2FV9A 4GF1A 3GBOA 4GUYA 3L0VA 5D2BA 3OHLA 4WKEA 3I7IA 5I12A 3ZXHA 3LK8A 1XFYA 3VI1A 1G4KA 1JIWP 1I73A 3N2UA 1G9KA 1R54A 1JKYA 1YQYA 1PWWA 4ILWD 1BQQM 1UMTA 2WOAA 3DTEA 3LIRA 1D7XA 4JQGA 3LUMA 3F1AA 2JT5A 1QJJA 1L6JA 1OM8A 5D7WA 2YB9A 2L0RA 4A3WA 1XUCA 3BA0A 1UTTA 2O3EA 2KRJA 456CA 1XFWA 1JAPA 1OS2A 2RJQA 1ND1A 3RTSA 1QJSA 4G0DA 3F18A 2WO8A 3HDAP 3B8ZA 3TSKA 1KAPP 1MNCA 3I7GA 4HMAA 4I35A 4IN9A 1D8FA 1J7NA 5B5PA 1ZTQA 3HDBA 1SMPA 1XURA 1BSWA 4H84A 3P24A 1OS9A 1JJ9A 2YUFA 1KUHA 4J4MA 4WZVA 1CK7A 1QJIA 2DW2A 2JT6A 1AKLA 2W13A 5H8XA 2USNA 1CGLA 1MMQA 1QIAA 2MZEA 1CXVA 3E8RA 2W12A 4GWNA 2OXZA 3C7XA 4H82A 2D1OA 1OMJA 1UEAA 3EDIA 1D8MA 1I76A 1ZS0A 2WO9A 3TT4A 2EROA 2E3XA 2X7MA 3WV2A 4WK7A 5CUHA 1WNIA 1BUDA 3DL1A 1CGEA 2OVXA 1I1IP 4JPAA 1HXNA 3LUNA 3ELMA 4PKWA 1SRPA 2D1NA 5CZMA 4XM6A 3EDHA 2AYKA 1KBCA 1JAOA 2FV5A 3TVCA 1ZXCA 3RTTA 2X3AA 3F17A 1HTDA 4AIGA 1QUAA 2JIHA 4PKRA 1PEXA 4JIJA 1SLNA 3HB2P 1IADA 1OM6A 2OXWA 2OVZA 4G9LA 4FXYP 3EHYA 3U1RA 2N8RA 5JMYA 4LL2A 3O64A 3KWVC 1IACA 1A86A 1OO9A 3DPEA 1D5JA 5D3CA 2MLRA 1Y0VA 3P1VA 5L7FA 3SHIA 1PWPA 1IAGA 3AIGA 1G05A 1ZVXA 4DV8A 2CKIA 1SU3A 1C8TA 5LABA 3DTIA 1KUGA 1GENA 4GR3A 2E2DA 5B5OA 2DDFA 1K7QA 1GKDA 4L63A 2XS4A 1XFXA 1JIZA 2YIGA 2TCLA 3WV3A 2Y6CA 1SLMA 1FBLA 1JAQA 1DMTA 2MZHA 2OZRA 4WF6A 4IUWA 2JXYA 4DPEA 4QKZA 3LJTA 830CA 1K7GA 1ITVA 4L7AA 3HYGA 2OW1A 2X3CA 3L0TA 5I43A 4ON1A 2K9CA 4PKUA 4DF9A 3VTGA 3KMCA 3K7NA 3AYUA 3G5CA 4JP4A 1K7IA 1GXDA 1XFUA 3CKIA 2OI0A 3KECA 1BM6A 1R1IA 1BQOA 1ROSA 3EDGA 1QHUA 1HV5A 4H2EA 1UMSA 3NX7A 3OHOA 1UTZA 2OXUA 3LJGA 4HX3A 3EHXA 3DSLA 1DTHA 1XFZA 2JSDA 4L6TA 2J0TA 5I0LA 4FVLA 1HOVA 3KMEA 1CAQA 4A7BA 1XUDA 1MMBA 1Y8JA 3LP9A 1BZSA 1AYKA 2SRTA 2A8HA 1BKCI 2DW0A 3S18A 1BKCA 1YP1A 1KUIA 5I2ZA 1QIBA 1IABA 3B92A 1CQRA 3LEAA 2MLSA 3F19A 1B8YA 1ZP5A 3KHIA 4CTHA 4DD8A 5L79A 3G42A 3KEJA 3LQBA 3K7LA 3HBVP 2DW1A 2W0DA 1PWVA 1HFCA 1GO8P 1GE7A 1ZXVA 2OW0A 1KUKA 3LMCA 1RTGA 5BOTA 2X3BA 4PKSA 4PKTA 5D1UA 4ZR5A 3USNA 1G49A 1GE5A 2W14A 1SATA 5BPAA 1FM1A 