1SUJA

X-ray crystal structure of ambystoma tigrinum cone arrestin
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
370
structure length
363
Chain Sequence
b'SKVYKKTCPNAKLSIYLGKRDFVDHVEHVEPVDGVVLIDPEYLKDRKVFVTLTCAFRYGRDDLDLIGMSFRKDLYSLATQVYPPETKEPLTPLQEKLMKKLGAHAYPFCFKMGTNLPCSVTLQPGPDDTGKSCGVDFEVKAFCAENLEEKIHKRNSVQLVIRKVQFAPANLGVAPKTEITRQFMLSDRPLHLEASLDKEIYYHGEPINVNVKINNTTGKIVKKIKIIVEQVTDVVLFSLDKYVKTVCAEETNDTVAANSTLSKTFSVTPMLANNREKRGLALDGKLKHEDTNLASTTVIRPGMDKEVLGILVSYKVKVHLVVARGGILGDLTSSDVAVELPLTLMHPKPSDDIIIEEFARQKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cone arrestin
publication title Crystal structure of cone arrestin at 2.3A: evolution of receptor specificity.
pubmed doi rcsb
source organism Ambystoma tigrinum
molecule tags Signaling protein
total genus 71
structure length 363
sequence length 370
ec nomenclature
pdb deposition date 2004-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
A PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1sujA02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1sujA01
5F0MB 4J2QA 4JQIA 2R51A 1ZSHA 1SUJA 1AYRA 1CF1A 4ZRGA 4R7XA 3GD1C 4LL1A 3P2DA 5F0LB 3UGUA 4GEIA 4GEJA 4R7VA 5F0PB 3LHAA 2WTRA 5F0JB 3LH9A 1G4MA 4P2AA 3GC3A 3LH8A 2WTRB 4GFXA 4LL4A 3UGXA 1JSYA 2FAUA 1G4RA
chains in the Genus database with same CATH superfamily
3GI9L 2VERA 4EQ3A 4QXTB 3WNLA 2F9BT 5IF0A 1TYRA 1ZXKA 3ARPA 2DWTA 2JB6A 3JZ7A 3PL6C 4XN9A 3SE9L 4BH7A 1QABA 3BJ91 4XPAL 4Z7WA 3B2PA 3U0TA 2ZT9C 2KZBA 5I0YA 4NN5C 3IJEA 2JWYA 2CHWA 3KEDA 4HJIA 1AO7A 4UQ3B 2KKQA 4NZFA 5L4JA 4R3SB 4ZI8A 1ZTMA 1AGEB 3FQUA 4LARH 4K7PL 1J05B 4M1CD 1J0YA 3L6FB 1TFHA 1IL1B 4NXKA 1MRDL 4LLDA 1Q1JH 2GK0A 2NR6C 3D33A 4CKVX 4JZJA 5GRJL 2X4OB 3LRSB 1KYDA 3ZJAA 3KJ4C 3WNOA 5DXWA 2A4CA 5C0FA 4ATTA 1KLFB 1TNMA 1OE3A 3N44F 3VD1A 2ZX6A 2DDQL 1P1VA 5IW3A 4A66A 1YEGL 3ULUH 1RI8A 1YC8A 1BVZA 4FTDA 4X8JA 4Z7AA 2GIYA 4NI6A 1CGSH 3EHBD 1CF8H 4M62L 4D9LL 1RLBA 5JORB 2E6PA 2HFTA 3KYMB 2VLRD 4U6VL 4WI2A 4G9DA 3ZUNC 1PZDA 4YSQA 5DUML 4UT7H 5CU9A 4DEUA 1T3FA 1I3RA 4L1TA 2VSKB 4P3CL 1A7OH 2IADB 1ZWIA 4QRPA 5CM1A 1SYSA 3CN2A 4LF3B 2YPKA 1E9PB 2AAVA 1GGTA 4LPTA 3MXWL 2Z8WC 3HZYA 1YQVH 2APXA 2CO6A 2DIAA 2H26B 5CUSL 2PCXA 4TLUA 4ETYA 3P0GB 1RJZA 1S3KH 1S7QB 3ZO9A 3AQXA 4WUUE 4Z5RA 4OKDA 4GH7B 5A3IC 1TZHB 1YPZF 1PDKA 3FUMA 4L1SA 5KYUA 3X1GA 4BSVA 3QI9C 5TGBA 1KFGA 3MACL 1K4DB 1RUAH 2YQBA 1TQCC 4I2XB 3P9WB 2GQHA 3HFMH 2NX5E 3CXHJ 5IMMA 1U8HB 3QULB 5I17B 5AB1A 5FOBB 3O3BB 1UENA 4QRRD 2A9BA 4L1LA 3FONB 1AXTL 3CDCA 4HU8A 3H53A 1BF2A 1G94A 1FYTE 1LQBC 5T5FH 1E28B 2WVVA 3APNA 3U0WH 1KTCA 1EGJH 2MPVA 3B3BA 3L4WA 3FTXA 2CO3A 2QTVA 3DTUB 3DRQA 1ZRUA 1GGIL 1ODUA 1E27A 3ARBC 3CSPA 3G6JE 4NQEE 2H6OA 3QDMB 4X6FB 4OQTL 2FSEA 3K6FA 5I8CA 2NLJB 2PWHA 1OAJA 4XOCA 3QUHA 3G5XB 4N2AA 4RWHA 5CMAB 4ZFZB 4OQTA 4G11A 4Q6IB 1CIDA 1WAEA 1JGVL 2A6DA 3L7FA 2F53A 3VXMD 1NFDB 3NG5A 5K1JA 1F4YL 3JV0A 3WJMB 4CN6A 5I2IA 5JNYA 2Y2WA 3K71B 1SJHB 3PPSA 1ONQA 3BC9A 1QSFB 4DUXA 5JPMB 4HFWA 4U1IA 4JDZA 3TWYA 1I7ZB 3AY4A 4UAHA 3LSOA 3AREA 4NN6B 4HG4K 1GYWA 3W57A 1J12A 1Z6JT 2OMVA 2WQRA 3MROB 3RDJA 3AGWA 4MD5A 1GW6A 4KI1A 4N0CC 4OGZA 1W91A 2J25A 4JM2F 2R4RL 3IF1B 1AGDA 3IXTB 5H37G 4NWUL 1BAFL 2XQYK 2DQTL 4Z7UA 1YEHH 2XPGA 3GNMH 3JTSA 4XMWA 4AQ1A 5CR8A 4X6DE 1CDUA 4BFKA 4HVBA 4OVVA 1JFQL 2WO3B 1QTPA 2OQJB 3IDJA 2VNCA 4YLBA 1P9MA 1QFUH 3F12A 2MPAL 4NHCH 4PLJC 2UVEA 5EPMB 3G6JF 1VIWA 1XF5B 1TETH 1OW0A 2NUPB 2Q7YA 3T65B 3FPXA 4GXUM 4L3FA 1U9KA 1PJ9A 43C9B 5FW8A 1KIQA 2ERJB 1RZJC 2ZWKA 4GINA 4LGPB 1II4E 2EDRA 3IEAA 4GAAA 1S7WA 4H8WC 3QE5A 1T7ZA 2MCG1 3S88L 3VW3L 3RWGA 3EH4B 1HCVA 1WTLA 4OKVA 4U6YB 5EO0A 5AW9B 3NH7L 1YLBB 1NCIA 3LIUA 3MLZH 3QFDA 2ICWA 2XYBA 2FWSA 4FLQA 4ZD3L 5DJ6A 3CX5J 2CGRL 4LP4A 5FUCE 5HHPB 3U7WH 2O5ZL 3R0NA 1N3NB 1JWUB 2EINB 4AGQA 2VO5A 4EOWL 4IDLA 3BAKA 3QCTH 5C6TL 1LE5A 1A4JA 5I6KA 4PRHE 4RA3A 5T1LA 1GGCH 3IMUA 3RKDC 4PB0H 4YDJB 5IEKB 2VDLL 3VYOA 2OKMA 3T0XA 1Z66A 3QRGL 4IJTA 3H2PA 5I1EH 1USQA 2CLRB 1CG9A 4UV4L 1E4JA 3FU7B 4KKBD 2ADFL 3BAWA 4Y2OB 5DQ9B 1ZVSB 2QKIC 4X4XB 1XGRA 4X6DF 5D7IB 1FSKB 2VDNH 2ZCLL 4JFFB 4QTIH 1V3JA 3ZT5A 3LEVL 4D0DB 5IOPA 4DP7X 4PGDA 3IMVA 1AS6A 4XPHL 3BKYH 1NQBA 3WJLC 4QXUL 3U2JA 2HKHH 4D9RD 4YLCA 4AEIH 2P4AB 3OSKA 2LFEA 3QVAA 2VLJB 1C16A 3RZWA 4E9TA 4MDJB 1CDGA 5BUAA 4R2GC 5FV1L 1WT5A 3U9WA 1KEGL 4AGNA 2R2EB 3GXIA 4YUEH 3HNVH 4UI2A 3WKNA 4G42A 4NZUH 3OZ9L 5DLML 5E5UB 3CSGA 3CFUA 3A3YB 1INQA 3RVTD 1MCKA 1S7XA 2CCWA 2WBJB 2Z31C 1SEQL 4PM1A 1DQIA 2MOVA 4E9YA 3TX4A 4AV5A 3QFJE 4Q97A 4N0FA 1L9RA 2MWCA 4N2NA 3IJ9A 4OLEA 1YNTF 3VXSB 3E9TA 4OLUH 4GUOA 4OZHA 2X9XA 1DFBL 1YECH 2P47B 2Q10A 4URKA 4FEIA 5C86A 3E7JA 3PE9A 4KX8A 1HSBA 1Q1PA 5EEZA 4KJPC 3D85B 3SKNB 5IW1A 3IGKA 5DR5H 1KB9K 3FULA 4K9EC 3MC0A 3L3DB 3QJFB 3QHZH 5KUKA 1E40A 4ZS7L 2VMJA 3L3GA 3D30A 2K4WA 1Q94B 5AW1B 1NCCL 4DGVL 1WFJA 1IBBA 2QADC 3ZKMC 1U4FA 2AQSA 1G7JA 3KPOB 3OKLA 1TDQA 3L3OC 2GKIA 2Y0SA 3WLWC 2W1NA 3MCG1 3MLRH 1YYLL 1PY9A 5IMOA 1E6JL 1G0XA 3FU5A 3OMZA 4HJGA 4OCXL 2W0KA 4H25B 3O6FC 4OLVL 2Q2LA 4K3DH 3QIWA 5DCCA 1QRKA 3TPUB 4P2QD 1MHHA 1MI5B 