1SUJA

X-ray crystal structure of ambystoma tigrinum cone arrestin
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
370
structure length
363
Chain Sequence
SKVYKKTCPNAKLSIYLGKRDFVDHVEHVEPVDGVVLIDPEYLKDRKVFVTLTCAFRYGRDDLDLIGMSFRKDLYSLATQVYPPETKEPLTPLQEKLMKKLGAHAYPFCFKMGTNLPCSVTLQPGPDDTGKSCGVDFEVKAFCAENLEEKIHKRNSVQLVIRKVQFAPANLGVAPKTEITRQFMLSDRPLHLEASLDKEIYYHGEPINVNVKINNTTGKIVKKIKIIVEQVTDVVLFSLDKYVKTVCAEETNDTVAANSTLSKTFSVTPMLANNREKRGLALDGKLKHEDTNLASTTVIRPGMDKEVLGILVSYKVKVHLVVARGGILGDLTSSDVAVELPLTLMHPKPSDDIIIEEFARQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cone arrestin
publication title Crystal structure of cone arrestin at 2.3A: evolution of receptor specificity.
pubmed doi rcsb
source organism Ambystoma tigrinum
molecule tags Signaling protein
total genus 71
structure length 363
sequence length 370
ec nomenclature
pdb deposition date 2004-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
A PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1sujA02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1sujA01
1G4RA 4JQIA 1G4MA 2R51A 3LHAA 4P2AA 1JSYA 4R7XA 2WTRA 4GFXA 1CF1A 3P2DA 4GEIA 3LH8A 1ZSHA 3UGUA 3UGXA 5F0JB 1AYRA 2WTRB 1SUJA 3GC3A 4ZRGA 5F0MB 4GEJA 2FAUA 3LH9A 4R7VA 5F0LB 5F0PB 4LL1A 4LL4A 3GD1C 4J2QA
chains in the Genus database with same CATH superfamily
3EJZD 1BZEA 2XPGA 4HS3B 2WXQA 4XBPA 1GVIA 2IQ9H 2BZDA 3KYAA 1IAKB 5EUOE 1MH5A 3UAJA 5FO8A 4NO2A 1KTKE 1C7TA 2FCBA 4I9WE 1MFNA 1BG9A 1MLCA 1PCSA 1BHGA 1IIKA 3AT0A 4F58L 3MBWA 1UOWA 3L9YA 1XD1A 3LKOA 4UB0H 1Z3GL 2IPKA 4WUUA 1XTMA 3I6SA 4TL4A 3S7GA 5IKCA 3FCUB 4WJKB 3ZIMA 3B2XA 2G2NA 1RIUL 1IBDA 1XCXA 3IGAB 3B9DA 1O6VA 1DEDA 5SWSA 1Y0LB 3DJSA 3D18B 2J6EH 4CVZA 3WE1A 5A16B 4W70A 2YD4A 2JKTM 3EJJX 3Q2WA 5AYQA 4CJ0A 3C5XA 2V3FA 4LBEA 3ARDD 2BNQA 3EG9A 5LAPA 2DMKA 4ZS7H 1NFDE 4K3HA 5DO2D 5DRZA 1HKLH 1IBYA 3L2NA 1OARL 2DBJA 4KK5C 3I6KB 4YL9A 4LK4A 3UZQB 1FZOB 2NX5B 1N0XL 2X4RA 1YY9D 2B2XH 4Q4EA 3ULUD 4GPVA 2RHEA 5EZJB 4NZUL 4Z18A 3QJUB 5D1ZA 5TFSL 3E1ZA 3WE6A 1YN6B 4LZKA 4OF0A 4YR6B 2FNWA 1ZK5A 1ZRUA 2HCZX 1LO5B 5MERA 5HYSA 1T22A 3H7BB 1JZ5A 4W93A 2HN7A 5L7XL 4E0RB 3SDDD 5HHPA 1ZSHA 2V3EA 4BKLA 2QKIB 3GMOA 2CDEA 3OKNB 4PJHE 4PJ5E 1CK0L 3WLBA 3ZY7A 3NK4A 2C9SA 3GO1L 3AITA 3BP5B 4LFHG 3CQPA 5B1AB 2JJWA 5HDBB 4KVNL 4LSQL 1AKJB 3C5ZA 3JWNG 3AGVA 2Z1PA 1OAJA 2IANB 1I7RB 3P30H 1MI5E 1NPNA 3KPTA 5DCCA 4XTRD 1IGYB 1CICB 3DMMD 4YDVA 4DZBA 4ALAC 3AMLA 5A2KH 1RV6X 3IPBA 3C9NB 4U1MB 3IPFA 5AAMC 1I9IH 5KAQF 4YQXH 5FECA 5F1IA 4PJGB 3MA7B 3T3ME 2BY1A 1GKOA 4AQAB 2C26A 3F7KA 2EO7A 2ZUXA 3MCLH 4G8IB 1BFVH 4MAUH 3CFKB 4N28A 4L5FE 4XXWA 3UJIL 1WT5A 2DIEA 1Y07A 3CFDB 2LFEA 3WIAA 1PJWA 1P53A 3WN6A 3MRQA 1AYOA 4MNGE 3MLVL 4NQSA 2CK0L 2NY0C 3K1DA 1WZ1H 3TBBA 2V5TA 4M6AA 1DJXA 4B7LA 1NICA 5J1AB 4UZSA 3ZE1E 3FYEB 2HJKB 4NNPL 4UDTB 4AX3A 4OLWL 3LEVH 4HXBL 5IQMA 4H2AA 2B0SH 2ADFL 3EOAB 3TZVC 4M4PA 1AQMA 1FORH 1NCAH 1ONQA 5F70A 1JZ7A 3GSWA 1HXMA 2EZ0C 4L4TD 4GSRA 4PLOB 4PWHA 3UTSB 1AH1A 1ORQB 1MCOL 4PJ6A 2PO6D 2CGZA 1Z2KA 5EU6B 4OZIE 4APQC 1AXTL 1KWKA 2NY2B 3C8KA 4JFFE 4JZJB 1WZKA 2QADC 4XNZB 4FCAA 4XCYA 1BJ1H 4WJG3 4OUUB 1QSEB 2FD6L 3H3PL 1FNEB 5GRVL 3CDGB 1AC0A 1KGIA 2YARA 4Z7WA 1NEZA 2E6PA 4X4ME 1A4JA 5F96H 4LEBA 4BH7A 4I3SL 4M8UA 2VDKL 2Y06H 1U58B 4Y2OA 3VNYA 3DOIA 4KI5F 2K9FB 3KLAB 5KJRL 2HVBA 5EBLB 1E28B 4N2GA 2HT2D 4JM2C 1P4BH 3O0RH 1B3IA 3KBFA 1Z9MA 2OCFD 3B2VH 1XGUA 2EXWD 4U1JB 1THAA 4HWZB 4V33A 3EBAA 4CC1A 5EEXA 4L3FA 5DK3A 3WU1A 1HDMA 4HUWA 3FT0A 3ARDA 1E9PA 4MJIB 2VN6A 2LLGA 2XC8A 1HQ4B 4R2GC 3DXAB 3L48A 3KPSE 5E6YA 2W9DL 3TFKD 1KJVA 2NDGA 2L4OA 2F19L 3IBEA 5MENE 1BWMA 5AVZB 3VTMA 5FM5M 1SPDA 3SDAC 4IJ3C 4Z6AT 4NC1E 1RZJL 4OF8A 2H0FA 3L7EA 1XBDA 2XETA 5JPNB 5DQDL 5HI3C 5L6YL 4GXVH 5CP3A 1BW8A 4TUJA 1ZJBA 4PJ5D 2NXZC 3CZFB 3J8F7 1CGSH 3K7UA 3UCRA 4HCRH 5MEPA 1JI1A 2YAEA 5H94B 2PXYC 5D8JL 3H54A 3CN3A 5I1EL 1VSCA 3K72A 3SDDA 5DC4B 2CNYA 3CE1A 4LVOB 4XMXA 5DRXA 5FIEA 1CG9A 2K9UA 5L0QB 1UM5H 4DFHA 1LE9A 2BIOA 3LPFA 4A67A 4JN1H 4H5SB 1WUNT 2ENPA 2OXGA 4PJXA 2BS8A 2DWYA 4N2CA 5TD4A 3SOBL 5C6PB 1QVOB 1SVBA 2WLMA 4BFIB 1HHKB 3KBPA 3A5VA 4YHPA 3W37A 3QFGA 3IJHB 4TOYH 4WY7H 3DMMA 3IXAA 5E2TH 2YC1A 4OLXH 5J6HB 2EDBA 4OB5H 3LZLA 3OHMB 4ETQA 1YVLA 4UM8A 4NUPA 2K3HA 1E50A 3CK0L 1RK1B 5AEAA 3V9CA 3BWUF 4KQ3H 4BSVB 3HN8A 2J72A 1GZPB 1NDMA 3P0VL 3PWLA 3QA3B 1BQ5A 4G6MH 4WV1C 3IMRA 4F80A 2XQYK 5FYLH 3QYCA 2HRPH 4OZGE 3HS0A 1BZ7A 4FQ2H 3SJVB 4DAGH 1S78C 2F54E 4N8CH 4WW1B 2Y3NA 1IAIM 3GMPB 3UDWA 2XG4B 3L9BA 4K94C 4QHUB 1BFOB 4ERSH 1IIIA 4GIOA 1QR1B 3FB6B 3O8XB 5T33H 1F41A 3WEOA 4F1ZA 1RZKL 4GS7C 4TSBH 3V4PB 4FFYL 5HYQB 5K9KB 2Y36H 4MZ2A 2X4OB 2O5ZH 2EIDA 3SBRA 5EBWA 1NFIB 3CIAA 1O9VA 1NMCB 2IH3A 1WUZA 3D87B 4OLEA 2H26B 2HKFL 4L4TA 1DVTA 2KC0A 1KLFA 2PO6A 4JO1H 4TUUA 1KN2H 4OIIH 4J3OD 3FC8A 5IIEA 4JDEA 1MQKH 3BZDA 5EV7A 5ICYB 5JOEA 4AE1A 1NGYA 3V6FB 1TVHB 4PRAA 4HFWB 2RGSA 3QCVL 2BHFA 2RR3A 4XPTH 4XPGL 4PGDB 4ZG1A 4IBYA 4N90D 4NN5B 5DEGB 1Z7JA 5EA0L 1T5XB 2LTQC 3M8OH 1HNGA 2WXHA 3OZLA 3TESA 2HH0L 2VZ3A 4LLAA 3IFLH 4JFEE 2BVQB 4WFGD 4CC0A 1A21A 2XPYA 3QDMD 