3V6NA 4I03A 4H76A 4AXQA 4H49A 4WKIA 4GR8A 1YCMA 4Q1LA 1HY7A 4GWMA 3UVCA 3DWBA 2J83A 2OY2A 3HY9A 2OY4A 4IJOA 3V96B 2OW9A 2QPJA 1RM8A 3LQ0A 3LGPA 2HU6A 3F16A 4GQLA 3LIKA 5CXAA 2PJTA 4L19A 1EAKA 3O2XA 2ERQA 2Y6DA 1C7KA 2MZIA 3DPFA 2O36A 1GKCA 1FLSA 1QICA 1O0TA 1RMZA 3TS4A 1G12A 1R1HA 4GR0A 1B3DA 1MMPA 1Q3AA 1ASTA 2OW2A 1XFVA 4XM8A 2ERPA 3AYKA 3LILA 4JA1A 5BOYA 1AF0A 4YEHA 1A85A 1CGFA 1BUVM 1JH1A 4RT6B 3LKAA 5D1TA 1HFSA 3ZUKA 2RJPA 2MQSA 4EFSA 1JANA 1YOUA 1BKCE 1GO7P 1R55A 1O0QA 1KUFA 2W15A 3EWJA 1C3IA 3Q2GA 4AYKA 1BIWA 1IAAA 3KRYA 4AUOA 3HBUP 3HY7A 5I3MA 1USNA 966CA 2V4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FXQ A;  1IAE A;  1GE6 A;  2JNP A;  1Y93 A;  2AIG P;  4PKV A;  4H3X A;  1EB6 A;  2XS3 A;  2I47 A;  4OEI A;  3OYO A;  1S4B P;  5D1S A;  1Z3J A;  4FU4 A;  3N2V A;  4XBH A;  1ATL A;  1H71 P;  3MA2 A;  4H1Q A;  1PWQ A;  1OM7 A;  3LE9 A;  4XCT A;  5I4O A;  3WV1 A;  1PWU A;  4R3V A;  1CIZ A;  3B2Z A;  3ZVS A;  2Z2D A;  1R1J A;  2K2G A;  2CLT A;  1JK3 A;  3EDZ A;  1MMR A;  3F15 A;  3Q2H A;  3KEK A;  4XM7 A;  4H30 A;  4PKQ A;  2POJ A;  2DDY A;  3LJZ A;  3DNG A;  4HSD A;  1EUB A;  2FV9 A;  4GF1 A;  3GBO A;  4GUY A;  3L0V A;  5D2B A;  3OHL A;  4WKE A;  3I7I A;  5I12 A;  3ZXH A;  3LK8 A;  1XFY A;  3VI1 A;  1G4K A;  1JIW P;  1I73 A;  3N2U A;  1G9K A;  1R54 A;  1JKY A;  1YQY A;  1PWW A;  4ILW D;  1BQQ M;  1UMT A;  2WOA A;  3LIR A;  1D7X A;  4JQG A;  3LUM A;  3F1A A;  2JT5 A;  1QJJ A;  1L6J A;  1OM8 A;  5D7W A;  2YB9 A;  2L0R A;  4A3W A;  1XUC A;  3BA0 A;  1UTT A;  2O3E A;  2KRJ A;  456C A;  1XFW A;  1JAP A;  1OS2 A;  2RJQ A;  1ND1 A;  3RTS A;  1QJS A;  4G0D A;  3F18 A;  2WO8 A;  3HDA P;  3B8Z A;  3TSK A;  1KAP P;  1MNC A;  3I7G A;  4HMA A;  4I35 A;  4IN9 A;  1D8F A;  1J7N A;  5B5P A;  1ZTQ A;  3HDB A;  1SMP A;  1XUR A;  1BSW A;  4H84 A;  3P24 A;  1OS9 A;  1JJ9 A;  1KUH A;  4J4M A;  4WZV A;  1CK7 A;  1QJI A;  2DW2 A;  2JT6 A;  1AKL A;  2W13 A;  5H8X A;  2USN A;  1CGL A;  1MMQ A;  1QIA A;  2MZE A;  1CXV