4OJFH 4CVWA 2EYSB 4X4ZA 2IQ9L 1TQUA 2K78A 3BXNA 3FT4A 3JXAA 4NCC1 3WY2A 5JMRA 3GBLA 2C4FT 3EGXB 1WWCA 3GGWB 2YPVH 5KG9A 1N4XH 1XF1A 3FRPB 2C9PA 1N12A 5AZEL 3E6FA 4AYGA 3UJIH 2GG1A 3WAKA 1YJDL 5LBVA 3RY4A 1BG9A 1Z9MA 4XXWC 1EEZA 1U3HD 4EIZC 4IKIA 2FJGA 4HD9A 3R18A 3FQXA 4Y9FA 4F33B 5DVOA 3SGJC 5I0XA 2R4SH 3QO1A 5CJQL 2L8AA 3LQZA 1XCQB 1HHKB 3O2DH 2C1OB 3ILPB 2FEDC 5FXCH 1MCWW 1OWWA 4BFNA 5BV7L 5C7XL 4MAUH 5GPRA 1MRFL 2VDNB 3DMMB 3CVIL 1AGFB 1BAWA 2UY7B 3FQNA 1NPUA 3NFSL 4GSUA 6PAZA 3W9DA 1AZCA 2NXZC 1CFTB 2P7TB 5CP7B 3MV8A 1IEAB 1NBVL 3UBHA 5BRZB 5HGHB 2JJUA 3FFDA 4XVSL 2H0EA 4LCYB 3LVTA 4JO8A 2FBRA 4FA7B 2WAQA 3CPLA 1ICTA 4WAFA 3OGOE 2P5WA 4QRQB 4GAYA 1YG9A 1L3WA 3OJMB 5C0BB 4AL8L 1RV6X 2H8PB 3S3CB 4RMVA 1GH7A 5MENB 4Z3IA 3S4SG 5BVPH 4YHPA 1O6VA 2V37A 2FZ3A 3O2VH 2YRBA 4I3GA 4EI5B 4M1CC 5CKAA 4C4KO 3TU6A 4MCZA 1UOVA 4GO6B 3FKUS 4R4FH 1OLLA 3IJYB 2NY0D 3WBDA 5E6IB 4JQIL 1PLGH 4ZFOL 3BUDA 1PL3A 1I1AB 3NEOA 1FGNH 4QOKA 1A3QA 2CRYA 4JQIA 2AGJL 1X7QA 2D3JA 4ZFOA 3NSDA 1AY1L 2H1XA 3KGRA 1T5WA 3MREB 3KXFA 1MHEB 1QO3B 4LHUG 5I73C 4FA6A 5HDRA 4FNSA 1BV8A 4AK1A 5DC0A 5LGJA 4N87A 3OGCA 1LVEA 1SVCP 5HYSA 3EYVB 4AE1A 4I4WB 1CQKA 2IBZX 2GY5A 5CN1A 3MRGA 4P2OA 4MJ6B 4J4PD 3EHBC 3NRPA 2XVLA 4ENED 4F93B 3QJOA 2I5YL 1P5UA 3MRRA 2P52A 4FQLH 4FDWA 4RX4A 3BIBX 5JW5A 4JFFD 3K8MA 5IKCB 2CO2A 4OCMC 3STZA 1SOSA 1H5BA 4UQDA 4Y89A 3EG9B 4WEUD 3OKNA 5KJ7E 4JPSA 5KEZA 2VLKD 3OB8A 1DQJB 2X1XR 3L9RB 5C97A 1MW0A 3KGSA 4HJTA 5ID0B 3HHMA 4X98A 4XB7A 1JTOA 2VLJD 4JRWA 1F13A 1DSWA 2XY2A 4JGNA 1M6UA 4OBRA 5FUZH 5IQMA 5L2KE 1P84K 2HSIA 1IAII 3ZLQC 4N8CH 3AWFA 5KYYA 1VFOA 5BQ7B 4YL9A 3OAYH 4QAWA 2BZCA 4FXGC 2A1WH 2LLLA 4PR5B 1W6WA 1SXBA 4R7NB 3VWJA 3ZT6A 2D8KA 4CW1B 1A47A 3QPXL 3R06A 3VXSD 1GJWA 3IJSB 5HYQB 1AKJA 1TQSA 2CUIA 2HPTA 3LKRA 2A9MH 3FUKA 4JEGB 5LN4A 2C4XA 3VGGA 2X6CA 2OPCA 3HN3A 1U58A 3NCFB 3GI9H 1ZV9A 3DO7B 1VSCA 4S2SB 2X7LB 5DVNA 2R8SL 3FL7A 4P2RD 3FQTB 3PAUA 2GUOA 1QPPA 4XPAH 2BSCA 2PWEA 2XN9B 3RA7L 1IBGL 3P77B 5EUOB 2VDQL 2VN3A 3DURA 3IYLW 3VFTB 4A7QA 3ARWA 2XXMB 4QI3A 1BZ9A 4F7PB 3CN0A 4E41A 4K7PH 1QP1A 4QPEA 4XCNB 1TEGA 3R0MA 2ZXQA 5K9OB 3F7RA 5IVZA 1MI5D 4QHMA 5ID1B 4NZTH 1N8ZB 1XIWA 1RUKH 1W9XA 4RNRA 3T4YA 4HUCA 3LRGA 2WD0A 3RPKA 3SE4A 3ZDZB 4AUJA 3WJJA 5IQ9B 1NFIB 2NY4C 3CLWA 4Y2NA 2K6WA 3U83A 5BW7C 3ZR6A 3PAYA 4PMFA 4AENB 4NQDB 2DDQH 1MLCA 5FF6A 3I75A 5DJCB 4PJ7B 5C0CB 3DUUA 4PJDB 4YH6A 1NGPL 1DJSA 4IGBA 1H19A 3UDWA 4UANA 1I7UA 2C8NA 5DHXB 1X5GA 5IB3B 5KVEL 2MSPA 1BW8A 3KGUA 3I84A 4U6VH 5B38A 5K39B 3B9VA 1OCRB 1S78C 5DUMH 1B2WH 3GSQA 3OKDA 4P3CH 1MVYA 5SWZE 4LCWE 1KPUA 5D2NC 3VFWA 4YN3A 4MTMA 4HGWA 3QQDA 1Y7VA 1PD6A 3DMMD 3EFFB 3LPPA 4YHNA 3PHAA 3WV0A 1LEKA 4H8UA 3A4FA 4MNHB 1VACA 3UAEA 2RFXA 1ET8A 1FO0B 4M8QA 4OGAD 1LK2B 2ZX9A 1AIZA 5T3ZE 4TN9A 5GGQH 3UTSB 3MACH 1BGXL 5DO2D 2IAMC 3IFOA 3B83A 3OV6A 2AF2A 4W4NA 4UQBA 2WWKO 3UBXB 5E08H 3MRJA 1HEZB 2OI9B 5KTEL 1AXTH 3QG7H 5MEND 4J8RB 2HRGA 4DP1X 1GGYA 3QQ4A 5JHDA 5DDHB 4KPHL 4HCRL 3RUGA 2P8MB 3GIVB 2C9SA 4XNMA 1FFQA 2H5UA 5E6ID 3MUGA 1NC4A 1ZHKB 1EHKB 1GGIH 1EHLL 1I1AD 5J4MA 2R0KL 4AH2A 5ISZB 1KCVL 2QVMA 4A55A 5TDNB 5IF0B 1SOQA 1XTLA 2JB6B 4L2LA 2XWRA 3IRZA 4C4BA 1QBLL 5DTFA 4YSUA 3EJQA 3NDYE 3WY1A 4KY1L 5CKGA 4BH7B 3BT0A 1M2VA 3BD4A 1JGVH 3FT1A 3IJEB 1AO7B 4UNUA 4UOW1 1F4YH 2GSIA 2V5YA 2A3TA 4Y5VB 3ZDYE 1YO4A 5IHWA 4Z7VE 2WQWA 2Z7YA 3FQUB 3KR3L 3MOBL 1MZZA 2PP8A 4LLDB 2GK0B 2BOCA 3BEVA 3GHEL 1XH1A 5CEYA 1GYUA 2F8IA 3VGBA 3BESR 1EK3A 1I1RA 2GHZA 2Z7WA 1LEGB 4TOYH 2JB5L 3B9DA 4Y1AA 5E8PA 3RVTC 3VX0A 5CLXA 4ZAKA 2R4RH 5ACLA 1JNJA 4LGSB 4AGPA 4O02L 1DANU 4NWUH 4AV0A 1RP9A 2DQTH 4IBZA 4PJ8B 1YEDA 4O02A 4PYHA 2W9LA 4Y1SA 3P3YA 4Q58C 4ZOAA 1QQDA 3KLLA 5CXPA 2PP7A 1MJUL 3ZRFC 2DAVA 5K59E 1W72L 1N2RB 2CR0A 2MPAH 1INEL 1T3FB 1I3RB 3U30B 4PH8A 1ZWIB 4Y19D 3ABMB 4ZW5A 2MMXA 5KN5A 2YPKB 1W72A 1TEFA 3VE0A 5DVKA 1J5HA 1A1NA 2YZ1A 3HZYB 4BZYA 1XR8B 4BHUI 1QATA 1RJZB 4HLZH 3BN9D 3ZDYF 3WTVA 4WEBL 4Z5RB 1IGJA 1R1CA 3NH7H 1PDKB 3QUXB 4XPTL 3C6LA 1I8LC 2XN9D 3ETBF 3OZLA 5TGBB 2NNFA 3SB3A 1SHMA 5TDPA 1B0WA 2O5ZH 3DIDA 3IE9A 3PG2A 4JO1L 4C8XA 3ARXA 3P3RA 5J8OA 4P07A 4YOKA 3CLEH 4EOWH 5IMMB 2HLAA 4FFZA 4A2FA 3C09B 3DI2B 3GTNA 1XWVA 1YEKH 1X6LA 2GBTA 4FZEL 3QRGH 2WVVB 3EOTH 3PWPE 3QUZC 1HZLA 5GRZA 3V6BR 5AVRB 3Q7JA 1S7RB 5I5JA 1U3HC 3DRQB 2BWIA 4TUUA 5GGSB 3OWRA 2YN5A 2B3IA 2FSEB 5I8CB 3QWRD 4L4VE 2ZCLH 3SOTA 5I1DA 2I9TA 3NTCL 5I71C 1AGBB 4FGMA 2BXYA 3RVVD 5K9JL 5K59F 4TRPH 4XPHH 3L7FB 3MVSA 1JXKA 2F53B 2YC1B 1D5ZA 3N5AA 1V27A 3MA9L 1J5CA 2MNWA 4PG2A 5JNYB 5I2IB 2VXSL 1R5WA 2PYEE 5E94A 1NGZA 1KN2H 4JS7A 4QO1A 4WNJA 4FTVB 4QD2E 1KEGH 4PRDA 3EYFB 4HFWB 2FTAA 4TL4A 4Y2DA 3A4DA 3SE3A 3V10A 3OZ9H 4V11A 4CC1A 1L0QA 1D6EB 2FO1A 1SEQH 4QDGA 2Q7NA 2OMVB 1FNGB 2XYCA 4M00A 4PRNA 1FG9C 4D7BA 1ZV2A 4MD5B 3TH2T 5T1KA 3EZ8A 1Z2KA 1DFBH 3QYCA 4HSQA 1NBCA 1AGDB 3O4OC 4U2YA 2HAZA 5ESQA 4Z7UB 3UTSD 2XPGB 2VUOA 2Q9OA 3VSTA 1ORSA 4GB9A 2NY0C 3IKKA 1T80A 1NSNL 2WXQA 3EO0B 4ZS7H 2QSQA 1EJOL 4DGVH 3F12B 4KMTL 2ADGA 3NYKA 1OZTG 2DTML 3NZ8B 3MV01 2VXTH 3AAZA 5F21B 4GP5B 1NLBH 3WD5L 3D50A 1F3RB 2H32H 3TO4A 