4O5LL 1SXNA 4ZOAA 2NTFB 1CBVL 3QHFH 4M02A 2R83A 4JG1L 1RJLA 5FYJL 3LRSA 1A1MA 1IM9D 1WBXA 1L6ZA 1OAKL 3I9GL 1KNOA 3UG3A 43CAA 3F7VB 5ES4B 3EDEA 1Q9KA 3OHXC 4QRRE 5B8CA 1UYWL 3F84A 2G9HA 4ANUA 3EHBD 1BQRA 5DFTA 3QRBA 4F92B 1NWOA 2YD1A 3R4RA 5T5NF 1P2CB 4NRYB 2ADYA 4ZMWA 4J6RL 1LEKA 2BMKB 4LEOA 1D5MB 4Y9FA 2PYFA 2K4AA 3DV4A 4LQFL 5D2LE 5DI8A 1UWFA 5CGYC 5HJGA 3VRIB 1MVUB 3MROA 4QGTA 1I8IA 2DQTH 3QUXD 4W9IC 4GFXA 2NYZA 5DR5H 1GCFA 3RAJH 2AJSL 5DJ2B 1BWWA 1CI5A 3VGDA 1QR4A 5KSVB 4AQZA 2VTFA 4N2LA 2Y6SC 2FZ3B 2H0JA 4PJHA 3ALPA 4PJ5A 1BM3L 2YPVA 4N2OA 5CSBA 5EZLB 5I30L 1I1FA 4UINL 1PZ2A 2ZOLB 4K3EH 2VJ0A 4BQCA 3BMVA 4DKTA 1PS3A 2HMIC 3AACA 3Q9QA 1EUUA 2E8ZA 3HC3L 4J8RA 4KTEL 3LQZB 1MZZA 3CVBA 3LZRA 3U2JA 2L3BA 5KVDE 2EVFA 3A6CH 3OKOB 5I82A 2QKIC 4P49A 3RURA 4Q74A 5HYJD 3JZ7A 4H25B 3RFZA 4ZAKC 2VR4A 3BQVA 1PX4A 4Z76A 4RMBA 4U1HB 1E5BA 4FKEA 4L29B 4QRUA 5CCKH 4R6UA 4FFVC 4FD0A 2FJFA 4OZFB 5E2UH 4KV5E 4Q6IB 4XVSH 1FZKB 2R1XB 1CICC 5F89B 2ZX7A 1U92A 1YPZE 4Z0XB 4HK0B 1CZ8L 1A22B 2X53A 1V3MA 5KG9A 2YHGA 4IM8A 5F7UA 5IF0B 5AW3B 5C0RL 5ESVA 1ZV9A 1MJ7H 5EO0B 5FA4A 3WN5B 1QYGL 1XH1A 4O4YL 1EHKB 5J6SA 4AYFA 4Y5VB 2OX5A 3MJGX 1YNTB 1OAYL 4G8EB 1LE5B 2AXWA 4P2QD 5F0MB 4WDIB 2CD0A 4HDIB 4NRZB 3D07A 3MRFA 4Z7IA 2ZICA 2YMXL 3CFEB 2C7UB 1EHNA 5GIRB 3MUJA 3RIFK 3JZYA 2NR6D 3ML8A 3QQ3B 2BH0A 3FB8B 2B77A 5HGBA 4P3CL 3GEFA 2VR5A 3TCXA 4DTGL 3MLYL 3H9SE 4X6DF 1SLXA 3V8OA 1RJZB 5GGVH 1RZFH 1TLMA 2AQQA 3G5XA 1IAIL 3ATAA 4LU5L 4LVNB 1OKEA 4PCTA 4TQHA 1DLFH 2CO3A 5IHUL 1U3YA 3D2UB 3GPEA 5JXEC 3EYSL 1EXUB 3PWPD 1PMYA 3TO2B 5JORA 1CVSC 2OR8A 1JNLL 4MA3B 5F8RC 2K6YA 4QDGA 2NY2C 3RY5A 2I26N 2FQFA 1EPFA 4JZJC 1ZWIA 2BOBA 4XNZC 5F7YC 3QO1A 3HE6D 3KLQA 2DLGA 1RJCA 1KELH 3QDMA 4N0FB 4P9HH 5FYKH 4GBXB 5E9DE 2D0GA 1AQ8A 4GMTL 4DN4L 4DOHB 2O30A 1QZ1A 4HK3J 5ADOL 4ODSL 2NY5C 1HHJB 4PR5A 1YJDL 1IM9A 5I0VA 2BVOB 3QFDB 2WC7A 3PDOA 3HZYB 4RLDA 4QXUL 2CJUH 4KKLC 5JW4M 5DUML 1RFDH 3BH8A 3FK3A 4JFVA 4YSEA 1AP2A 3CH8A 3MBXL 3BKYL 5T1KB 1PVHA 3MCKA 4ODTH 2WSDA 4DGWC 2QPUA 2BVPA 1V10A 4WEBH 2G0LA 5DSCA 4WF7A 2OMWB 4ZUUA 5HHOE 4E5XA 2E46A 2VJXA 3EJPA 3QUXA 2B1AL 2FT8A 2V8MA 3LVEA 5L4JA 4IBUA 2WWMD 1IFHH 3EO0B 3H6AA 3B2UC 4YDZA 4W9KC 3FFDB 4WHYG 4ZUTB 3FT2A 2LU4A 1B4JH 4OZFG 1PLAA 1MY7A 1XGZA 2FSEA 2VL5B 1LK2A 3WTSA 3A22A 5EF2A 1MREL 5IJKA 2AK1H 2G4GA 1UWXK 4P05A 1G7IA 3VD7A 1NGZA 2QQQA 2Z9TA 1E7VA 2X0WA 3SGEI 3S96A 1IQDA 4KJWC 3EYUH 3ZMNA 5LDSA 4LVOC 3CLFH 3BFWA 5HYJA 4LSSL 1LVEA 4L3ED 1QO3A 4DQOH 5L0QC 1FSKB 1E9QA 3WEAA 1LO3H 3CHQA 1G1OA 3MRBA 3PWNB 1J9TA 2X9WA 3ZRSA 5GRYA 1JGLH 3MREB 1BIHA 5GS0H 2OI9B 1I3VA 3HFMH 4JEGB 5AVQB 5DJ0B 5TTRA 3HAEA 4XCCL 1JG9A 3QORB 4HX1B 2UUDK 1NANI 4GT7A 3GMQB 4TTGA 5AKRA 3D3VB 4N87A 4X5WB 4BHUI 1FGVH 3BUQA 5F9DC 3JTBA 3UACA 3VQ2C 2B5IB 2PYED 3T65A 2R8SH 3FFCE 5D7JD 3FOLA 1YYMH 2R23A 1AE6L 5IM7A 4I3RH 1KGWA 2XWCA 3MTRA 1EEUA 3MOAL 2QVIA 4BSWA 3UZEC 4FFZH 3A4AA 5HJ3B 3I84A 2VLRE 2G5BB 4P2QA 3VGBA 1NLDL 2I7OA 4MD5B 1XF2B 4IRSD 3G04A 4W9GC 5EORL 3CSGA 3PJSB 1QFHA 3LRKA 3JSSA 2L04A 2IFFL 3T77B 4UILL 1CLZL 4G1MB 3X1EA 2EDYA 4G9DB 4AQ1A 3MRRB 4TPRH 2WGNB 4UNUA 1Q0XL 3GXDA 3O3DA 2NR6A 1DYZA 1KEML 2J73A 2F9BT 4EJ1C 1NMCC 2B8OT 4P5SA 4AC4A 3RNQB 1U8CA 1I3RB 2WZ0A 1JZIA 5KS9B 1JF5A 3U48A 2DEWX 3QO0B 3V9FA 3UTZA 3HI1A 2P8LA 2O6DA 3PWPA 4I0PD 1J8HB 4Z3EA 3BRDA 2P5EB 3P9LA 5E5RB 3ZQ9A 4B9IA 3ILQD 3ZKXC 4TTDC 3EGXB 3GSOA 1SVZA 3W9EB 4HGWB 1E40A 1XIWB 2VW4A 3HE6A 3TA3B 3LRHA 2JI2A 5BQ7B 1O5DT 1N70A 2YMTA 5ANMA 3BUDA 3VM7A 1NGQL 4WO0A 3QG6A 4I3GA 2A83A 3ECWA 1FNHA 4LE8A 4P4KB 2J8UA 5DEJA 5KVFH 2MTAA 1TVDA 3GRWH 3FO2B 5DJYB 3FUFA 5C97A 3S37H 3SY6A 1U8LB 2EO9A 5BQDA 5F1SA 4HJ0D 4JRXB 1JD7A 4RGMB 4Y89A 2DQGL 3FQ2A 2F2HA 5JHLL 5I18H 2WUCL 1JZFA 2R1YA 5D2LA 3WY4A 4RWYL 2QHRH 4UV4L 5C0DB 2VIRB 1YAIA 4GP8B 4I5BA 1MCKA 2DQUL 3OMNB 1MIEH 1QPKA 1QATA 3ULUF 4WEUD 5DJDB 1FYTE 4LO9A 4O2EB 1L5GB 4BFKA 2EKSA 2XYBA 5E23A 4N3UA 1TZAA 4N68A 4NX0A 1WITA 4YBLB 3REVB 4BHUA 2AXFB 1I9IL 4L5FL 4YQXL 7PCYA 3VI3E 3EYFB 1MELA 2A4ZA 1UENA 2GBAA 3TYGL 2XYCA 3OB0K 2CBMA 4XVJH 2NOYA 4GI6A 2GJ6E 2F74A 1DE4B 4ZMOA 3DX0A 5DA4A 4OD3L 1OTSD 1KB5L 3ARYA 2RALA 2QBWA 1QFWI 3H56A 3FDWA 3VCLB 2H6PB 4MWFA 2O5NA 2VZOA 4ZQKA 1BEYL 1KIUA 5DD0L 5KVGH 1I7ZA 3SY0A 1FGNH 3HCVB 3OWEA 4PJXF 4GRLC 1C9SA 1IVTA 5IV2B 4NPYA 2Y23A 2AMUA 1MIMH 4L3EA 2XNAA 3VD2A 4X0KA 4Y5YA 1RERA 2NCEA 3MRHA 5EU3A 1USZA 5CIPA 1INQA 1VESA 1K3IA 4OAWA 1SJHB 2WXIA 1I7UA 1XWVA 4N26A 3B43A 1SGKA 3IETB 3VMNA 1PBYA 4Y19E 4MB5A 1UKTA 1KCKA 4GQ9L 5DWUH 4DEWA 1W72B 1AANA 3AG2B 2HLAA 3RWEB 4B60A 1YQ2A 5GGTL 5KYUB 4KJPD 2PYEA 4Q6IC 3QZOA 4AMKL 1AR1B 5L2KB 4HV8B 2VDNL 2OMTA 4CBPA 3CU7A 3M46A 2N7AA 4V11A 4GAGH 5D7JA 5DJAB 1ZJAA 1T7WA 3BPLC 3BH9B 4AGQA 1OL0A 5DHVA 1MY5A 2SODB 2H8PA 3RWIA 3DGGA 4LHQB 3WN5C 5D7IB 2OMXB 2Y06L 1A6VH 3MODH 4HPOH 3Q6FA 4I18A 1TJIL 4AV4A 3TGXA 2O72A 5CZXD 1ED3A 5CUSL 2G3XA 1FFOB 1C12A 2OTWA 4LLWB 5H2BA 2A74C 4YEFA 4YNYB 3ZZLA 1JPFB 3FONA 5DD3L 3U0WL 4HJGB 1UB5B 2VERA 5DMJB 3DTUB 3SB3A 5T5FH 4HBCH 3NFNA 4I0PA 5IOKA 4DW2L 2AABL 2W65A 3QI9D 2ATKA 4QPEA 4NM4L 4AH2A 4S2SB 3VG0H 4HT1L 5TK2A 