A;  3E8R A;  2W12 A;  4GWN A;  2OXZ A;  3C7X A;  4H82 A;  2D1O A;  1OMJ A;  1UEA A;  3EDI A;  1D8M A;  1I76 A;  1ZS0 A;  2WO9 A;  3TT4 A;  2ERO A;  2E3X A;  2X7M A;  3WV2 A;  4WK7 A;  5CUH A;  1WNI A;  1BUD A;  3DL1 A;  1CGE A;  2OVX A;  1I1I P;  4JPA A;  1HXN A;  3LUN A;  3ELM A;  4PKW A;  1SRP A;  2D1N A;  5CZM A;  4XM6 A;  3EDH A;  2AYK A;  1KBC A;  1JAO A;  2FV5 A;  3TVC A;  1ZXC A;  3RTT A;  2X3A A;  3F17 A;  1HTD A;  4AIG A;  1QUA A;  2JIH A;  4PKR A;  1PEX A;  4JIJ A;  1SLN A;  3HB2 P;  1IAD A;  1OM6 A;  2OXW A;  2OVZ A;  4G9L A;  4FXY P;  3EHY A;  3U1R A;  2N8R A;  5JMY A;  4LL2 A;  3O64 A;  3KWV C;  1IAC A;  1A86 A;  1OO9 A;  3DPE A;  1D5J A;  5D3C A;  2MLR A;  1Y0V A;  3P1V A;  5L7F A;  3SHI A;  1PWP A;  1IAG A;  3AIG A;  1G05 A;  1ZVX A;  4DV8 A;  2CKI A;  1SU3 A;  1C8T A;  5LAB A;  1KUG A;  1GEN A;  4GR3 A;  2E2D A;  5B5O A;  2DDF A;  1K7Q A;  1GKD A;  4L63 A;  2XS4 A;  1XFX A;  1JIZ A;  2YIG A;  2TCL A;  3WV3 A;  2Y6C A;  1SLM A;  1FBL A;  1JAQ A;  1DMT A;  2MZH A;  2OZR A;  4WF6 A;  4IUW A;  2JXY A;  4DPE A;  4QKZ A;  3LJT A;  830C A;  1K7G A;  1ITV A;  3HYG A;  2OW1 A;  2X3C A;  3L0T A;  5I43 A;  4ON1 A;  2K9C A;  4PKU A;  4DF9 A;  3VTG A;  3KMC A;  3K7N A;  3AYU A;  3G5C A;  4JP4 A;  1K7I A;  1GXD A;  1XFU A;  3CKI A;  2OI0 A;  3KEC A;  1BM6 A;  1R1I A;  1BQO A;  1ROS A;  3EDG A;  1QHU A;  1HV5 A;  4H2E A;  1UMS A;  3NX7 A;  3OHO A;  1UTZ A;  2OXU A;  3LJG A;  4HX3 A;  3EHX A;  3DSL A;  1DTH A;  1XFZ A;  2JSD A;  4L6T A;  2J0T A;  5I0L A;  4FVL A;  1HOV A;  3KME A;  1CAQ A;  4A7B A;  1XUD A;  1MMB A;  1Y8J A;  3LP9 A;  1BZS A;  1AYK A;  2SRT A;  2A8H A;  1BKC I;  2DW0 A;  3S18 A;  1BKC A;  1YP1 A;  1KUI A;  5I2Z A;  1QIB A;  1IAB A;  3B92 A;  1CQR A;  3LEA A;  2MLS A;  3F19 A;  1B8Y A;  1ZP5 A;  3KHI A;  4CTH A;  4DD8 A;  5L79 A;  3G42 A;  3KEJ A;  3LQB A;  3K7L A;  3HBV P;  2DW1 A;  2W0D A;  1PWV A;  1HFC A;  1GO8 P;  1GE7 A;  1ZXV A;  2OW0 A;  1KUK A;  3LMC A;  1RTG A;  5BOT A;  2X3B