3BP7A 1YYLH 4LU5L 2HJKA 3VCLA 1E6JH 1KIQB 3KWVA 3DPBA 5T3ZH 4OCXH 2WBKA 2P24B 2CCLA 2FNBA 4OLVH 5ESVA 5TF1L 2VWEE 3OAYK 4KROB 4IIQC 3ELQA 4OKVB 5EU7C 4ENEC 1GKOA 2IQ9H 2CPCA 3E6HB 4J6IA 3ZE1E 3B9KA 4ODWA 3QFDB 1ETA1 2ICWB 5DJ6B 3V0AC 3SQOL 3DVIA 5JIDA 1IZKA 4FYQA 2CNZA 1T21B 3DO4A 5AVTB 5B21A 1AO7D 4MA1C 4TQIA 2XACC 1LE5B 1I7TA 1HXMB 1A4JB 5AZEH 4ACPA 3DXAE 1CQYA 5T1LB 5DD0H 1H15A 1YJDH 5DGRA 3FAXA 1CWVA 5BNXD 4P49A 5JHAA 4TL5A 35C8H 2UXVA 3MJ8A 1J11A 5JO5A 8CGTA 2CBQA 2G2NA 3NP3A 1HQ4A 1ZLSL 3VH8A 3PABA 5C3LD 3UEQA 3SDXF 2WNGA 2BNRE 5HVHB 1RPUA 2HT4D 3NABL 1T6VN 4KMQA 3TNMB 1EANA 5BV7H 4N2CA 5IOPB 4PGDB 4OT1L 4U1MA 2NW2A 4OBSA 4AXWB 2G2PA 2CDFB 1SF5A 4TSBH 4FLSA 4XNZC 3ZTJG 1UB5B 5AZUA 5EA0L 4EF3A 4ZMZA 1C16B 1J88A 3QGVA 4FQCH 4Z3EA 1IC7L 1PAZA 2YRZA 4TQHA 5AB2A 3FZUD 3IE4A 2W59A 2NDFA 4PTTA 1TMQA 4XVSH 2YD1A 4KUZL 4QRPD 4MMZA 5I6XB 1ZD6A 4ZO8A 1UKSA 3ZE1F 3B2DC 5FYLE 2AEQH 1KXHA 1NCAH 3L5WA 5BRPA 1J9TA 2QQLL 3OL2A 3IS0X 4N0FB 5HI5C 2E7CA 4NYLB 4X9FA 3LZLA 1T83C 5B7EA 3ZDXE 1EEYA 4IK6A 1PX8A 2JJTC 1N64L 4FP8L 2WLIA 4KVCL 2ODHA 4JQIH 1MCDA 1P7KA 1S7UB 2IJ0C 2OTWA 4Q6YA 3GMMA 4D0DA 4E9XA 3REWA 3BUPA 3TCLA 4PB9L 4MMYA 2AGJH 3LXCA 5DHYA 4HH9B 2EDEA 3CZUB 3VI3A 1AY1H 2KMWA 3BUTA 4AC4A 3L3GB 1GHFL 1OD9A 5DVPA 4Z7QE 4FMKA 4M02A 1SLUA 3BVNA 5EO9A 1E5UI 3TZVB 3MX0A 3NIFF 3OKLB 4PJ9C 5SV3A 1SN0A 4DGIL 1C12A 3QDGE 1KTLB 3HZMA 4N2KA 4WKZB 3EOBA 3CFCH 4IKKA 5IMOB 4HJGB 4WK4B 4HHWA 2B4CC 4G6AD 4XN4A 2I5YH 1T20A 5F7UA 3QIWB 4I87A 5FYKU 2FGWH 4YHYC 2F68X 1MHHB 2QMJA 3UAJA 2AQ1A 2FLRT 5C0DB 2JKNA 3FT4B 3G9AB 3S35L 4F2MB 5CEZL 3TV3H 1A5FH 4JJ5A 5HDOA 1Z9LA 2FH6A 4PJFA 2F53D 3ARQA 2R1WA 5LN8A 1JZ3A 3BSHA 3EXJA 3QCUL 5BJTA 4CAGA 2EACA 3E6FB 4M56A 4N0YL 3SDYL 2Q6WA 4MJJA 1EERB 1UWEL 2E59A 2VQ1B 2WNXA 2YD3A 4JMXA 4OGAC 4DOHB 1S7VB 1MH5A 3ZDXF 4PJGA 4ZYKA 3FQXB 3V4LA 4GQ9L 4TQPA 5DJDB 3ARED 2GK2A 2OTPA 2VR8A 4WGVB 2R2BB 1ILSA 4L8SA 4OAWA 5E9DA 4CL7A 4OM0H 1UKQA 3QO1B 4XP5L 1MQ8A 3OPZL 3LQZB 3IT8D 4GSQA 3QPXH 3BWZA 3MUHL 3PUCA 4DPRA 1RAMA 2ZONA 2C34A 1T7YA 5B39A 1P4LA 3B7TA 4Z7QF 4OFYA 3QHTC 3VRJA 5BV7B 5SX4I 3LNFA 4ZMTA 4ODXA 3W9DB 5I0WA 4L8BA 3Q2NA 5F7KC 3ZYIA 5FB8A 5T1JA 3BZ4A 4KQ0A 3MV8B 4JR9L 1M7IA 3DX2A 4FQHA 3NFPA 4AVHA 4WFHD 3MMEA 3Q3GA 3P9MA 3RA7H 3FFDB 2EVFA 3BYYA 3T4AA 3RGVA 3J27A 3CPLB 4GQZA 2I24N 3TURA 4B0MB 4ALAC 2P5WB 2F0CA 1SJXA 2CO4A 2DQDL 3DUSA 2JIXB 3RY6C 1PEWA 1RIHH 3LDBB 4N2GA 4YHPB 3N04A 1GYAA 1A6WH 2FZ3B 3ZHLA 5C0AE 4H20H 4MCZB 4DKEL 4ONGH 4XBMA 4DVBB 2YOCA 3GUTA 3ME0A 4M6ML 2BS9A 1ZANH 4OR1A 4MVBD 2Z0UA 4P48A 4JE4B 1X7QB 4R83A 1Q9WA 5EEVA 4ZFOB 5CP3A 5IVNA 1T5WB 3AADB 3KBHE 5DZVA 5KJRL 1PVHA 2XXFA 5DRWA 4MB4A 1HL4A 5T1LD 3WY4A 5LGJB 1I9EA 1C08B 2C4FU 4LXFA 3V0DA 4YSCA 5F96L 1NGPH 1S5HB 2X87A 3DO3A 3LN4A 4O4YL 4LCUB 1XD0A 3MRGB 4PW4A 4G6ML 4BQ9A 4K2UL 4KKAC 4Z6AT 2JKIS 4HGMA 3S36X 3SO5A 2RBLA 3U2SB 5JW5B 2DWDA 2HRHA 1FDLL 5A2JH 3S3DB 4HS3A 4LK4A 4HALA 2F19H 1D5MB 3STZB 3U7YH 4AKPA 4HPHA 4FKEA 2DQGL 2UZPA 2X2JA 3JWOL 2A73A 3MQIA 2JLPA 1LDPL 3HBZA 3A23A 5DMKA 1TXKA 1U6AL 1L9OA 1CGYA 1NMAL 1RUQL 1UB6A 2WNWA 2EADA 1A64A 2AK4A 2B8OT 1A21A 4X5XA 1U8JB 4XXCC 2GJ6A 3BN9C 1BGXH 2DLEA 5CJXC 5D1ZI 2E3VA 2O6EA 4IMLA 4XPFL 3KPRE 3GXPA 1G7IB 3BPOC 3VWJB 5GRVK 3L9EA 3TFBA 1DN0A 3UBXI 2P8PB 2MCMA 4KPHH 4HCRH 4AJVA 4XMXA 2X42A 3OZKA 1AKJB 1O7SA 1JI1A 1YPZA 1T2QL 3LKRB 3POCA 1MEXH 3FFCE 3LNGA 3P30L 2VRKA 4L4JA 1EHLH 1RU9L 2BS71 2BSBA 1KGCE 4L1BA 2DY2A 3ZK0A 4EEEA 4X0KA 2XKNA 4FQXD 1MXDA 1IEHA 3D08A 4KY1H 2NDGA 1JHKL 1LO3L 2Y2TA 4LLYA 3WHE0 2M8XA 3VWKC 3DURB 3L3JB 4UDTA 3RVVC 5IQLA 3GHPA 1EO5A 1ZOXA 2VDQB 2KI6A 1DTUA 2VJ0A 3WUWG 2DL2A 4HZ1A 1JZ4A 4W4OC 4E41B 5AD0B 3KR3H 3MOBH 4IRSA 4N22A 2VUYA 2YGOA 1HILB 5GGVY 1PZUB 1MY5A 3BIAX 1DO5A 2FECL 2JKLA 3GHEH 2PCFA 3QIWD 5F70A 4JPKL 3FUEA 2WVTA 4KK5D 5E03A 2RAMA 4PREB 3WTXA 3QXWA 1NIDA 2I7OA 2VSMB 5DI8B 4RNRB 1EBAA 4ZW6A 5ICYB 2WNKA 4WCYL 2JB5H 1YCSA 2L7QA 2ZKYA 5IFHL 2APSA 1JZJA 5I6PA 4JPIA 3O8XA 2DD8L 1BEXA 2ZYSA 2EXWD 4K55A 3V4VA 4AVKA 4NRZA 1MLCB 5FF6B 3D07A 2PP9A 2QZ5A 3I75B 1PSKH 4B9IA 3ROLA 4H0IA 3QIBA 2J4WH 3BVTA 3CPUA 4GKSA 2J8HA 3G6AA 1KIPA 1BVLA 2VO8A 1A7NL 4IGBB 4OD2B 1MCEA 1SGKA 2ZXAA 3QEQB 4UOZA 2CLVB 4WUUA 4A7VA 1KV7A 5B38B 5GS1C 1FG2A 1MJUH 2V9TA 1W72H 4UM9A 1INEH 4H8PA 1RJCA 5FHAH 4MD0A 1KPUB 3K5SA 4KC3B 3VFWB 3QQDB 4H0GA 3PRZA 5BOJA 1FP5A 4XB3A 2H2SD 1FL5A 5EBMB 5CN2A 1BIIA 1FAIL 1BOYA 4KH2A 3AXHA 1BVOA 4X7SH 1VACB 2RFXB 4WEBH 4M8QB 3GSVA 4P59L 3VFUB 3VTAA 1ZA3A 1JNLH 3MV8D 4LEOA 3QRBA 4XPTH 4BINA 2ZKHH 2ESVA 3G6JA 4NQEA 1JZHA 3BGMB 4HKJB 4JO1H 4NQXA 4DP4X 4W9KC 3IFOB 1XV8A 2A99A 2P5WD 3ARDA 3DVFA 1F56A 3LZFL 5KVDE 4U05A 3LRKA 3WIFA 2F7PA 1P4BH 3GJEA 4Z95H 1TUPA 1OXYA 4WWOA 5JHDB 3QQ4B 1QBBA 3RUGB 5CBEA 4FN0A 5DJYB 2QV4A 4XNMB 2NY6B 3AQDA 3S4SB 5E51A 3MUGB 4JZJC 5EU4A 3CUPA 1NC4B 1TJHL 2V9QA 3DVGA 5AW2B 4AH2B 4QOKD 3OLEA 3ZKXB 4P2CG 4M1GH 1BQSA 5CCHE 3NTCH 1JK8B 5DTFB 3KXFD 3WTYA 1BMGA 3SYOA 4PHZA 5IIEB 5K9JH 3HS0A 1M2VB 5F9OH 4M3KB 1WS7A 2XA8L 2YMTA 3QNYA 3VYPA 3ZRCC 4EIUA 5I6OA 3MOAL 1DQDH 2VXSH 5AVUB 5IWLA 4P2OD 4XP9H 2X4SA 5E9AA 4K94H 4F57L 