3W9DB 2V2WA 3E7JA 4PRIB 3RWGA 4ZMQA 2ZYRA 1ZA3B 4N4YB 3J07A 3UJJH 4EO5A 2JSFA 4WRLA 5JXAL 1W8EA 2ZIDA 1UD8A 5DZLA 4PWJA 5FW8A 3SO3B 4KY2A 4H1LH 3L4WA 1VKXA 3VVWA 3PV6A 2VE6A 4CN6A 2AAAA 3O6FB 4J8QA 5E5MB 4CKVX 1OB1A 4R7VA 1QSFB 1VFOA 1RZJC 1QHQA 2HUHA 4GW1B 3VFTA 1UM6L 4Z7VA 1XGRB 4EBQL 3ECBB 2EE3A 4PBDA 2VDPH 1WA2X 3FQ1A 5JPMB 4Y0GA 5BS0D 5BPPA 2GEQA 2ETWA 4JN1L 1MPAH 1PTZA 2FWLB 1K72A 4PTUB 4XNDA 1G1YA 3L16A 1GS8A 3OQ3B 4F93B 4X5PA 2APBA 4PY7A 1UEMA 2QT6A 3OGCB 4GKZB 2NPLX 2FL5A 4L05A 4WY7L 5I0YA 3K71B 3S3BB 4QOKB 3VA6A 3O3BB 2M83A 1KLGA 1C8PA 1G7PA 4S0SD 2CGRL 5FLVA 1E8WA 5T1MB 1N26A 3OAZK 3TNNA 5I1GH 3OPZH 3QIWD 3LN5A 2X28A 3WV0A 4HAKA 2DQHH 4MD4B 4E36A 5GRZA 2HT3D 5IVNA 2B59B 4HOWA 1AQKL 2NUPA 1H3TA 1SJEB 1LO4L 4TUKL 2BRRH 4KXZH 3WTVA 3INUL 1ZLSL 1JPSL 4UDUB 4TRPL 1DQTA 1FHGA 1QOKA 5ICXA 4JZNA 4LLVB 4XXDA 1P7QB 1Y1UA 2IAMB 2VN3A 5IT2H 2ESVD 3L95B 1I8MA 5L88H 4MJ6A 4JHAL 4S0HA 2OW6A 3DX7B 3QUKA 1QI4A 2ZXAA 5M95B 1R19A 1S7RB 4IQHA 4KVCH 1UJ3A 2F18A 4MAZA 1ZLUH 1BG1A 3H8NA 2N59A 1FSKC 3C12A 3DKHA 3UH8A 4WTQA 4OIIL 3KNBB 4HZLA 3BSZH 4GSUA 4ODXA 1TJGH 4XOCA 5D7LE 4F2FA 2XX0A 5LBGA 4HKBA 3MFFB 4EDWL 3QORC 4R9HA 5I8CA 4QXGL 1AJ7H 3RU8L 4JY4A 2WNWA 3NCWA 5DD6B 2B14A 4FL4C 5IB2A 2GIXA 4WCYL 5JDSB 3FSWA 3CFBB 5ICZB 4P2CG 4HHGA 5I1AB 3ABKB 1I9JL 3TONA 3MLSH 4O9HH 3I3EA 5TQ2H 1AG0A 4TQEH 1HC1A 1I4FB 1I75A 4UT6H 3RZWA 5IVZB 3QHFL 1E9OB 5HDRA 3KH3A 2ZSWA 1U91A 2J25A 2JV6A 5E99H 3A21A 2J88L 3VE0A 3NH7L 4WU7A 1JS4A 2NT1A 3DGCR 4HJUA 3MJ7A 3GIZH 5E03A 1S46A 2PP8A 5GZOD 5GXBB 3KCPB 4J3OF 2V7HA 3HLKA 4KQ4L 3EOBA 2BZ7A 3OJMB 4LSUL 5EULV 4RNRB 1P7KA 4ZNEA 3WFCL 4Q7DA 4KITB 2FBJL 4GKSA 4F2MB 1LMKA 1FVCA 3OG4B 4KMLB 5HI5C 4NZDA 4H88H 4M7JL 1HJBC 4N6RA 3LZNA 1CU4L 1JGIA 3EYQD 3F6IA 3NN8B 3QI9A 4S11A 4G7VL 4AOFA 5LBSA 4YDJB 2CUAA 5GGUA 2Z7UA 4ZRGA 4K5NA 1SF5A 1KBKA 4WTWA 4JY5L 3ZGIA 4R83A 1U8KB 1GS7A 1NBVL 4Y4HB 3BZ4B 3EJCA 3ZMRA 4F57L 3STZB 4AGMA 1JYXA 2V17L 5KVDL 5EIVA 1DJHA 4YZFF 3TURA 3CSYB 3DRQB 4BA8A 4LIQE 4YHIA 1MNNA 4DCQA 2Q86B 4PJDB 5F9WB 1XB8A 3BVDB 5B38B 4LSVH 1Q94A 3DUSB 1LDPH 3S35H 15C8H 5DRWA 3FO9A 5SV4A 3ZYZA 5BS0A 3QW9A 5SWQB 3QFJB 3ARBB 4P2RB 5FKAB 2CMRL 4RGMC 4TLUA 1CXIA 2OL3L 4OZ4B 2LHAA 1MHPH 1VCBC 1PU0A 2WO4A 2GCYA 3ENEA 3PS6A 1QRND 4KKCC 4QD2E 3S36H 3QDGB 4WEEA 2I9LB 3B4NA 3KAAA 3BAYA 4N0RA 3LD8B 4NKIL 2C34A 3H2WA 3BN9D 1D9KB 3TBWA 3DTXB 4JMNA 2ALWA 3I85A 3E6FA 4H20H 3BP4B 4K8RL 2FDBP 4M5YL 3KLKA 3OJDA 1BX2A 5IQOA 3ME0B 3QEHA 4HWBH 8CGTA 2XIDA 4ZSOE 1UUSA 4LP8A 1T0OA 2EIZB 3NG5A 3QIWA 4WKXA 1JFQL 4KJQD 4PGBA 1PEWA 3RJQB 1FFNB 4OFIA 1Z5YD 3NABL 4HHAB 5LNGA 2WXLA 2R1WB 2DMBA 2C4FT 3NQKA 4LL1A 5E4IA 2BINA 2JKLA 2B9BA 5D71L 1TJHL 1M2VA 2X6CA 3D05A 4G7YL 4AVHA 2DB8A 3VFRA 1T1XA 2ESVA 4G43B 1YEIL 4J4PD 2XV6B 5D1QE 3WTWA 4PJAF 1XF1A 3T9WA 3WKML 4K3DL 4CU6A 2YFNA 3IDNA 3FT4B 3ABMB 1L9SA 3ZSTA 3QJVB 4ZTPH 1R3KA 5E1IA 4X6EB 3LH2H 4MRBA 1TEFA 3APFA 4QT5A 5BRZB 4X42A 5GRJL 4KRLB 5C0IB 5CBEA 3DUUA 5FUCE 4HW6A 1ROWA 4KZ0A 4XPBL 5CJXC 4K9EH 3GHEH 4AXWB 4YC2B 5C8JA 1EFXB 4E42A 3DDGA 4UQAA 1AR1C 2Z92B 1S7SA 2AK4E 3BDYL 1KELL 1NAKH 3KWWA 4Z3FA 1NIAA 1DFXA 3FH8A 3H0TB 4K07A 2A9BA 2NQDA 5ID1A 3DURB 1B2WH 1A65A 1DQJA 3RVXC 1ZA6B 2LLNA 3QXAA 4F7MB 1FNLA 2KQNA 2NY4D 1ID5I 1DQML 1KGUA 4QRTB 2CJUL 3HRZA 3NSJA 4L8CB 3N04A 4PV8A 4ELKB 2V2TA 5CKAA 4JUTA 5GZOA 1C16A 2NY6B 4K5PA 2I9TB 1S7VB 3L3GB 5B38G 5CM1A 5I19L 5KSAD 1H9VA 3TCTA 1NSNH 4YHOL 1YJDC 3UBGA 3WHXA 4Z0BL 4YDNA 3IMTA 3RJDA 2OSXA 3QUZC 1KMGA 3PHOB 3LAFA 3VXNB 3GSXA 5I24A 2C9VA 1NL0H 2H3NA 3FQWA 3S3DB 3EH3B 4HUNB 3E8UL 4HLJA 4PH8A 1D6EB 4QUOA 5DUPH 4U3SA 2DJUA 4NDMA 2VSKB 2J8UF 5CCHE 3T0ED 4OCWH 4RAVB 2V37A 4U0QB 1H6EA 2AJXL 2VLMD 1UOKA 2AK1L 4JR9H 4CVWA 3TJPA 3PWVA 1CO1A 3GXNA 5EIIB 5AB1A 3RTQB 4D0CB 2YK1L 1UZ6F 4FTVD 5FUZL 2IXQB 1ZSDA 1RUPL 4F7CB 3FUEA 3O6FC 4OLUH 1OM3H 3SODB 2X44D 2WZAA 2P7TA 2AVGA 3NJXA 3CUPB 3UABA 2FHCA 2V5MA 4FQQB 3T8MA 1DJGA 5ISZB 1AGEA 1QRNA 5JPMC 4ZFZB 2VH5H 3P3TA 2YKKA 2H4EA 2YRPA 5C08E 3RGBA 2FATL 1TVBA 5FO7A 2NUTA 4KRNA 5H37A 4LKCB 5ACZB 1ZV5A 4JCMA 4AENB 1NIEA 3LKRA 1L4IA 2EXYC 4P4RB 3ZDYE 3ULUH 4PWFA 3UYPB 1OAZL 2R2HB 1IBHA 1WHPA 3CPUA 3L4YA 5EOCJ 4ZMAT 4HIHB 4G72B 4J3BA 4JQXA 1YC8A 5C0AB 3X13A 4Y2DC 4ABUA 4KHTH 3ZR6A 4C57C 2QPDB 2ZJSH 5CP3H 2GPZA 4I3RL 3AREB 1YUKB 4UT9L 2YSSA 3B3BA 4GUPB 2QL1A 3EO9H 4RGND 5GGSB 1G0YR 2DLFL 3ZHDA 3MV7B 3GYRA 4AJWA 3KXFD 4J4PA 4PW3A 3I50H 3TO4D 4HKJA 3HVDA 1MCHA 4J1UA 4LDCA 4TPRL 4JDZB 5A2IH 3L9EA 2E27L 2CXKA 2IAMC 3US1A 1SOXA 3DRTB 5KSBA 2HFFB 1DBMH 3TU6A 4FOMA 4U1KB 1WYJA 3RWJB 2QTVA 4YHMH 5CBAB 4JN2B 3BVVA 3BHBB 3QXDB 2DH3A 1RL1A 3BZEB 2ITDB 4MXQC 1IKOP 2AJZB 4JO2L 3RVVD 3CVHB 1W0VB 3MLWH 3U46B 1I85C 4MA7H 3ZTEA 1T20A 1Y18A 3H2QA 3OF6D 2R7EB 2EIBA 3HBQA 4LPYA 2X2HA 2CLZB 1ZTXL 3FB7B 4AMWA 3JT2A 1JHLH 2X7LB 1NCDL 1Q9WB 3REWB 3QDJE 1KCSH 2F53B 2HG0A 1ZHKA 1PD6A 1TQWA 2OXHB 2VWEC 4XB3A 4WW2A 4JLRA 4ILDA 2FX7L 1VPOH 3ARSA 3RVWD 5H4ZA 5EFIB 5IW1A 5IMMA 1HSAA 5DO8A 4HZ1A 1T1WA 4A37A 4PJFA 1H3VA 3A67L 5I1JL 2YGOA 4LSDA 2C3VA 4KXDA 3FO1A 1R1CA 3QR2A 2XV0A 5DVLA 3SYPA 1IILE 1DJIA 2HPTA 3SBWC 5EIIG 