A;  4PKS A;  4PKT A;  5D1U A;  4ZR5 A;  3USN A;  1G49 A;  1GE5 A;  2W14 A;  1SAT A;  5BPA A;  1FM1 A;  3V6N A;  4I03 A;  4H76 A;  4AXQ A;  4H49 A;  4WKI A;  4GR8 A;  1YCM A;  4Q1L A;  1HY7 A;  4GWM A;  3UVC A;  3DWB A;  2J83 A;  2OY2 A;  3HY9 A;  2OY4 A;  4IJO A;  3V96 B;  2OW9 A;  2QPJ A;  1RM8 A;  3LQ0 A;  3LGP A;  2HU6 A;  3F16 A;  4GQL A;  3LIK A;  5CXA A;  2PJT A;  4L19 A;  1EAK A;  3O2X A;  2ERQ A;  2Y6D A;  1C7K A;  2MZI A;  3DPF A;  2O36 A;  1GKC A;  1FLS A;  1QIC A;  1O0T A;  1RMZ A;  3TS4 A;  1G12 A;  1R1H A;  4GR0 A;  1B3D A;  1MMP A;  1Q3A A;  1AST A;  2OW2 A;  1XFV A;  4XM8 A;  2ERP A;  3AYK A;  3LIL A;  4JA1 A;  5BOY A;  1AF0 A;  4YEH A;  1A85 A;  1CGF A;  1BUV M;  1JH1 A;  4RT6 B;  3LKA A;  5D1T A;  1HFS A;  3ZUK A;  2RJP A;  2MQS A;  4EFS A;  1JAN A;  1YOU A;  1BKC E;  1GO7 P;  1R55 A;  1O0Q A;  1KUF A;  2W15 A;  3EWJ A;  1C3I A;  3Q2G A;  4AYK A;  1BIW A;  1IAA A;  3KRY A;  4AUO A;  3HBU P;  3HY7 A;  5I3M A;  1USN A;  966C A;  2V4B A; 
#chains in the Genus database with same CATH topology
 4FXQ A;  1IAE A;  1GE6 A;  2JNP A;  1Y93 A;  2AIG P;  4PKV A;  4H3X A;  1EB6 A;  1OZ9 A;  2XS3 A;  2I47 A;  4OEI A;  3OYO A;  1S4B P;  5D1S A;  1Z3J A;  4FU4 A;  3N2V A;  4XBH A;  1ATL A;  1H71 P;  3MA2 A;  4H1Q A;  1PWQ A;  1OM7 A;  3LE9 A;  4XCT A;  5I4O A;  3WV1 A;  1PWU A;  4R3V A;  1CIZ A;  3B2Z A;  3ZVS A;  2Z2D A;  1R1J A;  2K2G A;  2CLT A;  1JK3 A;  3EDZ A;  1MMR A;  3F15 A;  3Q2H A;  3KEK A;  4XM7 A;  4H30 A;  4PKQ A;  2POJ A;  3DTK A;  2DDY A;  3LJZ A;  3DNG A;  4HSD A;  1EUB A;  2FV9 A;  4GF1 A;  3GBO A;  4GUY A;  3L0V A;  5D2B A;  3OHL A;  4WKE A;  3I7I A;  5I12 A;  3ZXH A;  3LK8 A;  1XFY A;  3VI1 A;  1G4K A;  1JIW P;  1I73 A;  3N2U A;  1G9K A;  1R54 A;  1JKY A;  1YQY A;  1PWW A;  4ILW D;  1BQQ M;  1UMT A;  2WOA A;  3DTE A;  3LIR A;  1D7X A;  4JQG A;  3LUM A;  3F1A A;  2JT5 A;  1QJJ A;  1L6J A;  1OM8 A;  5D7W A;  2YB9 A;  2L0R A;  4A3W A;  1XUC A;  3BA0 A;  1UTT A;  2O3E A;  2KRJ A;  456C