4M5ZL 1IQDA 2EKJA 2BOCB 3BEVB 3NRFA 2WYIA 4LSRL 1AHKA 1LL1A 4X6DA 5CEYB 3SEPA 4RX4D 1JMXA 2ZNXA 4HISA 4IS6B 3TWCL 1EXGA 4ZUUA 3FPYA 2AKRA 4RMRA 1OGTA 1UA6L 3TIDA 3T3ME 4B6ZA 5H35A 3DYOA 1M57B 2FO4A 5E8PB 1N18A 4ZAKB 4A2LA 1PFOA 2WYHA 4GBXA 4L1HA 5B7MA 3UPCA 1U41A 3EDJA 4DETA 3AY2A 3S2AA 3OMNB 1XGTB 2WBWB 3IPEA 4NSKA 1P5VA 2XU9A 1RURL 4L3EE 4O02B 2XDHA 1V5JA 1QQDB 1THAA 2APFA 4B41A 4J3TA 5T1DL 2FT7A 4UU9B 3GDBA 1EJOH 3ZYJA 3HG1E 3VFMA 5AL8A 4KMTH 2NW3A 1CB4A 3MRNA 5ETUA 3VWJD 4WW2A 4WTQA 3MYJA 1QNZL 1CK0L 5GHWL 5KN5B 1W72B 1YNTA 3VE0B 3WD5H 1QTSA 3D0LA 5BOZG 4LU5H 4GAGH 1AKJD 4HIXL 4JHWL 5DZLA 2J2ZA 5DD6B 4BGDA 5D1XE 4B95C 5KSAA 2CSPA 3KG5A 1G9HA 2J55A 5E5RB 2OXGB 4NKIL 1IGJB 2KLSA 3UAAA 4M8VA 2Z91A 3ZE2E 5BXFA 3SQOH 4JG9A 2X2IA 3QDAA 5EF1A 3EYQD 5D8JH 4GUQA 1FGVL 5E1AA 3CHPA 2ZUTA 4BKSC 2EC8A 4NZJA 1N26A 1A9VA 3IFPB 1QEXA 3DECA 3T3MF 3EXLA 3M8OL 4UT6L 3HUJE 3RG1C 4ZFFB 1MFAL 5FYJH 4BRJA 4CU8A 1HL8A 1CBVL 3MV11 3IRCA 4JREC 1URZA 1HH6A 3WE6A 1KELL 1WFMA 1QBML 2QVKA 1RXLA 1XIWD 1NGXA 3ZO0A 3MCKA 1ZLSH 1A4KB 3QQXA 3AREC 1ZE3H 3WIIL 2I9TB 1DVZA 2NY5L 4RRPM 1ID2A 4QHKI 1FH2A 4JDVA 1SXSA 3D48R 3SCMB 2JJVA 4OT1H 1NWOA 1OSPL 1AHWA 3CZLA 4RZCB 3RWHA 3QR0A 1E65A 1NAKL 4G82A 1U8NA 1SRDA 3GMNA 4WGWB 4BKLA 5LXVA 4IGBD 1R5WB 25C8H 2NY3B 3FOMB 4HIJA 5EA0H 3X1FA 1NGZB 3OMAB 3HZVA 4XI5D 4AQ1C 4APXA 4AZ8A 3NSYA 1YEIL 4PRDB 2E7LA 2NY2D 3QP3A 2ZSVA 3NT0A 3EJZC 1HAUA 4KUZH 2HFFA 3QC6X 1GXEA 1DSYA 1DUYA 3P54A 1P9MC 3QQ9D 5TDOB 2BY0A 3WIHL 1EEQA 4PWKA 2QQLH 4H1LH 1FNAA 2QFPA 3ZE2F 4M7ZB 4WJKB 3S34H 2MQ0A 5E6RB 3WIHA 4KITB 4WFED 1UTDA 3M1CA 4HF5L 3B7YA 1N64H 3ARGA 4FP8H 1BXAA 2ZAIA 4G7VL 2JKTM 4ZSOE 5DJZB 3W11D 5ESQB 1FNHA 3ZSSA 5I18L 5DHMC 3HUJF 1ORSB 4HUWB 4PB9H 3NRQA 4YHZL 3RFZA 1GHFH 1MKFA 4PJ5E 1M56B 4MVBC 2ADGB 1I8MA 4EQ2A 4OF5A 4QRUA 1QYGH 3AAZB 1T89A 1PAMA 4DGIH 3TO4B 2APWA 3VXUB 5JHDD 4F8TA 5CINL 4GIOA 3VCLB 1UH2A 3DPBB 2NY6D 4O5LL 1NC4D 1RH8A 4KK9D 5ESVB 4LPCA 2BVOA 3QT2A 2Y4SA 5CEZH 1WCQA 4TSAL 3NOIA 3GBML 3WOVA 4ANWA 5CWSA 3DBSA 4FHKA 1VFBA 2E76C 3CSYB 1I7TB 4D7PA 1QI5A 1H15B 2FEJA 4N0YH 4V1DA 1XH3A 5EU3A 1VZIA 2WXGA 1E2ZA 5J0BA 2HX7A 1OAUL 5C9JB 5JO5B 3FSOA 4HIIA 4NUQA 2ZSWA 1X5AA 2BNUA 4NERA 1HQ4B 2ORBL 4XP5H 1JOIA 3OPZH 4QHUB 2CA3A 5T3XH 4Y1AD 4FQJL 3VGEA 5JIMA 2YEZA 4ZAKD 3UBFA 3KDPB 1Q8MA 3PPEA 3TBSA 1RZGA 2W91A 2E56A 3E80A 4U1MB 2H6UA 2NW2B 4ICWA 4IBTA 2Q87A 4I13B 4ELMA 4JDEA 4F5CA 3F7YB 2FE0A 3A6BL 1BZDA 4JR9H 4LVEA 2EVHA 3RILA 1JVOA 4JRXA 4PTTB 1I8UA 4R6UA 4FQXC 2OYMA 4UTAL 1DBJL 4K3EL 4MMZB 2EE9A 4OZGB 3D09A 3A24A 4XPBL 2EDTA 3UL4A 1BM7A 4UTAA 4OD3L 5MEQA 3L5WB 3EYOB 1WHOA 2FQEA 5FA3B 3TASA 1U8LA 4X4ME 3T5WA 4H1LB 3QWOA 4DKEH 4UILL 1P7KB 2XC8A 2OTWB 3EJPA 2VW7A 3C6LD 3GMMB 3R19A 4IRJB 4M6MH 1T0PB 4MX7A 4KK5C 3REWB 2PMZA 4DFIA 1KC5L 4MMYB 1P69B 4MXVF 5EFIB 3RIFF 3A4AA 4OZ4A 1U92A 5KJRH 2EEAA 3BDXA 5A2KH 2GPZA 3N43F 3BRFA 5ABDE 3BVNB 1JNHA 2N01B 1NUNB 3MX0B 2EXWC 3MNZA 2NCEA 5F96H 4DQAA 1AI1H 5KS9E 1A6TA 4O4YH 1PTZA 3U2IA 5T8IA 5I16A 1QSEA 3ECBA 3UZEA 2XQBL 1LK3H 1O7VA 1T20B 1EO7A 2IANE 4DESA 1WITA 5DMIL 1BZQK 4RRPG 3GSOA 4Z0BL 1E6OL 2XTJE 2VXVH 3EJJX 4U6HB 1O9ZA 4JJ5B 4PJFB 2DQGH 3JWOH 1A7BA 1SQMA 1LDPH 3RIAF 2R1WB 3BKJL 4PCSA 1U6AH 5E8DL 1FHNA 1ZS2A 2H2SC 2E6JA 1NMAH 2C3VB 2NY3D 2BP3A 1HHGB 5BJTB 3N0AA 4RQQB 1ZHBA 5DS8A 3AXLB 2VRAA 5HHOA 1JHTB 3BQUB 5HXMA 2GBVA 3MJ9L 1N0LA 1C1EL 1X3DA 4DEPB 5M94B 3HOGA 1MH5B 2W60A 4JANA 3CNKA 1CFVH 3AT8A 4XNXL 3MJ9A 4Y2DD 4ZYKB 3RGBA 3IBEA 4LQ1A 5E9DB 4KUCD 3E9UA 4L8SB 4OAWB 4EE2A 3TS8A 4NJ9H 1JNNL 3K2MC 3VRLE 3BRGC 1OGAE 4U0RB 5AOIA 3MBXL 3BE1L 2CDGA 5DD5L 4TLKA 1FLRL 5T1KD 4YK4C 2RR3A 5HD8C 5B39B 1P4LB 2FQGA 4UIKH 3MTXA 5GIRA 2QGCA 3VRJB 4AL8C 1YNLH 1RUPL 4AITA 3B34A 2DI9A 3TBCA 5B3SB 1PKQB 1PIFA 2EECA 5I9QC 5KS9F 1BFSA 5FB8B 2WLMA 4FI7A 3BZ4B 4RGNE 1M7IB 4GRWB 3NFPB 5L8KB 4R7VA 1RZKC 4PJIB 2NSQA 3P9MB 2CKBH 2K1MA 1JHKH 1LO3H 2CLZA 3P4NB 5AYTA 5B4MD 3T0BA 3RGVB 3T4AB 2RA1A 4MYPA 3C08L 3LZPA 2EH7L 3KWTA 2C5DC 1V10A 1RZ8B 2V5TA 2WGXA 3PWNA 4LFHD 2NY1C 1IKFH 3E3QC 3GS0A 1VEMA 1KCKA 1JK9B 4P2OC 5F7LB 4EZMA 4UNVA 1UZ8B 2DQIH 4JPKH 1GTNA 1GZQA 3ATEA 1P5UC 4MS8D 3ME0B 5J12B 3B9KD 3GUTB 4WJG3 4N2IA 3B3IA 1W0VB 4WCYH 4JRLA 2VITA 1SJVA 4TUJA 1Q9WB 1OB0A 4LCWA 2UZXA 2LOEA 3WGUB 3LNIA 2OMUA 1H5BC 1ETZA 2DD8H 5DRWB 4P46C 3AFLA 4PGBA 3G5YA 5HPMB 3P4MA 3WELA 1FF5A 1IGTA 4NKOB 3WKMH 3QIUC 1NCBL 1RK7A 4H0LC 3S2CA 3BSZH 3LN4B 1A7NH 2ICEB 1A8ZA 1JXJA 1ASOA 2OYPA 3GZPA 5D7KD 4H8QA 3PIQA 1F86A 1ECYA 3K0WA 1XGYL 2DWDB 1UWYA 4X5PA 4HS3B 1C8PA 2WUCL 3ZMRA 3O3UN 1D5IH 2ZCKL 3DGDA 2A73B 4EUPG 3D5OF 5AW5B 1FAIH 4J3OD 1KENH 2QT6A 3WI9A 3PP4H 4LGRB 4GMSL 4P59H 2AK4B 1OWRM 5D1QE 4YIQA 5IBTL 1O75A 3ML9A 3QFGA 4L9LA 4BFBD 4IMLB 4BWWA 1IM9B 5FO9A 3GSWA 2X9YA 3PJSB 3GSNL 3GRWL 1PZ2A 4DWHA 5I1AA 1MREL 1GZPA 2ZOUA 4R9HA 2R69H 5HGDB 3WUZA 4ORGB 4DP5X 3GSNA 3GRWA 1NANH 1TFPA 1XCTA 1WBYA 2DM7A 5DRNA 5AENA 1CL7L 2LE9A 5F3FA 3ASWA 3PGDA 1YPZB 2YO3A 2TSAA 1E4HA 2F7QA 2ZJSH 4K15A 4AM0B 3LKPA 3S97C 1TJHH 1M71A 4C58B 1J10A 4QJ3B 4RAHA 4BQCA 1XIWC 2A9DA 3JT2A 4X0KB 2XKNB 3TEWA 3D9AH 3CIQA 4CADA 5ICXA 