4YUEL 4ZOEA 4YZWA 3MRPB 3L3DB 1LO2H 2WXOA 2RB8A 4QTFA 1J5IA 5J3HD 1CD1B 2ZWSA 4FS0A 2XG5A 1LM8V 2PPAA 3U6RB 2ZUWA 2BVYA 3WJMB 1HOCB 2XQBH 5TGBA 1W0WB 4HH9B 1A9BB 3CVDA 5IROD 2Y4SA 2ED8A 2HFEA 3A4DA 4NWUL 4XP4L 4ATWA 4PJ9B 4ZMXA 2Z0UA 4P59H 5G4NA 1NUGA 2A38A 2WLJA 4V2CB 1MCQA 1XF4B 3VG9B 4JFHE 4ELMA 2KZKA 3IU3B 2MCPH 4GLRI 4LPWA 3WAJA 3PNRB 3GSQB 2JCCA 5BVJA 4BDVB 5J9PA 3T0EA 1JZ3A 1FBIH 4RMTA 1VEOA 4HEPG 1CYGA 2XTJD 1MRCH 3FTSA 4HUUB 1NGXB 4Y4HC 1QUNA 4JJ5B 4Z7VF 2I60L 4XMZA 1WK0A 5KVGL 1YSOA 3I02A 3SZ6A 4FTVA 4YGAB 3SD5A 4YMPA 5I23A 3PDGA 1GYAA 1CFQB 5F9WC 1G9ML 1SYVB 2NX5D 1MVYA 2VERN 3CSFA 5C0JB 5C08D 1YEGH 2XUWA 2YJQA 3DO7A 1NIFA 3AY4C 3HC0B 4DP6X 2YJLA 3FQRB 4R90H 3C6EA 5GRUL 3ARBC 3V4UH 3OKKA 3JWDH 3N41B 2R2EA 2QVTA 4NLHA 3B7YA 3KPMB 1S7TB 5HDWA 4Z7UB 1C5DB 5F1NB 2OAAA 3SE3A 5K5YA 4GKNA 5LJYH 4F5CE 2QSCL 3LD8C 1M2OA 2C4FU 5K1NA 8PAZA 1PAMA 3ELQA 1D9KC 2C9PA 4UM9B 4QY8A 2XZAH 4HKXB 1E7UA 1OAQL 3D4GA 1Z0MA 4FMFA 5JIPA 3RDTD 3AQYA 5CMAB 1U8QA 4JO3H 2DJ4A 2VC2H 4JE0A 4W9DC 5IB1A 3VM5A 1CF1A 3RUGB 2YPVH 3MXWL 2JMRA 4L23A 3VTTA 1KEGH 3MV9B 2XWTB 1TNMA 2X6UA 4OSUL 4Z3TA 3FUJA 3WELA 1WA1X 3KXFA 1WFNA 1WAPA 3TO4A 3FCBA 4X6FB 2FGWH 2OYKA 1AGCA 2OSLB 1UWGL 5CF3A 1WBYA 1FO0L 2WXNA 3EFFB 2HVJB 3FKUS 3B37A 4MJ5B 3L5HA 1YEHH 4NQVA 2UZXB 5JO5A 2Z7WA 1TOXA 4JFDD 1ULVA 2GTQA 3DETD 5JA8B 1IGFH 5DMYA 1G6RL 1HQRB 3HG1E 3E9UA 2O6FA 4G9FE 2YLHA 3SDYH 1FFRA 4FQIH 3QWOA 1FL5A 1S9VA 5JLZA 3OF6A 5HHMD 3DVGB 3MUUA 4UOJA 2A9DA 5D1XE 2LT9A 2X4QA 1U8IB 1RURH 2DTML 4JJHA 5EZIL 2E9JA 4WI4A 5BUGA 2EH7H 2ZYIA 5C71A 1ZDSA 4E9QA 3ARXA 4HS6B 1KUMA 3F01A 4JGJA 4UQ2B 3BQUD 1BIIA 1D5BA 1QUPA 3FT3A 3QS3A 3W39A 5IHZA 1AXSA 3UTSD 3KE0A 3O81A 5DJZB 1ANUA 4GO8A 1IB5A 2EP6A 3O4OB 4AEIH 4EDXA 4KDTA 3QZWB 5JNYA 5CJBA 3K3QA 3TM6A 4LCVA 1KBWA 2VXVH 1TLKA 1V3LA 3DI3B 3VI4E 3WI9A 2EADA 1PYWB 5E1AA 1KTCA 5IJDC 1T04A 2FX8L 2NY6C 4OJYA 2XWJA 4J3OH 5JIDA 1P6AB 3AG3B 4WJ5A 1D5IL 4GQPH 4MVBC 5IROA 1HILB 1HCYA 5DD1H 1ZS8B 5T1LB 3ROLA 3APCA 3BWAB 3WJLC 2H2SC 1UFUA 1MVFA 1S7WA 1HHHB 3UROR 3OKDA 1MLBB 2ODIA 1OM9A 2FE0A 3W2DH 1Y0LA 1YEDB 4XI5D 3O3UN 4Y16B 3FXIC 2PR4H 1B0WA 1X7SA 1OHQA 3OKMA 2ZP0T 2IWGA 1PKQB 4HQQL 5HHVL 3DBXB 5DC2A 4MJID 1P1ZB 2P8MB 2ZKHH 1K9TA 1F6LL 5HSFA 3GZPA 2BY2A 5J0BA 4TSCL 2NX5A 1FVDB 5C08A 3RTQC 4B96A 4U0RB 5L88L 2V7NB 1JF1B 3VFWB 3FCTB 2GTZB 2YKLH 5DT1L 1CT8B 3K6DA 4K7FB 3I74A 5I8OH 3MRKB 5EU7E 2WXPA 2XACC 3I9IA 5BMFL 1F3DH 1JZDC 2DOCA 4XX1G 1XF3B 3HNSH 4LASL 4B9GA 5IR1A 5C07B 3TBYB 3GHPA 4PY8J 5DUBB 3I2CL 1X9LA 2G5UA 5HVFB 1YAZA 2DYPD 2XQYA 1NM9A 3BUPA 1QNZH 2YXMA 4ES9A 3BP5A 3RDTA 1AGFB 3IS1X 1T80A 1VACA 2LLLA 1ZT1A 4F1SA 2JKWA 3C08H 1XBRA 2OK0L 4M3HA 3SDXE 4HUVB 2B15A 4UUJA 4Q2ZA 4JGMA 1G5GA 2D4DA 1X6NA 5TE7H 3QJHB 1RUQL 4LSTH 1ZGLA 3L6FB 3ULSB 4E9LA 3AREC 4R0LB 2AERT 2YQBA 3C9NA 5AG9A 5TDPA 1TSHA 1X7QB 2Y69B 4ZXBB 4ZMVA 3MA7A 2A6JB 4OR1A 4NJAL 1C08B 4MSWB 4R5TA 4ZD3L 5IGXH 4KTDH 2A1WL 2YGQA 4N9GA 4TXVB 2J1ZA 4B7IA 1QFUL 3QZWG 4PJEA 1AYRA 3ZU8A 4JFDA 4OD1L 4OCRL 3S3JA 3GXFA 4GP5B 2QTEA 5IVXE 5EOTB 1EBPA 2DQEH 2P5WB 3IPEA 1PQZA 2ZXGA 4U6VL 3HAEH 5FC9A 3V6OA 4H88L 3G5YA 1JXJA 3O8XD 4BIKA 2QQNL 3B2PA 1G43A 3F58H 4GRMA 4YHKH 1EAPA 4AM0Q 1EZVX 5IUSA 5DQJB 4AM0B 3IE9A 2GSIB 4PGJA 1J9CT 3ESVF 4YXHL 4JG0L 1CFVH 3BQUA 4LVEA 3MCG1 1M56B 3DX2A 4NHUB 1V05A 3QARA 2CLRB 3KVPA 4NIKB 2IADA 4PRPD 5CN2A 2LFGA 1M71B 2PTTB 3L4VA 3EFDH 4POZC 1MFMA 6PAZA 3CZUB 4NKOA 3VDCA 1SBSL 1FFPA 1Q0YL 3A4FA 4HU2A 1TENA 3UIZA 3MRNA 4ZFOA 5ITFB 1QI3A 5KAQG 1A0QH 2BSSB 1BPVA 5CSZB 2DLIA 4F91B 4NUJB 4LPCA 1I9RL 1KTDB 3M07A 3NIFE 1MHPL 5J5EA 4NOBA 3S36L 1MJ8H 1GPOH 3Q1SH 3ZGHA 4FZEL 1LD9B 3DVFA 2WGXA 3RWCA 2ZNXA 1GS6X 1U3NA 1NGPL 2YPKA 1CXLA 3CC5A 3EJYC 1U58A 3FUIA 3GC3A 1HZLA 4HJJH 3B9VA 1AXIB 1U42A 3GMMB 3U0TB 4H20L 5JIMA 2O61A 3H85A 4B9PA 1EVTC 2D7PA 1KXVA 3GSNA 1BCIA 4XVUC 4DP5X 2VZVA 4PJ9C 3OQRA 2XIIA 4GAAA 3HPLB 1UACH 2XI9A 3AXIA 2XN0A 3PGFL 2WCPA 4XWGL 1JHTA 4PVMA 1MWAL 3C2AH 4YIQA 2Q8AL 1OGAE 1L3NA 4K8RC 1YEKL 1TKWB 2HLFC 1J0JA 2O5YL 3GS4A 3SGEH 3TVMB 3VSVA 3HC4H 4GQZA 4DPRA 4APXB 4OJEH 5EDSA 5D5MF 3KJ6L 2GQHA 4FP8L 3MCYA 4LNRB 3L1OL 1FLTX 1S9KC 1DJSA 2O6PA 4LDLB 4P46A 1S4IA 1UG9A 4R96B 4KMQA 1CL7I 3U1PA 5J06A 4OM1H 4KH9A 4S1SL 2IPTL 1NMBH 3LHPL 1UZ6E 3LV3A 4OIBA 1AY1H 5H94A 3TBVB 3DIDA 5ADPL 1MAMH 1TTRA 1NANH 1X5YA 3FMGL 4WVRA 3KYMB 3FTWA 3PAUA 3TTYA 4EI6B 5C86A 2DYPA 4K9EL 4TUOB 1BEXA 1IC4L 1SBBA 1HH9A 1BQHB 5F7EH 3KVQA 1P7HL 1SNRA 1UVQB 4CC4A 1IC7L 3CZNA 3KYKH 4H5SA 5IB5A 1QLFA 4HAFA 2BHZA 5CEZE 4BFIA 1VHPA 4LB8A 2YA1A 1T0NB 5AVRB 3FB5A 1IM3D 5HHNA 2F5BH 2EDQA 4AJVA 4YO0B 2ZPKL 5CJOL 1NBYA 5F6HJ 2MKWA 1RCYA 3QEQE 5F9AC 1A9EB 5KSBF 5D7KE 3TBTA 5DFVD 1WCBB 4X9FA 2J4WL 4FQXB 4H1LB 1VADB 3PAZA 5CD5D 2Y7NA 1GZPA 4N86A 3AM8C 4MS8D 5M94B 3BPOB 3E0GA 1H3GA 1J87A 4OCMC 4PYHA 1D5RA 5CIPH 1D6VH 1NPJA 3K6OA 3V0WH 3HE7C 2VDPB 3GI8L 4WW1A 5HHQA 5IJVA 1WZMA 3EGDB 3PWUB 4NHCH 3WJJA 4MX7B 1BMGA 1BFOA 1URIA 2R2CA 4K15A 3MR9A 3O8XA 4MZ3A 2Q0ZX 5EC2B 3SGJC 1N4XH 1G4MA 3ULVD 1D7DA 2XY1A 1WISA 3D39B 3NQIA 3N1PC 4V1DB 5AW5B 1UXWA 1YYLH 3K6NA 4HAGA 4W9JC 4PS3A 2DDQH 