A;  1XFW A;  1JAP A;  1OS2 A;  2RJQ A;  1ND1 A;  3RTS A;  1QJS A;  4G0D A;  3F18 A;  2WO8 A;  3HDA P;  3B8Z A;  3TSK A;  1KAP P;  1MNC A;  3I7G A;  4HMA A;  4I35 A;  4IN9 A;  1D8F A;  1J7N A;  5B5P A;  1ZTQ A;  3HDB A;  1SMP A;  1XUR A;  1BSW A;  4H84 A;  3P24 A;  1OS9 A;  1JJ9 A;  2YUF A;  1KUH A;  4J4M A;  4WZV A;  1CK7 A;  1QJI A;  2DW2 A;  2JT6 A;  1AKL A;  2W13 A;  5H8X A;  2USN A;  1CGL A;  1MMQ A;  1QIA A;  2MZE A;  1CXV A;  3E8R A;  2W12 A;  4GWN A;  2OXZ A;  3C7X A;  4H82 A;  2D1O A;  1OMJ A;  1UEA A;  3EDI A;  1D8M A;  1I76 A;  1ZS0 A;  2WO9 A;  3TT4 A;  2ERO A;  2E3X A;  2X7M A;  3WV2 A;  4WK7 A;  5CUH A;  1WNI A;  1BUD A;  3DL1 A;  1CGE A;  2OVX A;  1I1I P;  4JPA A;  1HXN A;  3LUN A;  3ELM A;  1XAX A;  4PKW A;  1SRP A;  2D1N A;  5CZM A;  4XM6 A;  3EDH A;  2AYK A;  1KBC A;  1JAO A;  2FV5 A;  3TVC A;  1ZXC A;  3RTT A;  2X3A A;  3F17 A;  1HTD A;  4AIG A;  1QUA A;  2JIH A;  4PKR A;  1PEX A;  4JIJ A;  1SLN A;  3HB2 P;  1IAD A;  1OM6 A;  2OXW A;  2OVZ A;  4G9L A;  4FXY P;  3EHY A;  3U1R A;  2N8R A;  5JMY A;  4LL2 A;  3O64 A;  3KWV C;  1IAC A;  1A86 A;  1OO9 A;  3DPE A;  1D5J A;  5D3C A;  2MLR A;  1Y0V A;  3P1V A;  5L7F A;  3SHI A;  1PWP A;  1IAG A;  3AIG A;  1G05 A;  1ZVX A;  4DV8 A;  2CKI A;  1SU3 A;  1C8T A;  5LAB A;  3DTI A;  1KUG A;  1GEN A;  4GR3 A;  2E2D A;  5B5O A;  2DDF A;  1K7Q A;  1GKD A;  4L63 A;  2XS4 A;  1XFX A;  1JIZ A;  2YIG A;  2TCL A;  3WV3 A;  2Y6C A;  1SLM A;  1FBL A;  1JAQ A;  1DMT A;  2MZH A;  2OZR A;  4WF6 A;  4IUW A;  2JXY A;  4DPE A;  4QKZ A;  3LJT A;  830C A;  1K7G A;  1ITV A;  4L7A A;  3HYG A;  2OW1 A;  2X3C A;  3L0T A;  5I43 A;  4ON1 A;  2K9C A;  4PKU A;  4DF9 A;  3VTG A;  3KMC A;  3K7N A;  3AYU A;  3G5C A;  4JP4 A;  1K7I A;  1GXD A;  1XFU A;  3CKI A;  2OI0 A;  3KEC A;  1BM6 A;  1R1I A;  1BQO A;  1ROS A;  3EDG A;  1QHU A;  1HV5 A;  4H2E A;  1UMS A;  3NX7 A;  3OHO A;  1UTZ A;  2OXU A;  3LJG A;  4HX3 A;  3EHX A;  3DSL A;  1DTH A;  1XFZ A;  2JSD A;  4L6T A;  2J0T A;  5I0L