3EJCA 4RGMC 4QUOA 3L1OL 3SE4C 3N9GL 1XO8A 4LLYB 3WJJC 4IBLT 3NDZE 2M83A 3KPPB 5DUJA 1QG3A 3RFRA 5H4ZA 4QXGL 4HS8H 5DEGA 3MOAH 4FQQB 4NFBA 4AGOA 2IDUA 2VW6A 4H5SA 2DMHA 4IQHA 1A7RL 4NBXB 5E7BA 4AKQA 2XZAL 4IRSB 4F57H 4M5ZH 3C8KA 4HSCX 2DJMA 4LSRH 1IU1A 3SJVA 2TSBA 2J1XA 2OZ4L 4XI5C 1EEUA 4BK4A 5KVGH 4ZUVA 3UAJD 3TWCH 2NY2C 1P4IL 2PCPB 2OZ4A 5DQJA 2HTLD 4IOFC 1BQKA 3FDWA 3IJHA 3QQ9C 5MI0B 3VG9B 2B1HL 3BKMH 1N10A 1E8XA 4G71B 1I4FA 5EZIH 1V7MH 4Z18A 3VAEA 4PGJA 4GSRA 5I74C 3VXRA 4LB8A 3ROLB 3QIBB 3C8DA 3V5KA 1WZLA 1RURH 5EDXA 3L9BA 1WFTA 3W11C 1M9SA 1W6LA 4G5ZH 1E2VA 1FG2B 2BW5A 4NRXA 5T1DH 3UBGA 5IVXA 4UIMA 3D3VB 4JN1L 1E5AA 4UM9B 2B39A 3HPJA 5ALBL 4F92B 5LHDA 3LQAL 3TTSA 4Z76A 1QNZH 1CK0H 1MFMA 1SHXA 3LZQA 1AYRA 2XNAA 1DVFA 2WKGA 4MKTA 3GMPB 3JT0A 3IDYB 2I60L 1AXIB 4HIXH 2BVQA 4OFYD 3ILDA 1BIIB 3B8YA 4K3HA 2AJVL 3OAUL 3OD3A 3SBQA 2J8OA 2GW5A 4NKIH 3GSVB 1S9XA 4KK9C 1BF8A 2ESVB 3ZKXC 3RGVD 5F6IB 4NQXB 4L4VA 5DHVH 4NUPA 4AQEB 1UD2A 2BWQA 3WIFB 3IFNL 1FL6B 2ZKXA 4U31A 5F8RC 4YSOA 3VRIA 1AIFA 4L05A 1IAMA 4UT6H 1OAQL 5K9KB 4KKZA 1CBVH 1M4KA 3PAZA 2PYEA 1VKXA 5CBEB 3UX9B 1QBMH 1YAIA 4U1GC 4IEFB 3DVGB 2VDRL 4HWEL 5FUOL 3WIIH 3EJYD 4XGZA 2NY5H 3JWNE 3TBVB 5EDSA 3N42F 1EHXA 2D7QA 2PTVA 3MRHA 4WO4B 4XX1G 3W82A 3P02A 1OSPH 1L9MA 1GR7A 4IIZA 4Q2ZB 5GJSL 3X2QB 3VD0A 1O9WA 3OJDA 1NAKH 3ERXA 2W38A 4WNQB 4YR6A 2NYYD 2X2YA 4AQ8A 2WLHA 4U49A 4MJ5A 5T5NF 4ZO9A 1A0QL 4XN8A 2IBGA 1IQDB 1YEIH 4R96A 4J39A 1B3JA 5D72L 4FQIH 1L0YA 2G5UA 3SDXA 1FI8C 2ZIDA 1EDYA 4XNYL 3TJEL 3QG6A 1N70A 3QXDA 1JL8A 3ZRSA 3T1FA 2YGNA 5H35B 3SQBA 4NIYE 4U1SA 1MWAA 4CGUB 4IBVA 2FO4B 2AK1L 1RHFA 1MDAA 4YS4A 1ZT4B 3MRIA 4OFPA 4CBZA 4L1DA 3F6LA 5FO2A 4LLMA 4G7VH 2AK4D 5ABZA 3MOQA 4FOMA 4N8PA 3SYCA 3L5JA 4M4RA 1FORL 2GJ6D 1P5VB 1U8CA 5I18H 2VUKA 4W9CC 5E6ZA 4N0UE 3C6LC 1SDAB 5IROA 1UCTA 3WEBA 4FKKA 3FF7A 3VFMB 3FH7A 4S1SL 3ZU8A 4R5XA 4LCCA 5ETUB 2WCPA 4P5KA 4WW2B 2XPZA 3MYJB 5I75C 5HI4C 3L3HA 1BQHG 3PXLA 2HRPH 1TYJA 1IE5A 5CINH 3DXAA 2OR8A 4ODSL 4O5LH 2YIHA 1D5XA 4ODUB 4N1HB 3QJUB 4HBQA 5E7FA 4JFXB 4P4RB 5CHNA 4U33A 1IE4A 5A6LA 1CLVA 2JELH 2Z91B 4TSAH 4BH8B 1EAOA 3GBMH 4L5FE 3QXVA 4JFYA 2VMEA 1R3LB 3PXJA 3TEXA 3GXTA 5DZPA 3B1UA 3FUNA 3VDCA 1D7CA 3SKJL 4FNQA 4BM7A 5B8CC 4IRSD 4PG2C 5DJXA 5DYFA 5DEJA 4QTFA 4DN3L 4YSRA 2V5RA 2YAMA 1HH6B 3WE6B 2KUTA 1GC1L 5GRUH 1CDYA 4PY7A 4OZIE 1NGXB 4PV9A 5E23A 2D2OA 3MCKB 4Y2DC 5FYKL 1JZGA 2J57A 5FYLL 3GYRA 4PJXE 4OF0A 1E90A 3O8XD 3VO0A 4G43B 4JDVB 4LOEA 1EXUB 3FRUA 3Q9PA 3W5MA 3AITA 2W0FB 3QIBD 2ITDB 3GMNB 4BKLB 3O2WL 2ZQKA 4HIJB 3A6BH 3J07A 4WUUD 2QPDB 4AZ8B 2ZSVB 4UM9D 4JK0D 4QWWD 5AEAA 5LWYL 1ZK5A 2HFFB 4EKJA 1W2KT 4K3EH 1AVAA 4YSPA 3RNKA 2J1KA 1DUYB 4PGEA 2BDNL 1AAJA 1RULL 4BFEA 5AW7B 1OCCB 3DGGA 4H26A 1A4CA 1YVLA 2XZQL 3IMWA 4NBYB 4OD3H 4EI6A 5E00B 4DP8X 4IBYA 1QA9A 1FYTD 1YEFL 1QMUA 3QDGA 5HHMB 5MERB 1UT1A 5SWQA 5JLZA 1BBJA 3ARGB 1X44A 1J8HE 4G9FE 3VD3A 7FABL 2C9UA 1XGUA 3D39B 2ESVD 2VTFA 5A2AA 4NQED 1IB5A 4NO2B 3B9KC 5F3HA 4LRNL 4F2FA 3ARDD 4OZIF 2YWYA 1TCRA 4JY6A 1SMAA 1I8MB 2NNCA 4WTZG 3MZGB 3E2HC 4QRUB 4WHTA 2KBGA 4PJXF 2Q8BL 1SBSL 5B1AB 4AK2A 4NQCB 5FS5A 3RTQA 4QY8A 2EXYC 1QKZL 3TF4A 2XQBH 1OB1A 4WDIA 2ETWA 3QW9A 5HVWA 4MLIA 4KZEL 5DMIH 2ZE0A 1HVXA 4MAZA 3WNKA 4Z0BH 4ZDHA 1E6OH 3X1NA 2B77A 4X80L 4B7IA 1TQTA 4S10A 2P49B 1MCNA 1TTGA 3BO8B 4PI0A 4WTXA 3BKJH 3I6LE 3KWWA 4I1NB 5E8DH 5CWSB 5B22A 4CMHC 3KMDA 2EC9T 3WFCL 1VFBB 5GS0L 1LHZA 3ZX1A 2X4UA 1EZSA 2PNDA 4J3OC 2AHIA 3BYTA 2BVTA 5KVFL 3IGLA 3MJ9H 4I1PA 4V1DB 5EU3B 1C1EH 4W9LC 1WICA 1WF5A 3HI5H 2XICA 2VR5A 2WWMD 4XNXH 4HIIB 5BS0A 2J6EL 2BNUB 1EQWA 3E0GA 1C8QA 4KOBA 1IAKA 4M5YL 3NIGE 2DWXA 2J6EA 1OT4A 4I5BA 3LRMA 2JJSA 2YEZB 5DD5H 4OVUA 3GSRA 2VABB 1ET5A 2NZ9D 4GBXD 3TBSB 1A3ZA 1RZGB 4I18B 3D4YA 4JUSA 4YHKH 3H9YA 1RUPH 3GBNL 4ELMB 1ZTXE 4KFZC 3IU4L 5C0AA 3HPLA 1OCWL 1NGQL 1WA2X 4JRXB 4WU7B 3NEXA 4FQ2H 1U8PA 4LASL 2HFGL 5LDSA 3C08H 4PJBE 3P3UA 3OMIB 5F88A 3LH2L 3L54A 5K69A 4Z7NE 2IEPA 5MEQB 2QQQA 1M7XA 1J1XL 4ANKA 3SY0B 4AYBA 4WWKC 4HYTB 5I76B 5KSAD 1D5RA 3NBNA 4FXTA 3CC5A 5F7HA 2XKSA 2RQEA 3FTSA 2BP8A 3BMVA 4RMTA 1P6FA 1SBBA 3KYAA 3MDJA 4ZS6D 4MX7B 4JPWL 1S7TB 4J1UA 3UAJC 1NLDL 1GYCA 2W65A 4X4YA 3FU3A 3SDAA 1KBKA 1U92B 2HTLC 3K0YA 4R7LA 4F15B 4U6XB 3RZCA 2VQTA 2EYTA 1RJYB 2GTQA 5D7LE 3DJZA 3NIGF 3UJJL 1FYHB 4X7CC 1JNHB 2YD8A 1G7QA 4N2OA 2YAHA 1U42A 2ZYHA 3MNZB 1Z9SB 4FNRA 3OSVA 5I16B 3LKOA 1QSEB 4DEPC 3K6NA 1FNEA 1AQKL 1XGYH 3DIVA 1I7RA 5D4QA 2H4EA 3RPIA 3GSOB 2OSXA 5F0MB 3KPRA 4GI9A 5EBLA 1B0GA 4YXKH 3S37X 1PJWA 4JO5A 4R97B 1KTBA 2CRIA 5I23A 3GZQA 3NSFA 3QUMA 4ETQB 3AS1A 4FL4C 4PJBF 4KAQH 3V4UL 4JLRA 4TV3A 4J27A 1E3XA 4Y4HA 1BD2E 3KYOA 3MRCA 3UTTE 5HHOB 1ZHBB 5DS8B 4Z7NF 2WZ0A 3F7QA 3FFCA 1N0LB 5IBTH 2Y36L 1JZ2A 4G6JH 3WEOA 4D9QD 4NCDA 1ZLWH 4F7KA 3DSFL 3NCCB 4RETB 2FEEL 3KLAA 1MJJA 3FT3B 1EVTC 4R90L 4AEEA 3GSNH 1NUDA 3GRWH 4ZPTA 1X5JA 1FLTX 2B1AH 4GP8B 1IBDA 3VI4A 4EN3B 2CDGB 2X09A 1F2QA 4N5EC 2NUTB 4FA8A 1CL7H 5JOPE 5HHMD 5GIRB 5EF3A 3ARGD 5FR3A 5TJWK 3U4BH 1XX9C 4ZXBC 3PL6A 2HT2C 1JVKA 3MLYH 4G7YL 4KTDL 2XV3A 4I48A 4F3FA 3BWUC 3INUL 1KN4L 3L1OH 