1NFIA 1LWHA 3TPKA 5IEKB 4WU5A 1F90L 4LARL 4WW2F 3FSAA 4IOIA 2PWDA 5DHVH 4M61B 1CLYL 4QCIA 2Y2WA 4PJFF 4OCWL 3PP4L 4LCIH 1R3IH 4C56E 1ZLVH 4PRPA 3RIKA 4D0BA 1RZIB 1KIPA 4AIEA 1C5BH 1Q38A 5ICYA 4FA6A 3KDMA 5L9DL 4HFWA 1ES0B 3IN0A 4OLUL 4XCEA 3O4OC 4ZDHB 1E3XA 5IESH 3L3OB 4FI8A 4JFTA 4W9FC 2XSKA 1LQBC 2EVHA 1UADC 4G8GD 4PJIE 1S8DA 1MFUA 3TIEA 3O9WB 5JUEH 1J5CA 1T7XA 4KNQA 3QPXH 3A47A 3IJEA 4HEMA 1KYUA 4MB3A 4UAOC 3MRJB 2J55A 2ZXWB 4ELMF 3WLWC 3MUGB 4R5XA 5E7BA 3B7SA 4YS4A 2JCCF 3ZDZE 1EEYB 3IMUA 4DGUA 1I8KB 3O4LB 5F8QC 4WFED 1P1VA 2YD0A 5CP7B 2AI0L 3FCSB 4KHTL 5BOZG 3V2AR 1CF8H 4PRDA 4ODHH 1MG2C 1QFWH 3ZE0B 1BQHG 1NCJA 5DLMH 2JE8A 1IAOA 3BGFC 1I82A 1PZUB 1U3HD 2BMKA 4G8FA 1MFEH 4OCYH 2YXFA 1MVUA 2E7LA 2ZCZA 4CADB 4XNYH 2Y07H 2XZCL 3QCUL 1CDHA 1N59A 2X41A 2Y25A 3F7PC 2YBGA 3MRLB 4P57A 4U4BA 1JUFB 1SXZA 4HIJB 1NFKA 4N0UB 1U6AL 4DSYA 3CLWA 2X70B 3LNGA 3P0GB 4M6NL 4F33A 2R9HD 3GI9H 1B0RB 4H1LG 2D73A 2EYSA 3I6LE 1MF2L 5E1HB 4NQQA 4X2UA 3UYRH 3US9A 1PY9A 2E7CA 3K1KC 3OAUL 4Q6YA 5CEZD 4ENED 1TYRA 4LRNH 4A7GA 3AU1B 4JFQA 3IXTA 1RK0A 2RFXA 4YPGB 5ABZA 2RIKA 3BPCB 5E4AA 1W80A 3MLZH 4X6DB 3EYOA 5CLTA 1XGTB 2E9WA 2BNRD 1IM3A 1DBJH 4HSAC 1OXYA 1VGEH 3BX7C 4TNWK 3BSHA 4F9PA 5T5NG 3SKMB 2XPGB 1A5FH 4P99A 3V0AC 1DUZA 2N01B 2XA3A 5FO8B 1MH5B 4NO2B 3VQ1C 1LWRA 2GK2A 4OLVH 3P69A 5IVXA 4R0LC 2AEPH 2CJ3A 1HX0A 1MLCB 2EH8L 4LXFA 4KK8D 1TDQA 5DA0B 4ZXBC 3K2IA 4WUKL 4L18A 3MBWB 3BCDA 1H3XA 5FCUL 5HGAA 3LKOB 3QEGL 3Q8EA 2IPKB 4WUUB 2VLJD 4PS4L 5IKCB 2F5AL 4OCNC 4XO4A 3GNMH 2NYYC 3KPRB 2AQSA 1E4WH 4XP1H 2VQTA 5JQIB 1LILA 5SWSB 1G0DA 1PD1A 4G8EA 3F3HA 4CVZB 3NK3A 5GS2D 2KL6A 4RDBA 1KGCE 5I6OA 4KI5C 4IKJA 2CHXA 2FEDC 2M26A 3CFEA 2ICES 3P9MB 4LBEB 4P59L 4U1NA 2BNQB 3EG9B 4C47A 3GKWH 2X4PA 5DRZB 1ETB1 4NQCD 3TV3L 4F7TB 2E86A 2X4RB 1A3RH 4LOFA 4MYPA 4UQIM 5LGYA 3QHTC 4Q89A 5GS1A 5BRQA 1PEZA 1RJZA 1Z6JT 3DIVA 3FN3A 5LO7A 1KCRL 5I1IL 5F7LB 4GSQA 3WE6B 1IGCL 2OYPA 2WQSA 3IU4L 1YMME 5MERB 3NRQA 1A3QA 5IQLA 4KRMB 4LPVA 1T22B 1VAHA 3N85L 1H6FA 2ZWLT 4G8GA 2OBGA 1XZWA 2HN7B 5HHPB 3NFSL 4G7QB 4BKLB 4LOUC 3GMOB 2CDEB 4JFZL 4K3JH 3TA3D 5DZ9A 3WLBB 1SN0A 3QUMA 3F7RA 4WWKD 2FQEA 2WVUA 1B6UA 1WBZA 5IBTL 5GRVK 1IFGA 1HHJA 4RBPH 5CILH 3C5ZB 1WFUA 2VLKD 3LS4H 5LBSH 1O7DE 2MQGA 2ADGA 2AEQH 5I28A 3HZYA 2LU3A 3QPQC 1BP3B 3BAEH 4QWWC 4HD5A 4DZBB 2FSDA 3K91A 1CE1H 4W9EC 2VN7A 1Q1JH 3ZK0A 4F8QA 1V3JA 1XEUA 4ODUA 2YPVL 5FECB 1FE8L 5F1IB 2WP3T 3BE1L 1QKZL 1U3HA 3QQDA 4XPHL 2UXVA 4EZKA 3CFCL 1I3GL 2Q1EA 5HDLA 1AZUA 1A7OL 4H8HA 5JTWA 2J5LB 3MJ9L 3BWUC 2GJJA 4K23H 3U1SH 1IAMA 4HK3N 3MRQB 4NQXA 1T5WB 4NQSB 3R06A 4E9VA 3MBED 5LGHL 3MRCA 4G1EA 1S7UA 3EXLA 1Q9LB 1QLEH 4JY6A 4PS8A 4EOWL 5I1KL 1IT9H 5J1TC 4I4WA 3AAZA 2JQAA 3BUBA 5I15H 4MNHA 2LU7A 4G6AC 3TEWA 1HXMB 1MW2A 4ODBD 2EDTA 3BVWA 5BVPL 1NAMA 4KZCA 1SEQL 2WVSA 3Q13A 3GDCA 3MLRH 3NIDF 3WD5H 3ZHLA 3C8KB 3D0VA 3EF7A 2BNRA 1PLBA 3Q1EA 3KW7A 3RFRA 1IJNA 3F6JA 1I3UA 1X4YA 4KK9D 4GI8A 4XCYB 1AHMA 1A6WL 3ERXA 5DJ0A 3BEWA 2JKNA 2G4EA 3ZE2E 3IFNL 2X0VA 4NT6A 1P9MC 1IKFL 1NEZB 2ICWJ 3QNYA 4N0YL 4Z7WB 4IOFC 2YGPA 3SQOL 1JRHL 4BWTA 1FN4A 4WI5A 3B2MA 1A4JB 4BH7B 4HUCA 2J1KA 4PJEF 3BIAX 5GJSL 4L8BA 2W9EL 4Y2OB 4FQXC 4P2AA 2EDFA 2F1AA 2VT0A 2VLJA 4FNLH 3S48A 1RQ5A 3BPOC 1LDSA 1I1AD 3TJHD 4ANKA 4X8CA 2R0KH 1LNUA 3G3LA 1ODAA 3OGOE 1UXSB 2B39A 3O3AA 4UOQA 1T7ZA 2CGYA 4MD5A 3ZIYA 1XF2A 1XGUB 2WINA 5EWIH 4ZMZA 3UTQA 1B4TA 2I32A 1AZVA 1HDMB 2W80C 4HUWB 4NZTL 3ARDB 1E9PB 3Q0HA 4IRZA 4L9LB 4NP9A 1A14H 1NDGA 5CGBA 5GGRY 4F3FA 4HETA 1H8SA 3UXFA 4NQCA 5JHBA 2IO5A 1KJVB 2XBDA 3L1EA 3RGHA 3GMNA 1UD2A 2ARJA 2H1LM 2PR4L 4XN7A 2PN5A 3VFSA 4UT7H 1MHCA 4M43H 1I3RA 1NCCL 3L7EB 1BQKA 4PJIA 4GXUM 4MDRA 4J3TA 3NCCB 5F3HA 2NQCA 4DKAA 4TUJB 4I2XE 5MEPB 1ZPUA 5J4MA 5ESQB 3L4XA 4JE4B 4H4NA 1WAEA 4P5TC 3GXTA 3K72B 3SDDB 3EW3B 4DEPB 3FYIB 3HZVA 1RVFH 3NIGE 4M8VA 3VXSD 3NRPA 1EHLH 3ZL1A 1O6SA 3ZL2A 3ILPB 3L3OC 5DRXB 1BECA 1CG9B 2JNZA 1XCWA 1BD2D 1JNHA 5B7EA 2FTAA 4WWKA 1J9QA 1LE9B 2OR9L 3BC9A 1BOYA 4EIZC 4PJXB 1BMWA 2OXGB 3KYNA 4FN0A 4W4NA 3PCYA 2VLKA 1ND0A 1RU9H 5B21A 4OZHE 2PWGA 4YHPB 1KV3A 1J7VR 2BVEA 2ICCA 1DO6A 1CDUA 1KC5H 2P26A 3A23A 3DMMB 3IXAB 3GK8L 2C3WA 2YC1B 5DGQA 3VAEA 3VU2A 4I48A 4ETQB 4UM8B 4AQ8C 3SCMB 5JR1L 1SUHA 3AZUA 1T0MA 2Q7YA 1HINH 3PWLB 1NDMB 2YZ8A 2WCSA 2CHZA 2MOGA 5DJDA 3C75A 1BAFL 3HS0B 1NBQA 1BZ7B 2WYIA 2Q3ZA 5B1CA 2NSXA 1CVRA 1XGQA 1ZEAH 2LVCA 4HCIA 4OGYH 4BRJA 1TT6A 4Q0XL 3MU3A 2X87A 1CR9H 2WLNA 3MBEA 1PFCA 3N1QC 4NWTH 3MMEA 3UAAA 5CD3A 2MWCA 5GJTL 1NEZG 4DKFH 2YAHA 1SOQA 1TQSA 5AOLA 5EBWB 2H6PA 1DBAL 2IH3B 4LEEA 1CTNA 5H37H 2QSQA 4M8RA 4YBQC 3TH3T 2EYTA 4M29A 4L4TB 2VLLA 3N40P 2J44A 1KLFB 2PO6B 4G6KL 5JIHA 1KCLA 1P69B 5IIEB 3O6KH 4X9IA 2ZYHA 3KPQA 4HYTB 4JDEB 3V0IA 4WI6A 3DGDA 4HWEH 1OSZA 1NGYB 4FC3E 4PRAB 1SLUA 4AQEA 1JHKH 1WH0A 5E9NA 2DD8H 4QO1A 1CFNA 1D5ZA 5EEWA 3LMJH 3IETA 5GZNA 2YPLD 3ESMA 3QP3A 5F7MC 4HJEA 5IREA 5DD5H 2VDMH 3PP3K 2ZOWA 1T03L 4Y7MA 3OLIA 3VH8A 3UAJC 1LP9A 2HKHL 1J0KA 1U8HA 2GSGB 1RJLB 2DJSA 1QFWM 3F00A 5DJAA 2YAPA 2IBGA 3LRSB 2XVBA 1A1MB 1WBXB 1I1AA 4QRQA 1KNOB 4P2OD 43CAB 2DLHA 1QABA 2V33A 