A;  4FVL A;  1HOV A;  3KME A;  1CAQ A;  4A7B A;  1XUD A;  1MMB A;  1Y8J A;  3LP9 A;  1BZS A;  1AYK A;  2SRT A;  2A8H A;  1BKC I;  2DW0 A;  3S18 A;  1BKC A;  1YP1 A;  1KUI A;  5I2Z A;  1QIB A;  1IAB A;  3B92 A;  1CQR A;  3LEA A;  2MLS A;  3F19 A;  1B8Y A;  1ZP5 A;  3KHI A;  4CTH A;  4DD8 A;  5L79 A;  3G42 A;  1XM5 A;  3KEJ A;  3LQB A;  3K7L A;  3HBV P;  2DW1 A;  2W0D A;  1PWV A;  1HFC A;  1GO8 P;  1GE7 A;  1ZXV A;  2OW0 A;  1KUK A;  3LMC A;  1RTG A;  5BOT A;  2X3B A;  4PKS A;  4PKT A;  5D1U A;  4ZR5 A;  3USN A;  1G49 A;  1GE5 A;  2W14 A;  1SAT A;  5BPA A;  1FM1 A;  3V6N A;  4I03 A;  4H76 A;  4AXQ A;  4H49 A;  4WKI A;  4GR8 A;  1YCM A;  4Q1L A;  1HY7 A;  4GWM A;  3UVC A;  1TVI A;  3DWB A;  2J83 A;  2OY2 A;  3HY9 A;  2OY4 A;  4IJO A;  3V96 B;  2OW9 A;  2QPJ A;  1RM8 A;  3LQ0 A;  3LGP A;  2HU6 A;  3F16 A;  4GQL A;  3LIK A;  5CXA A;  2PJT A;  4L19 A;  1EAK A;  3O2X A;  2ERQ A;  2Y6D A;  1C7K A;  2MZI A;  3DPF A;  2O36 A;  1GKC A;  1FLS A;  1QIC A;  1O0T A;  1RMZ A;  3TS4 A;  1G12 A;  1R1H A;  4GR0 A;  1B3D A;  1MMP A;  1Q3A A;  1AST A;  2OW2 A;  1XFV A;  4XM8 A;  2ERP A;  3AYK A;  3LIL A;  4JA1 A;  5BOY A;  1AF0 A;  4YEH A;  1A85 A;  1CGF A;  1BUV M;  1JH1 A;  4RT6 B;  3LKA A;  5D1T A;  1HFS A;  3ZUK A;  2RJP A;  2MQS A;  4EFS A;  1JAN A;  1YOU A;  1BKC E;  1GO7 P;  1R55 A;  1O0Q A;  1KUF A;  2W15 A;  3EWJ A;  1C3I A;  3Q2G A;  4AYK A;  1BIW A;  1IAA A;  3KRY A;  4AUO A;  3HBU P;  3HY7 A;  5I3M A;  1USN A;  966C A;  2V4B A; 
#chains in the Genus database with same CATH homology
 4FXQ A;  1IAE A;  1GE6 A;  2JNP A;  1Y93 A;  2AIG P;  4PKV A;  4H3X A;  1EB6 A;  2XS3 A;  2I47 A;  4OEI A;  3OYO A;  1S4B P;  5D1S A;  1Z3J A;  4FU4 A;  3N2V A;  4XBH A;  1ATL A;  1H71 P;  3MA2 A;  4H1Q A;  1PWQ A;  1OM7 A;  3LE9 A;  4XCT A;  5I4O A;  3WV1 A;  1PWU A;  4R3V A;  1CIZ A;  3B2Z A;  3ZVS A;  2Z2D A;  1R1J A;  2K2G A;  2CLT A;  1JK3 A;  3EDZ A;  1MMR A;  3F15 A;  3Q2H A;  3KEK A;  4XM7 A;  4H30 A;  4PKQ A;  2POJ A;  3DTK