4QYOA 3N9GH 2CLZB 5I1LB 3EJYC 2ED8A 2B20A 1TJIH 4C59B 2X4PA 4I0PC 4N2LA 4QXGH 3NJFA 1OP4A 3Q48A 4R0LA 5AW3B 3PWNB 1A1OB 1A7RH 1ZJBA 4XAWL 4F9PA 3TA3A 1CS6A 2NYYC 2Y3NA 1JWMB 3PFQA 4Y8AA 3KPLA 3ZSTA 1GSMA 4MA3A 2OZ4H 5GISL 1PZ5B 5HDQL 4A39A 2JF1A 1GZQB 3FB7A 1KYAA 2BNQA 4P9HC 1QLFA 3B3IB 5B7FA 4ACTA 4E5XG 4NC1E 1X5LA 5IUCA 3S3BB 3JZYA 4TUJB 3S96A 1BAGA 2B1HH 2DYPA 4EJ1C 2FECI 3HG2A 1ETZB 1IIIA 1IFRA 5E4EB 2AJSL 5C0JB 2AXJA 4Z23A 3BD3A 3P4MB 4LQFL 1IGTB 3BLPX 4M5TA 4P57B 2A6KA 4R84A 3D0VB 4V1DD 3QJQB 4MWFA 1JXDA 2AFNA 4PRPE 4JGMA 2B9AA 4RMBA 4DZ8A 2ZUYA 3RURA 3PIQB 4M6OL 3VFOB 2DEYX 3FO0L 5TH2A 3LEXA 4JN1H 4NJAL 5DF0A 2KYIA 2AQNA 2XIIA 3DA0A 4A6YL 4PJHA 2QPEB 2G3MA 4A6YA 2AQPA 3UO1L 4BZ2H 2C9VA 3MJGX 3VD4A 3P2BA 1UYWL 2PLTA 2AJVH 1AZNA 3LPWA 3OAUH 5LCVL 2YD9A 4Y16B 3RLSA 3QI9A 4GPVA 1A1MA 2EDLA 5LCVA 2Z93A 4JRXD 1H0DB 2HLFD 2B3RA 4UUJA 4WTWA 4QRBA 3QORA 4NZRL 3SO3B 2E86A 2APVA 2X1OA 4X6CB 1DJYA 5FO9B 3IMTA 5LJYH 3S98A 2QQKL 1J0IA 1SVZA 3IFNH 1QWHA 4MA7L 4X0NA 5I1AB 3KPNA 4XX1E 4WI0B 3O3DA 3BH9A 2N7SA 3GSNB 1OAQH 3CBKB 1XCTB 3MA7B 1WBYB 4WY7L 5D6DC 5DRNB 4EPSA 5JOEA 3QZOA 2W88A 4BXSV 5ABAA 5CZKA 3CIAA 5J6HA 3ARBA 1AR2A 1BZEA 3AG3B 1THCA 5BMFL 5A7EA 1COBA 1M71B 1EAPA 1I3GL 3V0FA 4HWEH 1O7DE 3BZEB 5FUOH 5IB5A 4KH9A 1NANI 5L9DL 4B9JA 3IMRA 3ULSB 2ZUQB 1JERA 1MFEL 4KJWD 5ICXB 2DEXX 3VXQB 1ZT7A 4UQEA 5C71A 3REVA 2Q3XA 3O8XC 3K2IA 5DEGB 1IAIM 4W81A 4N9OB 3WHXB 1FCCA 2NYKA 4H5SB 3GDCA 3QRFM 1TZGL 2J12B 4R5VA 1QSED 5DA0B 3TP4A 1U4EA 5J1SC 5KBLA 1KB9J 3C8KB 2XVBA 1AS7A 5L2KD 3SJVB 2D2CC 5E8NB 1ZLUH 3BMWA 2QVFB 3OVUB 4XNYH 3TJEH 3DLQR 4F7EA 4ADJA 1OQOA 2D7PA 4JM2C 1H9VA 3IJHB 2AK1H 4NS0A 3PWUA 1UACL 5ILTH 1XCWA 1I4FB 1SY6L 1FV1A 5HHOD 1U93B 3VXRB 4I3SL 2Z92B 1UKTA 4NN7C 1BREA 1YC7A 1FORH 3LZOA 4TNVK 5D1XA 3L48A 1SY6A 1ZS8A 4LEXL 1S7SB 3NVQA 4JFEE 1CD1A 5HTSA 3TCTA 3VFPB 5IVXB 4NRXB 1IVTA 1DQMH 1OK0A 1A6AB 1EO8L 3MJ7A 4GQRA 4S1SH 1J86A 3V6OE 1RZJL 2ID5A 4U6TA 4N2DA 5TPWH 3ARDC 1WC7B 4OLZL 3TEZA 4DP0X 4HOWA 1H3PL 1BG1A 4ODSH 4LSPH 3Q2CA 2ROYA 8FABA 3W5NA 3MRKA 2OX5A 1P7QA 4OSUL 2OMTA 1ZHLA 3HUJA 2XG5A 2BSSA 2BOLA 5C0RL 4DN4L 1S9XB 6CGTA 1MY7A 4ISVA 4IBSA 4ZZKA 1GPOL 4IBWA 1KJ3L 1SXNA 4S1QL 2FIRT 4EIGB 4LKXA 2EUVA 1DFXA 3TNNA 1KWGA 1SOXA 3AMKA 4IMKA 3HS0C 4OV6F 3U9PL 3WENA 9PCYA 3HC2A 3F7KA 1Z3RA 2E27L 5HY9A 4XWOD 5DUBB 3VRIB 3NMEA 1PY4A 4G83A 5IK3B 5I1GL 5L8JB 3WKYA 5IWLC 4MD4A 3EAKA 2DQFA 3NJVA 4DN3H 1OSYA 2VN7A 4XN2A 1GC1H 4JG0L 3IU3A 1PPIA 1AQ8A 3DSNA 2D31A 1IGFH 2LTQC 3PQYE 4FS0A 4ZOEA 5FYKH 4F80A 1MJ8L 2FX7L 4BE5A 1WAAE 4LCWD 4XGZB 4YDKL 1GCYA 4JG1H 4Y2LA 4Z7OE 3FU8A 4ZQKB 1IGML 2QQNL 4LLUB 1D6VL 2QL1A 2VKXA 1XL6A 2NZ9C 4GBXC 4L29A 4YR6B 5C0EB 5I15L 4PSRA 3O2WH 2OCFD 1TKWB 1N6UA 2XETA 2YUXA 2DQJL 4MFHA 3WFHA 2J1YA 2CO7A 1J9QA 1YEWA 3SDXB 3VD9A 4ODHL 4Y5YC 2W07A 3QG6B 3S3SA 2WYZA 1AP2A 2BDNH 2BCKB 4PJ5A 5FUCC 3T1FB 2XZQH 4S1DD 3SQBB 2A83A 4U1SB 2R0WH 2JV6A 3MRIB 4G72B 4HBCL 1D9KA 2R7EB 3M07A 4DEWA 3FT9A 4TLSA 1YEFH 3MGTB 3LTVA 2XSKA 4WW1A 2KLTA 1JDDA 5KSAC 5C0GA 1FE8L 2YD7A 2X6MA 3LIZL 1JV2A 4JO4L 7FABH 5CZVL 4EBQH 4DUVA 4FNUA 1OTSC 3LIZA 4ZS6C 3ISWA 4LRNH 2Y72A 4HS6A 4UYQA 3L3OA 2FX9L 2XXGA 4LCCB 4P5KB 3GM8A 2GBAA 5EIIB 1CFQA 3L3HB 3PNWA 1KTDA 5F1OB 1N59A 1WAAF 2Q8BH 1SBSH 2R9HD 4H8HA 3O6FA 3QWNA 5LQBL 4Z7OF 5KBNC 3U4KA 1BEYL 3Q8EA 1P84J 1ZLWK 1QKZH 3ZTCC 1D5XB 2AV7A 4JZOA 2Y06L 1RJLA 2XQYG 4KZEH 1A6VL 1FVCA 1LP9E 2IALA 3F6JA 3K91A 1MLBA 2OMYB 5BO1H 2BY1A 5C2UB 3NCWA 2NQDA 4HULB 1SEBB 4JFPA 3ZN6A 3KYNA 5A40E 3NIFB 5A2IH 4NO0A 4JFYB 2DZEA 4LHJB 3HJ0A 1DBBL 4ANVA 4RAVA 4YFLI 5D2LB 5GS0H 4BQ6A 1AHWC 4QNPE 3VFSA 3GPSA 1Q0EA 3D51A 3IDNA 5KVFH 5ANMA 5CJOL 4X4KA 3THML 1UC6A 3SJVD 2A77L 3HHRB 3HLAA 4DQOH 3CXDH 4JFQA 1TO5A 4PJCE 5GSRB 4J3VA 4JFDE 4ZTOL 5EZJB 2OR9L 4KBPA 1FPTL 5HYJA 3MLPA 1YMHB 1H8SA 1R9FA 3BP5B 1KCLA 1NA8A 2UZYA 4CNIA 3EYUL 3NJGA 1DJWA 4PLNC 5IHUL 5IBLD 4KO6A 4XO4A 2ZWYA 3VXRD 4FFYH 4NB7A 5C9KA 5KBDA 3GBNH 1D7DA 4JMNA 3HVNA 3IU4H 3I6KB 3BUYB 4X4MA 1URIA 4IBQA 5IM7A 3MLUH 1OCWH 1NGQH 4HWUA 2BIHA 4GLRH 4ANUA 3HZ3A 4XCFL 4GJTB 3A6CL 3AVEA 4LASH 4KI5E 5F7YC 3RFZC 4QT5A 5LNGA 2X44D 3VFVB 1LP9F 4PGEB 3RJQB 1MCWM 1DVFD 3LH2H 4F8NA 2AQRA 3HB3B 3DGGB 3S3PA 2IMMA 4H26B 4B9CA 3HW7A 1J1XH 1WG3A 2YEVB 4AT6A 5EOQH 4MHHG 1DP0A 2KL6A 5KS9A 2KDYA 1QA9B 4F8LA 1B88A 1HT6A 4ZRGA 2RQ8A 5SWQB 1BBJB 2APBA 4WI9A 3ZZ1A 1DUZA 4QNPF 4F7MA 3B6SA 1VPOL 4JPWH 4GEJA 4M1DL 5BQDA 5DSCB 3DARA 4CDGC 3C5JA 4L4VD 3LKQA 4PJCF 2BFGA 1TCRB 3GBDA 4IKNA 1KJ2L 2D3NA 1R6VA 4XMTA 3ZIMA 4UM8A 4HAFA 2XWTA 2FO8A 2HG5A 4M9OA 1KJ2A 4XMVA 4B97A 1WIPA 5HJBA 2PYED 4NUJA 5IHLB 3EGDA 4OLYH 3RTQB 4QY8B 1FFPA 3BGFB 1HWHB 3VXNA 5EEUA 1O9VA 1AQKH 2K6ZA 2ZYIA 4DHLA 1AQHA 4AMKL 1DJHA 4X5RA 4C56A 2GB2A 3O4LE 1X9LA 5L6YL 2L04A 4OLWH 3KPSE 5E5MA 1KYOJ 5LAXA 2E9IA 2R23B 4W9HC 3L95B 2X4UB 1A7PH 2X89A 2VN5A 1E43A 1OPOA 3WUWA 3T0WA 5LGHL 3WAJA 2XRAL 4O2CA 1UASA 2W8CA 1BQ5A 5I1CL 1BSIA 4OFIA 5BS0B 2DPKA 3DSFH 2HLFC 1CDCA 4R90H 4GT0A 1HINH 4CVUA 3UEZA 4LPWA 2F54E 3GSRB 3H9SE 1TU2B 4HWZA 3GSUA 5D70H 3OG6B 2E6QA 4G8IB 5HI3D 1ZLUK 4EVNA 1PQZB 2B15A 1HNGA 2VB5A 