5AQ0A 4HMCA 5B8CB 5EG6C 4AVJA 2G9HB 5FOJA 5F97E 3NPSB 2WXGA 4HJJL 1HE7A 5DVOA 4MZIA 2BJMH 1GGIL 5F9JA 2F15A 3HOGA 2B1OA 5FV1L 3VXME 5EEYA 3JV6A 1LEKB 4LEOB 3HEIB 3U36A 2PYFB 3DV4B 5DI8B 3PUCA 2WAHA 4K7PH 3MROB 4LSPL 3KL3A 1RIHL 1I8IB 1UACL 4HJGA 5BUAA 4W68A 1KENH 4QXVA 3WSQH 4JDTL 2VC2B 2K70A 1WZLA 1S3KL 1Z5LA 3HC4L 4PJHB 1MOEA 4PJ5B 5D1ZC 1ZVHA 1I1FB 4LSRH 1IEHA 5SWZD 2FT7A 4M1CD 4HS8L 3V4VA 3VXSA 1GCYA 3WY1A 3F05A 32C2A 2E3VA 4H8UA 4J8RB 4B0MM 5FM4A 2CJSA 1BD2A 3P2DA 2AAVA 4XAKD 4NENB 2VISB 3IYLW 3RPBA 1KCUH 5IFAL 4G6JL 3FUHA 1MAML 4ZFFB 5IFHL 3QHZH 2Z31D 3SBPA 2BXYA 5A2CA 2XWRA 2XTSA 4UOW0 4Z76B 1F3RB 3T3MB 2WXJA 1J1OH 3EIFA 2BWIA 2YEQA 4QRUB 3TXAA 4ZI8A 1GAFL 3C5ZC 5HYEA 4LIQH 1URZA 2FJFB 4Q14A 3MNZA 1MG3C 1P6WA 3KYKL 3CDCA 5C7ZA 1CJYA 1AHWA 1U92B 2V5RA 3QGVA 3T0AA 2ZONA 3S3SA 1QBMH 5DDHA 2FH6A 3B7RL 1F42A 3K71A 1U41A 2VSCA 4K9EC 3L5IA 3OBAA 1PZBA 4FXLA 4M93B 3CZKA 5KG9B 1ZHNA 3ATBA 1C8QA 3QJXA 5ALBH 4NEHB 5ESVB 5FA4B 3ZE1B 1F8TH 1QEWA 3FTUA 5EPMA 3VFGL 4ZFGL 3VMPA 4OKDA 4AYFB 3WY2A 1J0YA 4PJCE 3NZ8A 4EIUA 1WT5C 2OX5B 3X3FL 3ARFC 2J5LC 4MJJA 3S2CA 5E6SB 1OAUH 2JJTA 3IVKB 4BZ2A 3MRFB 1N2RA 3KS0J 4HJIA 2AGJH 2D0HA 3IN2A 3SPCA 4OI8A 3KGSA 3T4YA 1CBJA 4MHHI 4OZIB 4B5ZA 3O2WL 5FYKU 5B39A 4L37A 5HGBB 1UWEL 2OPCA 4X6CA 5D4HA 1QHOA 1SEBA 4RFNB 4F8LA 1FG9C 1MDAA 1JTPA 3K8MA 5F9OH 1HE8A 3DPDA 3OC5A 1KPRA 3G5XB 2OSWA 12E8L 1INDH 3ZTJH 1ZHLA 1EO8L 3NSDA 5JHDD 5TE4H 3WS6A 2ZWYA 3BKCL 5JORB 3NDYE 1OGPA 2C8NA 1R3IL 4AC2A 1X5GA 4E68A 5BRZD 2YPLA 4AKQA 1L7TL 1ZWIB 4ZUVA 3B5TA 3QO1B 4PY8I 5I2IA 3K2UL 3EJZC 3LKNA 1NDTA 1KCVH 3F5WA 2MTPA 1XVSA 5JOFA 1JV2A 4L1BA 3VRLF 3WIFB 4JHWL 3Q6GH 3MV8E 2ZAIA 5I17A 3KWTA 1NLBL 4WSKA 2ZP9A 2EIJB 2HA1A 1R24A 2CZNA 3HZKA 4PR5B 1N67A 2XRAL 5FDYA 1SJXA 1IM9B 5AOZA 4GO6B 1NCWL 3CFBA 4NO3A 4P2OA 4PJBA 3PDOB 3ISWA 4P8QA 5JUEL 3I9AA 2GUOA 4KPHH 5I1AA 1QMUA 2VXSL 1IBGL 4TF4A 3ULVF 5CINH 3BH8B 3WGUB 4W9LC 3PQYD 1AP2B 1NINA 1OTTD 3EHBB 4JZOA 1M1XA 2FWSA 3ELAT 3MCKB 3JWNH 4R4BA 2Y3AA 3WKYA 3X1NA 3PGDA 2X3AA 4YX2H 2IJ0C 4FJ6A 4U7SA 5T3ZL 2BVPB 4GLRH 5DSCB 3MA9H 4ZUUB 3H9HA 4ZMLA 2CKNA 4E5XB 4PYGA 3QUXB 1CF8L 5DO2C 3CFMA 3FCGA 2CHNA 2A4CA 4APQD 3UPCA 4KK6D 3X1BA 3FT2B 4F2MA 3ULUC 1YY9C 4UV7L 3F2LA 3T6QC 5LBVA 3TWCH 1KTLA 5LKNA 2OP4H 2FSEB 2XVKA 1YECL 1LK2B 1UH2A 5SWZA 5TE6H 2C1PA 4IDJH 3FPXA 3VXTB 4JG5A 4ONGH 1GYWA 3NZHH 4DP7X 3KLDA 1OLZA 1G7IB 5KBLA 1BYPA 1NGZB 2ZT9C 1DSWA 3LRMA 4PWIA 5E5UB 3S96B 2P9RA 4RISL 4PQXA 3D34A 4GKOA 3SDDC 3UC2A 4DEPC 5AZEL 5HYJB 1UH4A 3CSYA 4NQDD 1QO3B 2Z31A 1H8NA 3S37X 5JDJA 4XN4A 2MPAH 4PCYA 1E9QB 4NYLA 5FYLD 4PHXA 3MRBB 5G4MA 1MWOA 5JYMA 3DHMA 3T6XA 4Z77A 1OHZA 3LKQA 3O6ML 4BXVA 2BVTA 1DHKA 1HIMH 1U4EA 1ZMYA 4XTRC 3DMMC 2F54B 2Y6TE 1KJMA 1QRKA 2ED9A 4M7KH 3RL1A 4J3OG 3T65B 1YRKA 2VXUL 3P3YA 4XWOD 3WFDL 4F8PA 1T6BX 4UBDD 4B97A 4NGHL 3R4DA 2R23B 2NNCA 1XH2A 5IM7B 1J1PH 4RMVA 4C55A 3K0WA 2K3TA 3HS0C 3HR5A 4BSWB 2AEPL 1EMTL 4P2QB 2DEXX 1DQVA 1TTGA 4TKWA 3V5HA 5E6UB 1N5YH 1IEBA 3KBHE 3VW3H 3G04B 3UDWC 2PXYD 1RZ8A 4S1DD 1J9SA 4OBRA 3QQ4A 2HJLB 3TJEH 4D7BA 2O6CA 4GRWE 3BMWA 4AQ1B 1IGIH 4HHAA 3PU7A 3ARRA 1DVXA 4I7ZC 3O3DB 4FFWD 2QVMA 1NJ9A 3L4ZA 3DTDA 4OY9A 3VSQA 3HUJA 4O02L 1M3JA 1U8CB 2APXA 4QRPD 4G59C 1DFBH 3IFOA 1T1YA 2PO6C 4LLDA 5JHDA 3HI1B 2P8LB 3PWPB 4JFEB 2QPFA 3CX2A 1GIGL 3P9LB 5K59E 2ITFA 1C5CL 1WC7A 1RUAH 3GSOB 5BRZA 4C4UA 5KWYC 3P4MA 3RB5A 4CMMA 3HN5A 5HDBE 3UTPE 3QXWA 1BLNB 4JRYE 3S9DB 2BFVL 1JYWA 1R33A 4E5XG 1QFPA 4N22A 1K2DA 5C92A 5ANMB 2IANE 3RX9A 4D9RE 5KW9L 4Y4KC 1K5NA 1QQDA 1SQ2N 3EH4B 3QG6B 2UZIL 2A83B 3U7WL 1JPGA 1BXVA 1EGJA 2O5XL 2J8UB 4F7PA 4FNQA 4EKXA 5AZ2H 4FQLH 5LG1A 2ATPB 4H40A 4PJGE 3U9WA 1QPXA 3QRFM 2F53D 4TQ8A 3PQYA 4XN5A 3DURA 1ZVSA 2EJ1A 2R1YB 5D2LB 3CHOA 5EH1A 2L7JA 2AQTA 5F6HI 1OSPH 7PAZA 4S1QH 4GAJL 3EJSA 4AQOA 2HT2C 5AVSB 3OXSA 2FLRT 2Z1KA 1QTYT 3V52L 4Z7QF 3DJRA 4I5BB 5B8CC 2DICA 1ID2A 2EXWC 4L8CA 3NA9H 1QFOA 3NPSC 2MH4A 3C60D 3EF4A 3FQTA 3ZBMA 3AFLA 4HPYL 3RWHA 2E56A 3VA2C 2EKSB 1ZS2A 1HU8A 4APQA 1J48A 4ZUSA 1XHHA 1T4WA 2CO4A 3R0MA 4XC3L 3E8VA 1ACXA 1AC6A 3DDFA 4OCSH 2F74B 5I8KH 1MFBH 3AB0B 2C3XA 4JJOA 2A6DA 1S3RA 3NSXA 5C9JA 1A4KA 4MWFB 1DO5A 3LXBA 5EU6E 4AGPA 5EB9A 5A7EA 1KIUB 1UOVA 1XGYH 1I7ZB 3SY0B 1YEFL 1KF9B 3SSGA 1E65A 1K4DA 4IS6A 4NPYB 4L3EB 4NQDA 1CD8A 4R8WH 2XNAB 4X0KB 1QSEE 3H55A 3OAYK 1ROCA 4Y5YB 3U4BH 3MRHB 1YNLH 4PSRA 3ZUNC 1QAWA 5EU3B 2HWZL 3QJZA 5CIPB 2K8QA 5TQ0L 1PNDA 1INQB 4MYWB 5JZ7D 1T7VA 4GG6A 4OAWB 3K6IA 2YGVA 3RFZC 1I7UB 5FEBA 1WSST 1WGVA 3FQYA 1HWHB 3GSNH 1XQ4A 1QLRA 1R6VA 1X9UA 4QLRA 4KVPA 3LN4A 2HLAB 3ECQA 2JELH 2PYEB 3UBXI 1CGVA 1L7IH 3QWNA 4JB9H 5CGYD 1U0QA 2OMTB 4DJMA 5TDNA 4HOXA 1XH3A 5D7JB 5AVWB 3HHSA 1RUML 4M93C 5DHVB 2DQJL 5IK3A 1G9NL 2H8PB 2AZAA 3OD3A 4BH8A 3RWIB 3BGMA 4K71B 3DGGB 1FLRL 3G5ZA 1AMYA 2EUXA 1A6UL 2FB4L 1T2JA 2UZYA 4YWGH 2PXYA 3QYMA 1K4CA 5BO1L 2DWXA 3UZVA 1MCIA 4QYAA 3UP6A 3WFEH 2J12B 4L4VD 4AG4H 4I18B 1L9QA 4FNUA 4ESKA 4A6YA 3EH2A 2EDWA 3TCLA 1ED3B 1T7YA 1KYDA 1J5DA 4DP4X 1WV7T 2F08A 1C12B 2OTWB 2VXTH 5H2BB 4D2NA 1XDTT 3FONB 4FQJH 3ROOA 1NCBL 4JUSA 4IJTA 4QRPA 1OSYA 4PRHD 