A;  2DDY A;  3LJZ A;  3DNG A;  4HSD A;  1EUB A;  2FV9 A;  4GF1 A;  3GBO A;  4GUY A;  3L0V A;  5D2B A;  3OHL A;  4WKE A;  3I7I A;  5I12 A;  3ZXH A;  3LK8 A;  1XFY A;  3VI1 A;  1G4K A;  1JIW P;  1I73 A;  3N2U A;  1G9K A;  1R54 A;  1JKY A;  1YQY A;  1PWW A;  4ILW D;  1BQQ M;  1UMT A;  2WOA A;  3DTE A;  3LIR A;  1D7X A;  4JQG A;  3LUM A;  3F1A A;  2JT5 A;  1QJJ A;  1L6J A;  1OM8 A;  5D7W A;  2YB9 A;  2L0R A;  4A3W A;  1XUC A;  3BA0 A;  1UTT A;  2O3E A;  2KRJ A;  456C A;  1XFW A;  1JAP A;  1OS2 A;  2RJQ A;  1ND1 A;  3RTS A;  1QJS A;  4G0D A;  3F18 A;  2WO8 A;  3HDA P;  3B8Z A;  3TSK A;  1KAP P;  1MNC A;  3I7G A;  4HMA A;  4I35 A;  4IN9 A;  1D8F A;  1J7N A;  5B5P A;  1ZTQ A;  3HDB A;  1SMP A;  1XUR A;  1BSW A;  4H84 A;  3P24 A;  1OS9 A;  1JJ9 A;  2YUF A;  1KUH A;  4J4M A;  4WZV A;  1CK7 A;  1QJI A;  2DW2 A;  2JT6 A;  1AKL A;  2W13 A;  5H8X A;  2USN A;  1CGL A;  1MMQ A;  1QIA A;  2MZE A;  1CXV A;  3E8R A;  2W12 A;  4GWN A;  2OXZ A;  3C7X A;  4H82 A;  2D1O A;  1OMJ A;  1UEA A;  3EDI A;  1D8M A;  1I76 A;  1ZS0 A;  2WO9 A;  3TT4 A;  2ERO A;  2E3X A;  2X7M A;  3WV2 A;  4WK7 A;  5CUH A;  1WNI A;  1BUD A;  3DL1 A;  1CGE A;  2OVX A;  1I1I P;  4JPA A;  1HXN A;  3LUN A;  3ELM A;  4PKW A;  1SRP A;  2D1N A;  5CZM A;  4XM6 A;  3EDH A;  2AYK A;  1KBC A;  1JAO A;  2FV5 A;  3TVC A;  1ZXC A;  3RTT A;  2X3A A;  3F17 A;  1HTD A;  4AIG A;  1QUA A;  2JIH A;  4PKR A;  1PEX A;  4JIJ A;  1SLN A;  3HB2 P;  1IAD A;  1OM6 A;  2OXW A;  2OVZ A;  4G9L A;  4FXY P;  3EHY A;  3U1R A;  2N8R A;  5JMY A;  4LL2 A;  3O64 A;  3KWV C;  1IAC A;  1A86 A;  1OO9 A;  3DPE A;  1D5J A;  5D3C A;  2MLR A;  1Y0V A;  3P1V A;  5L7F A;  3SHI A;  1PWP A;  1IAG A;  3AIG A;  1G05 A;  1ZVX A;  4DV8 A;  2CKI A;  1SU3 A;  1C8T A;  5LAB A;  3DTI A;  1KUG A;  1GEN A;  4GR3 A;  2E2D A;  5B5O A;  2DDF A;  1K7Q A;  1GKD A;  4L63 A;  2XS4 A;  1XFX A;  1JIZ A;  2YIG A;  2TCL A;  3WV3 A;  2Y6C A;  1SLM A;  1FBL A;  1JAQ A;  1DMT A;  2MZH A;  2OZR A;  4WF6 A;  4IUW A;  2JXY