2GEQA 4TXVB 4TF4A 1NDMA 4OUUA 2IPUK 4PW9A 1NCWL 3W37A 1WS8A 3ULVE 1EJ6A 4G7YH 4KTDH 3HPLB 3TVMA 4ZMXA 5KYWA 3S9DB 3MUZ1 3V5HA 4Q9RL 5DJ2A 1TOXA 3CSFA 3RWEA 1D2PA 1EDQA 1PY0A 1YY8A 5GGSY 4BCYA 4KJWC 1QWUA 1MVUB 4U7SA 3QWQB 4XPGL 3WN5C 2LU4A 3ZE0B 2X70A 3VXMA 4Z78A 4GG6B 2VCOA 1CMOA 3HR6A 2IOOA 3HTLX 1BLNB 2ZWZA 4XAWH 4AYMC 1JP5A 3DXAD 1NCHA 1R5VA 2CIIB 3EFOB 4X50A 2AEPL 2DBJA 5GISH 4MCNA 4M6AA 5I1KL 2ZOLB 5F89A 2FSDA 1AGCB 4WWPA 3W0WA 2EIKB 3BSGA 3BPLB 1NIBA 3CFKA 3NFNB 4J1UB 4JY4A 5BW7A 4G6FB 3F5WB 3SDAB 2Q1EA 3O9WA 3RZCB 3GSXB 4A04A 4DP9X 2BH0A 3LKSA 1G7QB 3NPSB 1DVTA 3RDTD 3ALPA 4P5TC 3DX3A 3CH1A 4TSCL 3N1PC 5ANHA 1EAJA 2BHZA 2MQCA 2DQCL 5D1QA 4M6OH 3KWUA 3FO0H 2BHFA 4JFOA 1W80A 5ACZA 4NJAH 3TEUA 1FNEB 5C8JA 2V17L 4JHAH 1I7RB 3RPIB 3IKCA 4RFNB 2I07A 5GRYA 3ULVF 1A2YA 3NCYP 5EBLB 5FYKD 2KDGA 3UO1H 4PTUB 5FYLD 3RL2A 1G7LA 3M17A 3QCVH 5SV4A 1UYWH 2IH3A 3II1A 2P5EA 2FLBT 4OCSL 4YBLC 4TUOB 2W9EH 2H0PA 3AS2A 3FTGA 4Y4HB 3RB5A 5GRXG 2C1PA 2FYYA 2FATL 3FN0L 3ARSA 3EKCA 4Y4KB 2IAMA 4PV8A 1M1XA 4XCYA 4YHOL 7PCYA 4PJEB 5DJ8B 4NLHA 4NZRH 4E42A 4F58L 4MA7H 3VJ6A 1OAXL 1U8KA 1CFNA 3VI4B 4WY7H 3TOPA 5L7XL 5GS2D 4OF3A 1NMCB 1DQQB 3CFEA 3QDGD 1YEEL 2P9RA 3DV4A 5C07E 1UXLA 1TJXA 4B9FA 2DJUA 2R0ZL 1I3GH 3BP4B 3PL6B 4OGXL 1C9SA 4HJ0D 4AYSA 1QR1B 5L9DH 4F3FB 5ELIA 3SDDC 3LN9A 1CL7I 1MFEH 3HAEA 3FUFA 3QR1A 4NN5B 2IPTL 4JQVC 3PDOB 4QYOB 2Z1KA 2DM3A 3LEYL 1N8OE 5A7BA 2P26A 2Q20A 3ATBA 5E70A 4B53A 5CD5D 4HDIA 3S8WA 1TZAA 3L4ZA 3PF2A 1ZT1A 4Y0GA 5HYEA 2EKSA 4UDUA 1G9NC 1TZGH 1KTRL 1GGBL 4EZKA 3S48A 4PMEA 1Q9OB 2DIEA 3V0IA 4QHLA 2W94A 4MA3B 1XCXA 3KJ4B 1FVEA 3FB7B 4UQ2A 4L4TE 1E9OB 2BNQB 4LOFA 3T77B 1DE4A 1T22A 2BP0A 3L08A 1AQDA 1XZWA 2DYPB 3FHQA 4OFKA 1UACH 2UY6A 4S1DC 3MGAA 1MCPL 2V2XA 4RVBA 1SY6H 3ISRA 2A6KB 5GS0D 3QNXA 4MWFB 3QS3A 4LEXH 2FRGP 5BS0D 3MSPA 5TH2B 3LEXB 4L9LC 4XTRD 5IHZA 1RZJH 4UAOC 1F42A 4H8WH 1JF6A 4PJHB 2R27A 1MHPL 2BFVL 1CZ8L 4OLZH 2O30A 3WY3A 5JOFA 1H3PH 1HL9A 2CM5A 4ZX5A 4Y4FA 1UM5H 5LGKA 2V9RA 4NI3A 2GJZA 3RWDA 2VLRE 5JUEL 2B59B 3MKGA 3WU1A 3QI9B 5C0AD 3WMQA 1I8LA 1A1MB 4DN4H 3D34A 1XTMA 4NM8L 2Z93B 3Q0HA 4WUKL 3ZUCA 4PWHA 2ZUQC 3FRPG 2UWEE 2HVBA 2OSYA 3QORB 5IQ7L 2J6WA 5D7JC 3U9PH 2Z9TA 1XFPA 1SOKA 3NN8B 3WGVB 2RIKA 3KPNB 4LPXA 3VB8A 3QUZA 3PP3H 4NZDA 2ILLA 3BH9B 5I1GH 5SX5H 2OW7A 1QPXA 1U3HA 5J6HB 3ARBB 1HSAA 4JG0H 4NNYA 1S5IL 4LSSL 4OFQA 1UD4A 3ABLB 4J23A 4AVIA 1U8QB 1CDHA 4XODA 1MJ8H 2CWRA 2FX7H 3LJ3A 3C8HA 4G6FD 4U3SA 5IB5B 3SDAD 3SGKC 1T04A 4YDKH 1HEJC 2W81C 3VACA 4QRRE 4NNXB 3FN9A 4NX0A 1EIBA 1L7TH 1UEYA 1WZAA 1YUKB 1ZT7B 2F7IA 3RZCD 5DK2A 3REVB 4EXPX 1D6VH 3E38A 3MV9E 5I15H 1TLMA 1JZ5A 4ONFL 5IBLC 5I5MA 3BZFA 3HN5A 4LE8A 3MRPA 3DYPA 3HHSB 4J3SA 4LHQB 3WFBL 2DM4A 2OLDA 1E2WA 2WINB 3MRFA 3OC5A 3C5XA 1TVHB 3LV3A 3N1QC 5ITBL 1ZK9A 2FJFA 5FGSA 3KPRD 4F7EB 2ZX8A 3ZTDC 3WL9B 4HX1B 1ZPUA 2A4EA 1DVFC 3DX8A 5ACMA 3SD5A 3TBBA 4D0CA 3PCYA 3WTUA 2UWEF 5IBUB 3LQAC 2Z8SA 4HBCH 4PP2A 3QJHB 4UMSA 4K9EH 5CCGE 1U3JA 1FFOA 2AC0A 1FV1B 2DI7A 4AG4L 4PJAE 1CTNA 3FFCD 1FE8H 5D5MB 1AG0A 3LIZH 4JO4H 2Y7LA 5D1XB 5CZVH 1ZS8B 3NJKA 4ECNA 1HXYA 1KGCD 2H1PL 3D2UA 5C08B 3ZIYA 2OSLA 2J8UA 4GT7A 1RIVL 3JVFC 2RGSA 5CGTA 4LPUA 1FNFA 2FHBA 1QFOA 3MJ7B 3LD8C 3BJLA 3T0EE 4E9RA 2CJTA 3N41F 4TVPE 4JE0A 3FFOA 1PX4A 2NXYD 1IJ9A 4J12A 5SWSB 5C09B 1MAMH 1OTUD 3V7AE 5DJAB 1NEZA 1L9PA 3BW9A 1OAYL 3MRKB 1P7QB 1TQWA 4NGHH 4GKZB 1ZHLB 1SM3H 3PL6D 4RIRA 3QJSB 4CN1A 5HVGB 2BSSB 3HRZA 1HCFX 3A6OA 1A8JH 2D4FA 4OZIA 3VD7A 1CGTA 1MIEL 3FH8A 3MO1A 4EZJA 2G75A 3CGTA 4LOVA 4XBPB 3M7FB 4K71C 5JHLL 1DBBH 1F45A 1DJZA 2CD0A 1KEML 3ARUA 4A2MA 3FO9A 2XG4B 5FGCB 5JHLA 4HPOH 3FCTA 3WKQA 4AQ8C 3TA3D 5CJOH 4MD4B 2O6PA 5MEOA 2G2RA 1IEBB 5I6MA 4HUMB 2J56A 3IU3B 4V2CB 3L3IA 2BNQD 4PJAF 4G8FA 4EDXB 3WXVL 4ZTOH 1FPTH 4PRIA 3TTYA 3UCRA 4B60A 1GY1A 2BY2A 4X6BB 2DYPD 1D7FA 2A6JA 1HE7A 1UURA 2CHZA 4KNQA 1KPVB 1UCBL 2CMRH 5IHUH 4LPYA 1CD0A 1MSPA 3F7LA 1R3JA 4Y5XA 2B5IB 4L29B 2ZD0A 4JRYA 4NP4L 4R2GB 3EH1A 3DUHA 5HI3C 3OBAA 1VF5C 2EIJB 4CN4A 2BSTA 4UB0L 3VG0H 3I50H 4G9FA 2CO7B 2VWEC 2D7MA 3A6CH 2N1KA 4YGVB 2Z31B 2W07B 1S46A 3EH2A 1AP2B 1DQLL 2GCYA 2OMWB 5CGYD 1ILUA 4RRPA 3UC0L 2E7MA 2ICWJ 3HR5A 2V6HA 2Z35A 4KTEL 1JPSL 1U8IB 2A83B 5CCKL 3C2AL 3AZUA 4LKCA 2JJTA 4LCIH 4ELKB 1HH9A 3LAFA 3MCLL 5F9AC 2EUZA 3K6OA 4QGYA 1QR4A 2W9DL 3CX2A 4HEME 3FW6A 4HZLA 3KCPA 5FAAA 2H3NA 1P6AB 5FPIA 1DLHA 1QX1A 2WMPA 3RWCA 2G4EA 2ZOKA 1JV2B 2VQUA 2AJ3A 3OB0H 2DICA 2WKOF 1K9TA 4M1DH 4YAQA 4WI3A 1MQKL 5TE6L 5MP6L 2YJLA 1RK1A 2QADB 4P4KC 3QORD 4PJ9A 4HS6B 3L3OB 1KJMB 1KJ2H 2EDKA 2WLLA 2B4CL 2YFNA 2YD0A 5EIQA 1AG6A 1CFQB 2PXYA 3PNWB 1KTDB 1KT2B 1FVDA 5IR1B 1N59B 1FL3A 2ZWNA 5DHDA 3I2CL 4PCKA 3O6FB 1JAEA 3ARBD 3RDTC 4K7PX 1VCBC 2XWEA 3Q6GH 4FCAA 3UOAB 3VTMA 2AV7B 2IGFL 2EIMB 4JZOB 5EH1A 4I2XE 1AH1A 5ADOL 1RJLB 3GMOA 5EU6A 3CVCA 1FVCB 4JM0A 1MLBB 4E36A 5I19L 1RK0A 4R4BA 1RL1A 4FQPA 2HH0H 5CJ5A 3KYNB 2FLMA 1XF2A 3ROOA 3CZNA 4NO0B 3BGAA 4X2UA 4WFFE 1UWFA 1K5WA 2AJYL 3RU8H 3H6JA 4RAVB 5EC1B 5K33A 3EJSA 4BYHA 1J0HA 4GKNA 1ND0A 3IDNB 4ZODA 2WTRA 2XRAH 3GLEA 5ANMB 3QDME 3N55A 4PPTA 5IESH 3MBWA 