1DQDH 1N7MH 4EZLA 4W6WB 5HHXH 1DEEA 1JVKA 1O6TA 3V0VA 4RFNC 3NFNB 4KFZC 2HRHA 4I0PB 1NC2D 4MDJA 4J3OC 4U1IA 3RZCD 4OV5A 1MSPA 2W65B 2ATKB 2ZX8A 4AH2B 2QJDA 2E4TA 4N85A 2FK9A 1SM3L 4HOMA 2V2WB 3RWGB 3C6LD 4ZS6D 1KJ2L 3TC9A 3CVHA 1ZTMA 1LP9F 2KS0A 5DTFA 2WHVA 1UM4L 2BRQA 3N43F 3HBZA 1FUNA 3BAWA 4J28A 1SY6A 1VKXB 1ZKAA 2VE6B 2YUZA 2G2PA 3RWDA 1OB1B 3RNKA 2X7LA 4Z7VB 2F53A 2G3MA 2HAZA 4F7TA 4IMLA 4O51A 4D3CH 3QZNA 3KGRA 4WK4B 1UWYA 1Y7VA 2CU9A 1BVNT 3LN9A 4BGLA 5HHOB 2ZKXA 4OGAC 5C3IA 1VRSA 1QD0A 4NZRH 4JVPA 1JWUA 1SRDA 4ZW7A 5GISH 4E41D 2W0FB 4PY7B 1KTRL 1OT1A 3FTXA 3J2PA 4XN2A 3EHBC 2FL5B 3KPPA 3QAZB 5ICUA 3C60A 4YLCA 1DQQA 5I8EA 2ICEA 1OANA 3PHQA 1KBGH 4H8WH 4KBPA 4JQIL 1KLGB 4IK7A 5K9OA 4UQDA 2IG2L 3UBXA 1G7PB 3L81A 1W8NA 4KHXL 4AUJA 1MRFH 3MXVH 3FOMA 3N1GC 2H0EA 4TVPD 3WJMA 4EKJA 1DBBH 1W0WA 4HH9A 3SE8H 4G3YL 3TNNB 1M3IA 2ROYA 4KAQH 2CKBL 4B0MB 3NYKA 3BUIA 5C0BE 5GS0D 2NUPB 2UWEA 3CFTA 2OZ4A 3HI6L 4DEUA 3GD1C 3SZKC 4A66A 5BO0D 2M8XA 1CL7H 3LZQA 4JKMA 5IJKC 4IGBC 1ASPA 4JZNB 5ICXB 5E7FA 2XN2A 4XXDB 2HG5A 4Y16D 3QUYD 1I8MB 2EDDA 1QP1A 1RJYA 1BMZA 4MJ6B 5D7SH 4BUQA 1QHPA 3QUKB 4PP1D 3II1A 5GS3A 4KKLD 4MNQD 3S35X 3RY6C 1PG7H 2PWFA 3OHXA 2W0LA 1UJ3B 1ADQL 2VDRB 4WFFD 1BVZA 1O9ZA 5F7BA 2J6WA 3TTSA 4WNQA 5FFLA 4HZLB 4XAWL 1JD9A 2JQZA 3RLSA 4YHNA 4UQBA 1OE1A 3S36X 3WIHL 4UYPA 3FQRA 3SGDI 2BFGA 1Z3RA 1MFDH 1DL7L 1JPTH 1LHZA 2NY7H 4HKBB 4PUBL 5I8CB 1G4RA 5DHMC 4ALAL 3E6HA 1DTUA 5HTSA 4OQ1A 2HTKD 4DK6A 4DVRH 4C4BA 3BVTA 3JTSA 3FU3A 3UBFA 4KZEL 4LRIA 4XNAA 4U2ZA 4M6ML 5BJTA 1FAIL 4R7DA 1KXHA 1ET7A 5A2AA 4MMZA 4U6XB 2OQJA 1X5IA 2MOVA 2NRDA 5EN3A 4URKA 3W1ZA 4I87A 4P3DA 4L4VA 1OCOB 2VDLH 2ZSWB 2FEEL 1U91B 2FX9H 2XFGB 1MW3A 3VFVA 4X4ZA 3RUGA 3VE0B 4WU7B 2DQDL 4X6CF 3S5LA 2UUDH 2VDOH 3EOYG 3MJ7B 1U93A 2XWTA 4KJWD 5E8DH 3FUKA 3WXWL 4AK2A 2ZXCA 4X4XB 4NQUA 4X80L 1MCWM 1SHWA 2V7HB 4HIEA 1ZANL 3EOBB 3FH7A 3P40A 4M48L 1P7KB 1VJSA 3A4EA 2NR6C 2Q6WA 1M1SA 4PRHA 3TWYA 4GKSB 4O58H 4L0PB 3VMOA 1FVCB 3WNIA 2CA4A 4JRYA 4PTTA 2NZ9D 1NC2A 5L8JB 3RZCA 4TVUA 2X6VA 2KZWA 4UNIA 3QI9B 2GT9A 3EFFA 5I16A 5B1JA 1VDGA 2J56A 2AZUA 2BM3A 2BX5A 4MJ5A 5GGUB 4IOSD 3A6BH 5CJ5A 1YN7A 2MNWA 3B5HA 3D7PA 4CSTA 2DQCH 1KENL 3MAWA 2H1PH 2ZX9A 1BLIA 3C6LA 3ESUF 1TR7A 1R9FA 1AO7D 2Z35A 1BXXA 3NSYA 4XCFH 4JFSA 2DI7A 1W0YT 2V3DA 3HE6C 4FABH 3T1WA 3BGAA 1JK9A 5ALCH 1XL4A 2BIMA 4PJBF 4R3SA 4YSRA 2WIIA 4YHIB 3VXUE 1AZCA 1N8ZA 4NN6B 4DCQB 4J3SA 1S9WA 2ZOUA 5FM8A 1Q94B 3KBEA 5DRWB 5DS8A 2FEJA 3FO9B 3T0DA 5BS0B 1H6TA 3RHWF 5E00A 1PLGL 3OJ2C 5T1DL 2ICWI 2ZUQC 4E41A 1RMFL 1QLEB 3ULVH 3IT8D 2GCYB 3X1FA 3ZTNH 1E5UI 1F6FB 3P11L 5F7FA 1AQDA 2P28B 3L5JA 2JFCA 2GJ6B 3UMNA 1ORSA 4L1DA 4BKSC 4ONHA 3TBWB 4XH2B 2CUHA 4KO5A 3GZOA 3E6FB 4XVOA 1ILSA 4OGXL 3OJDB 2WWMC 5C0BD 3WMSA 3QEHB 5HGDA 1S5HA 4ZW6A 3QIWB 1KY7A 1NCHA 3DSFH 1E5AA 2ZXDA 3PHAA 4PGBB 2PETA 3TPUA 3S2AA 3AB0C 3SPJA 2G9KA 1HHHA 3FN0L 3L7FA 1JZEA 1NM4A 3CLEL 2HSIA 1OAUL 1M2VB 1U33A 3AXHA 3MO1A 1YEEH 4XPFL 4Y16A 1T1XB 2ESVB 3QUYA 3VFRB 4PJDF 3CDFA 1ZGLM 3QUMH 4CJ1A 1WCQA 1GGCH 4MNQA 2PR9A 1LWJA 1P1ZA 2P8MA 2VSDA 3CHXA 3NEXA 4FZ8H 4ONFH 4RAUA 4XBEL 3TF4A 3IDNB 4LHJB 4X5LA 1VFMA 4Y5YC 1JGEA 5AOJA 4LF3A 4JBSA 3AQZA 5LXGH 4Z8FL 1R3KB 2DQ6A 1INEL 1FVDA 1ZPLA 3T4AA 4NI6A 3OB0H 2MIZA 4QT5B 4QYOA 1S5IH 5F9OL 5CBEB 3UO1L 3DUUB 5I1CH 1ASOA 4WSGA 4EN2A 4FI7A 3MJ8A 4ZT1A 3KHOA 2YWZA 1KLUA 4BFNA 5C8JB 3JUZA 4E42B 1KYAA 3HZMA 2C1OA 1S7SB 1F4XH 2A6KA 3CMOH 2Y5QA 5LNDA 5MHSD 3KWWB 1GZHA 5L4IA 3R7RA 3N9GH 5D7JC 1IFRA 4GG8A 4MAYD 3Q6GL 1YQVH 3IB4A 2ODHA 1DQJB 3QXAB 1RZPA 4XNBA 4E9RA 4K71C 5MP6H 4JO8A 4YXLH 1M7IA 3PXLA 3KLLA 4K94L 4IRSC 4KUZH 3HRZB 3T3PF 4PV8B 2Y1AA 4NUGH 3HUJF 4QHPA 2V2TB 4F8TA 4I18C 1C16B 1Q72H 2X4NA 2ICWA 4Q52A 3GGWA 5CEZH 5KOVC 4X7FC 4HSQA 5GHWH 4R26H 1G7QA 1EWHA 1U8JA 2D7NA 4I88A 1NAMH 3EO1B 3SPHA 1FZJA 4ZMYA 2JH2A 1DVUA 5T3XE 2F58L 2XX1A 3LIZA 2Y7MA 1NIDA 4QNPE 2N3JA 5FFOA 4IOSA 5FHBH 3GSXB 8FABA 2ZUYA 1JZJA 2H3NB 1E5YA 1OCWL 1NZRA 2F7IA 3FQWB 4I0PC 4ZYKA 1AO7A 3ILQC 5DMIL 3TWCL 1W6LA 4FKHA 1A6TA 4W1TA 5FUOL 1T89A 3P0YL 2R29L 2MEJB 4QTIH 5IB3A 1TZGL 4U3SB 4NDMB 2NLJA 4G8AC 3SE9H 4ICXA 4BJLA 4V1DD 3NZHL 1OV8A 4CN1A 1SYSA 3UZEA 3CX5K 4RRPA 2JK5A 2PUQT 1K8IA 2F8OA 3DX6A 3D3VE 3MGTA 3DX8A 3UBHA 3VO0A 2IH8A 2Z4QA 4OCXL 1ZSDB 5EOQL 1MCRA 3BT2H 1JNNH 1A7PH 4FHBD 3VWKD 2P7TB 3X3GH 4HJ0C 1UKSA 4AW7A 1MFCH 5GS2H 4J2XA 2A77H 3F8UB 1AGEB 1QRNB 4JREC 1JVLA 1U8OB 2KI6A 4G82A 5C2UB 4IRZH 1TVBB 2GYSA 2NUTB 3AG4B 5FO7B 5ITFA 2XZZA 3L1FA 4E9YA 5IHHA 1PSKL 3EH1A 2AKRA 2RCSH 3LKRB 3QAZC 3V7AG 1R3HA 1Y6KR 2HXAA 3KCWA 3ESNA 4UF7C 1KTDA 3NCYP 4ADIA 1GHFL 1RPQA 1FH2A 5C0BA 3O9WD 3DX9A 3WNNA 2IMNA 2OULB 2ZNWA 4Y9CA 3X13B 2YRLA 5IMOB 1A47A 5I71B 1T21B 4FYQA 3VQMA 4HJSA 4JKPH 3GMRB 1RXLA 1DQLH 3BIBX 5BVPH 4I9XA 1F86A 4CDHA 4WSJA 1OTSC 2WTPA 4KXCA 5KS9E 1JMXA 5JMOC 1T83A 4XMPL 1J8HE 3MZTA 2P5EE 2VDMB 3KDPB 3IDXH 5D70L 4M3JA 3LKSB 3OLGA 4HKJB 1R47A 1B6DA 4J1UB 5FAAA 4GG6F 2NY3C 3HLAA 2DM4A 5C6TL 1ZT7A 2Z8VC 2ZCKH 5F1OB 5KSBB 1DJYA 4QMEA 5CJQL 5CLWA 4RMRA 3IAPA 4UTAL 3RL2A 3LSOA 4AEFA 4DP1X 4F24A 1OF2A 3OAZH 1HEHC 3QIBD 2BY0A 