A;  4DPE A;  4QKZ A;  3LJT A;  830C A;  1K7G A;  1ITV A;  4L7A A;  3HYG A;  2OW1 A;  2X3C A;  3L0T A;  5I43 A;  4ON1 A;  2K9C A;  4PKU A;  4DF9 A;  3VTG A;  3KMC A;  3K7N A;  3AYU A;  3G5C A;  4JP4 A;  1K7I A;  1GXD A;  1XFU A;  3CKI A;  2OI0 A;  3KEC A;  1BM6 A;  1R1I A;  1BQO A;  1ROS A;  3EDG A;  1QHU A;  1HV5 A;  4H2E A;  1UMS A;  3NX7 A;  3OHO A;  1UTZ A;  2OXU A;  3LJG A;  4HX3 A;  3EHX A;  3DSL A;  1DTH A;  1XFZ A;  2JSD A;  4L6T A;  2J0T A;  5I0L A;  4FVL A;  1HOV A;  3KME A;  1CAQ A;  4A7B A;  1XUD A;  1MMB A;  1Y8J A;  3LP9 A;  1BZS A;  1AYK A;  2SRT A;  2A8H A;  1BKC I;  2DW0 A;  3S18 A;  1BKC A;  1YP1 A;  1KUI A;  5I2Z A;  1QIB A;  1IAB A;  3B92 A;  1CQR A;  3LEA A;  2MLS A;  3F19 A;  1B8Y A;  1ZP5 A;  3KHI A;  4CTH A;  4DD8 A;  5L79 A;  3G42 A;  3KEJ A;  3LQB A;  3K7L A;  3HBV P;  2DW1 A;  2W0D A;  1PWV A;  1HFC A;  1GO8 P;  1GE7 A;  1ZXV A;  2OW0 A;  1KUK A;  3LMC A;  1RTG A;  5BOT A;  2X3B A;  4PKS A;  4PKT A;  5D1U A;  4ZR5 A;  3USN A;  1G49 A;  1GE5 A;  2W14 A;  1SAT A;  5BPA A;  1FM1 A;  3V6N A;  4I03 A;  4H76 A;  4AXQ A;  4H49 A;  4WKI A;  4GR8 A;  1YCM A;  4Q1L A;  1HY7 A;  4GWM A;  3UVC A;  3DWB A;  2J83 A;  2OY2 A;  3HY9 A;  2OY4 A;  4IJO A;  3V96 B;  2OW9 A;  2QPJ A;  1RM8 A;  3LQ0 A;  3LGP A;  2HU6 A;  3F16 A;  4GQL A;  3LIK A;  5CXA A;  2PJT A;  4L19 A;  1EAK A;  3O2X A;  2ERQ A;  2Y6D A;  1C7K A;  2MZI A;  3DPF A;  2O36 A;  1GKC A;  1FLS A;  1QIC A;  1O0T A;  1RMZ A;  3TS4 A;  1G12 A;  1R1H A;  4GR0 A;  1B3D A;  1MMP A;  1Q3A A;  1AST A;  2OW2 A;  1XFV A;  4XM8 A;  2ERP A;  3AYK A;  3LIL A;  4JA1 A;  5BOY A;  1AF0 A;  4YEH A;  1A85 A;  1CGF A;  1BUV M;  1JH1 A;  4RT6 B;  3LKA A;  5D1T A;  1HFS A;  3ZUK A;  2RJP A;  2MQS A;  4EFS A;  1JAN A;  1YOU A;  1BKC E;  1GO7 P;  1R55 A;  1O0Q A;  1KUF A;  2W15 A;  3EWJ A;  1C3I A;  3Q2G A;  4AYK A;  1BIW A;  1IAA A;  3KRY A;  4AUO A;  3HBU P;  3HY7 A;  5I3M A;  1USN A;  966C A;  2V4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...