3HLAB 3MR9B 3UBXG 5KZCB 5I1CH 1BVNT 2YKLL 4JFQB 1VADA 3H4HA 5FO8A 4ZNEE 2VR6A 1CD8A 4QRTA 3IETA 4LIQL 2QVTA 5EN2B 5HYJB 3V4PH 4PJBA 4LPVA 3CLFH 5A1AA 1VGEL 3K72B 5ERWB 5I30L 4CNIB 4KO9A 5DD3H 4QEGA 1FCGA 1QSFE 5LDUA 1T03L 3T6WA 2NXZB 2WM0A 3BKCL 1KNOA 2Y5TA 5D1XD 3EBHA 3TL5A 1NCWH 2YRPA 1RVFL 1G7HA 4W9FC 1RHHB 8PAZA 2OR7A 2MFNA 3IGFA 4KXZH 1MAKA 4HJ0C 2KZKA 4U1LB 4Q9RH 4ONHA 4UQAA 2YZ8A 2XLLA 2F5AH 3RY6A 5AL0A 1H6TA 4Z0XA 4XPGH 5AOZA 1A6ZA 2BS8A 1A7QH 2X6AA 2A9CA 2BC4A 4HIEB 1JGIA 4F2EA 4CVZA 1F4WL 2QZQA 3KW7A 1RIUL 5CD5C 3IFLL 4AT6B 4Q4IA 2I9LB 3MRDB 3GD1C 3ULUE 1P7QD 3H42L 3CDFA 2AEPH 3GBEA 4KKPA 1A3RH 2YSTA 5F7BA 5AAMA 5CD3A 3BAYA 4NDMA 4XP1L 4K0OA 4D8PA 1KBVA 3GWJA 4OB5L 1A9EB 3SKMA 3B6SB 3MHZA 2JCCB 4JDTL 3FB8B 2ATKA 1DCEA 2EDNA 2GJRA 5I73B 4WI6A 4UINL 3T6XA 5BCAA 5L0QC 4K3GA 1RERA 3DIFB 4L18A 4JZNB 2WXKA 1MFVA 5EOTA 4N86A 5T33L 1MRCL 1I8KA 2DS4A 1UVQA 3PUUA 5J89A 4UM8B 3F6IA 1BMWA 1DCLA 5CCJA 2XWTB 3EHBB 2HG5B 5GGTH 1KJ2B 4X7TB 4OCYL 3F64A 4TSCH 2GABA 3PXHA 4NUJB 4BD4A 3EGDB 5F0LB 1E8ZA 1LD9A 3I3EA 1FFPB 1JUFA 2DQCH 3Q6FA 1NMBH 3GPEA 1DQVA 5F7NC 1SPDA 2V17H 3WFDL 2EEFA 5HGBA 4MMXC 3PLYA 4R7DB 5J56B 3F58L 3GC3A 1NKRA 4C56B 3VDBA 1F41A 1X5IA 5SX5K 1BFOA 3SODB 5FECB 1CD9B 2JJSC 4QJ5B 4NT6B 1E30A 1P4UA 3HZKA 5E5MB 5FGRA 3SBPA 3K4AA 3TYFA 1U2CA 3G3LA 4F7CA 2BJMH 4IM8A 4AV4A 2NRDA 2FATH 3ULUF 2EH8L 4O2CB 5JZ7C 5D7IE 4OUOA 4JFFE 4FXGB 1TSRA 2WPGA 1NUGA 4F37K 3RVWC 2EDXA 4OZFA 4PJ5D 5IVOA 4Q56A 1OAXH 3LN5B 3O6ML 4W9JC 2G3XA 2VLJE 1AFVH 5L7XH 1D9KD 5AB9A 4HWZB 3O41A 3ZMNA 2FEEI 2COQA 4KZCA 4EVNB 1NC2A 4J6RL 4G3YL 4OUUB 4OGXH 2R0ZH 4Q52A 5GJTL 3PHOB 4YWGL 5F7EH 4MYWB 2F6AA 1Q9KA 3VWKA 5AG9A 5KYWB 2AJXH 4BBWA 5D9SA 3C5SA 2C26A 2IXQA 3DOIA 2IPTH 4RISL 3V5HB 3RWEB 3LEYH 1OY3B 1HAWA 5FIEA 3FMGL 3VXSE 4WVRA 4Z78B 3S7GA 4W4OA 2X70B 2A6IB 4OCLC 1I1FA 3HE7C 3VXMB 3UPRB 3BWAA 3RNQB 3P11H 3RX7A 2J1WA 5HDWA 3O6FD 3L13A 1GGBH 4GAFB 3WIAA 2YD4A 2DYSB 3AB0C 3LNHA 4JPVL 4XBEL 4BWTA 5CLWA 5HYIA 1S9KC 3IVKA 1XBRA 2VLLB 2XWXA 5F89B 3PWVB 3R4RA 1LGVA 4TYUA 5CEXA 3W0WB 4P2YA 2NY4B 1LO0H 1C5CL 2BRRL 3CFKB 4JY4B 3CVHL 4RFNC 5DJ0A 5F1IA 5D7IF 4NO0D 3POHA 3U4AA 2CA4A 3B56A 1G4MA 3RIFK 3CVHA 1YDPA 2WOBA 4B5EA 1BX2A 1KCSL 4M61B 5B1JA 1JTTA 1UM6L 1YAZA 1YZZA 3IXAA 4JFZH 2OXHA 1TTRA 1IFGA 1CE6B 3AM8C 3LKSB 3PWJB 2BMKA 1V8HA 2AERT 3B7RL 2O61A 1MI5E 4XVTL 5GS1A 4YSDA 5ESAB 3CH1B 4X5WB 5IJCC 2EVGA 2OL3L 4JFOB 5C8JB 4OI7A 5D2NB 3NAAL 2G5BA 2KZ1B 2I07B 2OL3A 3VQMA 2EILB 1WA0X 1MHPH 2DQUL 1JRHL 2BFVH 1RUMH 4PVNA 1CZ8H 4KKCC 5LGYA 5F93C 3RL2B 1G7LB 3JVGA 4NFDA 2NXYC 2ZNWA 3M17B 3AC0A 1ZA6B 2IH3B 2NXZD 4FFTA 4FAAB 2P5EB 3AQYA 4HLZG 2UYLA 1JZDC 2QPSA 1GOHA 1K72A 2C1PB 2CUAA 1NCJA 2ITEA 4QHPA 5HGGS 2IIJA 4NM8H 1NIAA 1ACXA 3WXWL 2IAMB 3U48A 1OCZB 2X41A 3K46A 4PV8B 3LPOA 1M1XB 4XCYB 3FU0A 1E50A 3BWUF 5IQ7H 4E42B 1QI3A 3VGHA 3JV4A 1CFNB 1HQRA 1NEPA 3VU2A 5AAWA 1IZJA 4R0LC 2R0LL 4FZ8L 1LE9A 4F9PC 2VAAA 3CFEB 3TA3C 2V7HA 1HHIB 5BRZE 1SJEB 3DV4B 1S5IH 4LSSH 4ZZFA 1MJ7L 1OSZA 4JO3L 2HFEA 1HNFA 5GZND 4DERA 2R56L 4BUQA 1EPFA 1F58H 5FFOA 1Y1UA 5C0BE 4M8RA 2XTJD 5MENE 5DZNA 4HUXA 2WZAA 2NNAA 2X4TA 4HDIB 4A37A 5FM5M 2IDCA 4KRPC 1ZT1B 3CFTA 3DX6A 2EKSB 3OB0K 2PPEA 1AYOA 4NEHB 5CN3A 2AI0L 3VTTA 2F1EA 1JD7A 3AU1A 4Q9BA 3T0VA 1ZEAL 1WUNT 4JFEA 1T1YA 3UMTA 1EFXA 2VR3A 1AD9A 4AIZA 1YN6A 3UTZA 5J5EA 4C56D 1DYZA 1BOGA 3V6OA 2BX5A 1T22B 4MKMA 5CGYC 5EC2B 4RGOL 1AQDB 2Y5EA 2UY6B 1S9YA 3K74B 4CILA 2X89D 3UZVB 4AG4H 1Z5LA 5JXAL 4YZFE 3H54A 4WIQA 3QNXB 3KH4A 3M6DA 4PN6A 1NBZB 1MIML 2H1PH 5F9JA 1VCAA 1RIVH 1VZGA 2WXMA 4BZ1L 4PLOB 4UMGA 4F8PA 1UOWA 2FK9A 5IHZB 1FH5L 4BZ1A 2QSTA 2P1YA 2OMZA 3QORC 1M6OA 4YEFA 4M48L 1JFHA 2DBLL 3AG4B 3G7TA 3Q13A 5DWUH 1OAYH 2P28B 3FOLA 4LDEB 5FK9A 4WKXA 1TVDA 3EFDL 5DEFB 3ECQA 5F0JB 1UFGA 3QH3B 4P2QB 2AXHA 3BCDA 4HWBL 1YN7A 3H9HB 3TVMD 2WW8A 3UXFA 4DO6A 1MIEH 4HWBA 3PQYA 2LU7A 2OMXB 3U46A 3WDIA 1QW8A 5J06A 2P8LA 1YEJL 1B9ZA 2Y9RT 3AROA 3SGDH 3QA3B 3EOYG 3W56A 4UF7C 3X11B 3F83A 3QZWB 1H3XA 3QUZB 1VFUA 3M7OA 3P0VL 4XH2A 4IRZL 1SN5A 4G2AA 4JX0A 1U3HB 2IOIA 1R46A 5IEHA 1HSAB 1SVBA 1ZY9A 2XN9E 4Q0XL 4RWYL 4IRZA 4CC4A 3QDJA 1HDMA 3JYBA 5EUOE 2WZPA 3W0WD 2X40A 5IW6A 2NY4D 1K5NB 1JDCA 4H7VA 2MH4A 2DH3A 4YZFF 3WXVH 4YO0B 2IQAB 4QLWA 5I71B 3BP6A 3KL0A 4LCVA 1T04B 3ABZA 4JL2A 2WY3B 3KS0J 4ZW7A 1FZOA 3IDIB 3O9WD 5EBWA 1KCBA 4UNTA 3FUHA 3IGAA 2HKAA 4NWTL 3V9EA 3DHJA 4NP4H 1JZ8A 3O3AA 4NUGH 3X13B 3X3GL 3BZFB 4AY0A 1S78D 5D1XC 5G2NA 5JPNA 1MFCH 3MRPB 3S0PA 3WTTA 4YDZA 4ZTPL 5D1QD 15C8H 3ZDZE 2WUBL 5J1AA 1HHHA 3L7EB 1OGPA 4WWNA 2EE6A 4F7TA 4TS6A 4NQDE 4Z8FH 3BEWA 3UC0H 3PDGA 1XH2A 1E4XH 2Q76A 4PJ7E 5C0CE 1BVNP 2PABA 2JTYA 3FAWA 3NJNA 4PJDE 4D0CB 5CCKH 3C2AH 1LTXA 3U6RB 2R29L 2P5ED 3MCLH 3O4OB 4KHXH 2CHDA 1HJBC 2QPFA 3CHRA 4BELD 4E9QA 1N67A 5C3IA 5K5YA 5TE4L 1KCRL 2R29A 2WO4A 4W70A 1K8IA 1BQUA 1JGUL 2NY0B 3HBGA 2IAMD 2YR3A 4PP1D 1G7PA 1IV8A 3D2UB 3WNIA 1E8WA 4UOQA 2J8UB 5MP6H 5DMGD 1CGUA 3CN1A 5EUOF 43CAA 2XUWA 2B4CH 4IMKC 3U1QA 1IKNC 4ZMVA 1OTTC 3AG1B 1YMMA 1X5ZA 3T6VA 1DBKL 1NEZB 1PG7L 4PYGA 3I3BA 3UTSE 3B37A 4WJ5A 3QHFL 4AJ0A 4IIQB 4S1RH