3LH8A 4HUKB 5FK9A 5HDQH 2QGBA 3OV6A 3T04D 4Q9QH 5IFJA 4I1NB 4PBXA 3SD2A 2GBTA 4JRXE 1T20B 1Y18B 2YAQA 3VWJD 3LQAH 1JDAA 4M9OA 3U9PL 1U8MA 3RA7H 1RULL 2ERJC 5DVNA 1FRGL 3KYMA 5FO9B 3U7YH 1HSBA 5EOCH 5DZNA 4MAYA 1ZHKB 4ZPTA 3QVAA 4YE4L 2J21A 1IC5L 1BQHA 3D0LA 4WW2B 2G5RA 4JLRB 2X3BA 3ZO0A 5IW1B 3HB3C 2NY4B 5IMMB 1T1WB 4PJFB 4M1GH 4NQTA 3W0WD 3UGXA 4JO4H 2C3VB 5BV7H 5I9QB 1HL8A 2HFGH 1F58H 3L3HA 3HPJA 3HW7A 3Q8BA 1SXCA 5CZXC 1BVKA 4F15B 4PREA 1A7RH 2HX8A 3NAAL 5BZDA 2W0PA 1F2QA 4P2YA 5CHNA 2XG5B 3O2DL 2QQKL 1SFHA 2E0PA 3G6JA 4FLSA 1AI1H 5TGBB 5ERWA 5I26A 1CTMA 1G87A 2YUXA 2HFEB 4BD4A 2VRAA 1EEQA 1EFQA 3Q2NA 4Q9RH 1JERA 5BOPA 1CUOA 3MGOA 3QK0A 2ORBH 1K5WA 3Q8CA 3KPRD 5H37G 4ELMB 2WN2A 2AJVL 1AGDA 2ZWNA 5BVJB 2JCCB 3DLQR 3QZLA 4WTXA 3T0EB 5J9PB 5DURB 3TT1H 3U25A 2XA8H 2VSMB 2Z34A 4V1DA 5J1SC 3NJMA 1QUNB 2FLMA 1RZGA 2Z91A 3M7FB 2FR4A 3CXHK 5A6MA 3I02B 3NZUA 5LQBH 4FTVB 3V79C 1YMHA 2WTRA 4NN6C 3GSVA 5L2KE 2NY5L 4IKKA 3VWKA 4CGTA 4TSAL 3DO7B 1A3LH 1FIGH 5I5JA 1Y1DA 1HYRC 3FBKA 5LHDA 2OSYA 1OD9A 3T0VA 4KJYA 2A74A 3GBNL 3HIZA 3G6DH 3MC0A 2YZ1A 5D7IE 2ZG3A 4ZDHA 2VR9A 1ZE3H 2A5UA 2ZXBA 5FYJD 3B1UA 2XZQL 4GKNB 1P4IL 1JXFA 3O9WA 4DGVH 4QY8B 1F45A 2H45A 2XBTA 3T6ZA 4DESA 5C2BH 2SEBA 1U8QB 4LOVA 2DBLH 3WHE0 5IB1B 2UWEF 2X5PA 3C09C 1A8ZA 1OWWA 3H6JA 3NFPA 3AUWB 1F4YL 3POHA 3QIWC 4X9HA 4H8PA 4NNXA 2FRGP 4RGNB 3STLA 2ZUSA 3V4VH 3WUZA 2AQ3A 3U6XA 4XMWA 2A9NH 2PW2A 5LB1A 1GH7A 1NCUA 3KXFB 1CXFA 5EN2A 4M5ZL 3TO4B 3ZZ1A 4LOEA 5C0CE 1AGCB 3BISA 5HPOA 1GYUA 3Q2CA 3N0PB 2Z64C 2QQLL 3ZDXB 3LEYH 2VDQH 5HJBA 5KZCD 4FQJL 3UTTD 3ETSA 4NQVB 5JO5B 1OTUC 4DGIH 5KBMA 4BWWA 3CSPA 3QIBA 1C1EL 5G2NA 3X1GA 1F6AA 3HI5H 1FZMB 1CYXA 1JUFA 1CXKA 1QSFE 5KBPA 4F27A 3QWOB 2XJKA 4IW4C 1S9VB 2W07A 4Z7UF 5JLZB 3RPIA 3VWJA 2FJSA 1JYVA 2CG9X 1CFBA 2X4QB 2XXMB 4M3KB 1QI5A 4BKTC 3L8QA 1A02N 2D7TL 1BZ8A 4RDQG 5EZOH 4XX5A 1BIIB 1ZD6A 3MRGA 5FDWA 3FT3B 3AU1A 3OSKA 4QOKE 1AXSB 3W39B 3RUGF 5IHZB 2FT6A 3W0WA 1WA0X 1P5UA 2Z8SA 1JZHA 4BZ2H 4EDXB 1CE6A 1XAUA 5JNYB 4FRWA 4ZFQA 2EDMA 2IGFL 3K81A 5EUKA 3HRZC 3SKMA 4TN9A 1HYSD 2H32A 5E1AB 5ELIA 1T04B 5GZOC 1CDYA 3V4PL 5L8LB 3ZKSD 3HJ0A 2XWJB 1NMAH 2ADJA 3HG3A 3O45A 4NC0B 4FFYA 1OVZA 3CX5J 4WJ5B 5C09E 1L9NA 3OLDA 3EYQC 3ROLB 1UA6L 2AVFA 2V5YA 5FGCB 2DIAA 1TQCC 4KI1A 5AALA 1S7WB 2R56H 3KPRA 4PWEA 3WS3B 3OKDB 2WSKA 1A7BA 3NACH 1DSFH 5E08L 1DBBL 1PY0A 5F93C 2LAAA 3H53A 1EEZA 2XTJB 3L5XL 5AWNL 5KVMC 3H4FA 5F3FA 3LZFL 3OKMB 1WAAE 5D2NA 1M7DA 1ZXQA 1Q90A 2X2IA 3P9MA 2AJYH 5TF1L 2BSRA 4RGOH 4HC1L 4XVTH 3ZTJG 2RMNA 2DIBA 3RVXD 3QQXA 1E6JH 5DZPA 2E7DA 3HKZA 4Y1SA 5C08B 3W3BA 4BE6A 5FPIA 3UO8B 3CN2A 4HWBA 1UHVA 1GGBH 2VWEE 1OB0A 1KGJA 4KFMA 3OKLB 2Q2LA 5B3JF 1WVZA 4GNKB 4MXVF 2H41A 3NCBB 4NKMA 4F37F 1TZIA 3NUKA 4ZUWA 1BBDH 2GKIA 1WPCA 4RETB 4GIAA 4XRCA 5KVEL 4OLYH 2WQVA 4PBWD 2H2PD 2R4SL 4JRWA 5IR1B 1OOAA 3WEBA 5A3ID 2JXMA 1U2HA 1MJJA 1OPGH 3QQ9D 2B1HL 1NCNA 1NA8A 2E76C 2R4RH 3BN9C 3ES6A 3MYZA 4RIRA 5AD0A 1SHXA 4FAAB 1CFMA 4K2UL 3RDTB 3IBOA 4G5AA 4WFHE 4P5KA 2C9AA 1VACB 4PFEA 1ZT1B 2VUOA 5AVYB 2ZE0A 1A25A 1BBJB 4PGEA 4JQXC 5D6CA 1VA9A 4UUJB 4Q2ZB 5I71C 3H42L 4KJQC 3NIDB 3N44B 2EEFA 3SKJL 3ARQA 3PL6D 1IAII 4H44C 1ZGLB 4IKLA 1SMDA 3D4YA 2TRYA 3LHAA 3L17A 4PWGA 5TDPB 3SCMD 2FJGA 1HEZA 2BW5A 1BFTA 3RGVD 2MQCA 3GPSA 3UC0H 3CZJA 4J4PC 4DKEL 4N9GB 3UTTA 1E4XL 3HNVH 4BFRA 2VZ1A 4PJEB 5E2VL 3EOTH 3FHQA 4JFDB 4O58L 5JXED 3K5RA 1X9RA 3H3KA 1PQZB 2EVJA 1T5WA 4PJDE 3G5YB 1SF3A 4XNUH 1AG6A 4FI6A 5HHMB 1Q9LA 4GRMB 2FWUA 3NCJH 1A8JH 1UZ8A 2XXCB 1EAPB 3GXUB 4MQ7A 3IJSA 1YNKL 4FX5A 3QFJE 2VMCA 1WEJH 5DMKA 5H8DA 4P2RE 4NPJA 3TT3H 1GW0A 4N1CA 2V6HA 4Z7AA 4XCFL 4IBQA 4N5ED 3VDAA 3BQUB 5D96B 3P54A 3QDGE 1X5XA 1O7VA 3KPNA 3P4NA 4OI7A 1MFAH 4Y8AA 2WD0A 1N19A 2IADB 3BW9A 1N64L 2DQFA 3W82A 3F64A 4LGPB 1S9YA 4WW2C 5E5LA 4DERA 4NKOB 2G2RA 1FFPB 1YDPA 2C5DC 1SDDA 1UZGA 4Q4IA 2WLLA 3MRNB 4XODA 5AW8B 4ZFOB 3B7TA 3MACL 4I9WD 4Y2NA 3GTNA 4ZBJA 4M5TA 4LEXL 4XP6H 1R5VA 4BUHA 3ULVL 1L6PA 2X9XA 1RZ7L 4F15C 5AKVA 2EO1A 5KSAC 4AIXA 4BFOA 3U9UA 1FH5H 3C8HA 3RWCB 3WL9B 4GMSH 3CC5B 2YPKB 3CXHJ 5D72H 4L48A 5IOPA 3T2NH 1IQWL 5DRNB 3INOA 1FNSH 2X1XR 2O61B 4HWUA 4BZ1L 3KG5A 3GSNB 2JJUA 1FV1A 4HH8A 5FW6A 3D1MC 3IJYA 4YBHA 1UXSA 2AQRA 3TV8A 1HVXA 2P80D 35C8L 1E4KA 3GSUA 4HF5H 2HPOA 2XQYG 3IRPX 2Y5TA 4MXWH 3T0EC 5IVOA 5CN1A 1JHTB 4YIQB 4L9LA 1EGJH 3A24A 3CVIH 4KMTL 1JGUH 4X7CC 1E6OL 2L7EA 4NB7A 1OZTG 4PG9A 2DQIH 1WWAX 1PIFA 1MCSA 2CLVA 2AXGB 1LMIA 3SE4A 2H3XC 4RMSA 2A9MH 1Z66A 3V55A 4XN1A 4P46B 3V5KA 2WXKA 1V7NL 5BZZA 5DC9B 1EJOH 6CGTA 4JHZA 1EQWA 1FJ1A 3B8SA 1VFAB 2NW3A 1MJUL 4M1DL 3LV3B 3QISA 4N2KA 1WJ3A 2IOMA 5ESQA 5TF0A 3IMWA 3VGEA 4JM4H 1X5KA 1N5AA 4P9MH 5CFHA 2AQPA 3ZZSA 2EIMB 3ILPA 2DYPB 5ETUA 3U30C 4KZDH 4X8GA 3QUZA 3QUGA 1AFVH 1HH9B 1MI5D 4HIXL 2OMNA 4IU2A 3S5ZA 1IC0A 3PWJA 1IL1A 1X3DA 2WY3B 3QBTB 5IB5B 1QLFB 4XNXL 2P46B 4Z95H 1VLXA 1F4XL 4HXAL 1MAJA 4PI0A 3RI5K 2ZAGA 3S3CB 4M6OH 1CGUA 1XT5A 3FH5A 3B5GA 2YRZA 3FB5B 3PL6A 1WFJA 25C8L 3D69A 5HHNB 1J11A 3FTYA 3JT0A 2XFXA 4X5RA 4AYID 2Q3AA 4OLZH 1NBYB 2D31A 4PJ7A 3SCMA 2PCFA 3LNIA 3TBTB 3RGVA 3MZGB 3W5N