1SUJA

X-ray crystal structure of ambystoma tigrinum cone arrestin
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
370
structure length
363
Chain Sequence
b'SKVYKKTCPNAKLSIYLGKRDFVDHVEHVEPVDGVVLIDPEYLKDRKVFVTLTCAFRYGRDDLDLIGMSFRKDLYSLATQVYPPETKEPLTPLQEKLMKKLGAHAYPFCFKMGTNLPCSVTLQPGPDDTGKSCGVDFEVKAFCAENLEEKIHKRNSVQLVIRKVQFAPANLGVAPKTEITRQFMLSDRPLHLEASLDKEIYYHGEPINVNVKINNTTGKIVKKIKIIVEQVTDVVLFSLDKYVKTVCAEETNDTVAANSTLSKTFSVTPMLANNREKRGLALDGKLKHEDTNLASTTVIRPGMDKEVLGILVSYKVKVHLVVARGGILGDLTSSDVAVELPLTLMHPKPSDDIIIEEFARQKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cone arrestin
publication title Crystal structure of cone arrestin at 2.3A: evolution of receptor specificity.
pubmed doi rcsb
source organism Ambystoma tigrinum
molecule tags Signaling protein
total genus 71
structure length 363
sequence length 370
ec nomenclature
pdb deposition date 2004-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
A PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1sujA02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1sujA01
3LH9A 4LL1A 4GFXA 3GD1C 1G4RA 3P2DA 4P2AA 3LHAA 4R7VA 3UGXA 2FAUA 1AYRA 1ZSHA 5F0MB 4JQIA 4LL4A 5F0LB 1SUJA 4GEJA 4GEIA 2WTRB 5F0PB 3UGUA 1CF1A 1JSYA 3GC3A 4R7XA 2WTRA 4J2QA 3LH8A 5F0JB 4ZRGA 1G4MA 2R51A
chains in the Genus database with same CATH superfamily
3VD9A 4I9WE 4UQEA 3TP4A 2JJVA 4J3OC 2I85A 5JOEA 1G5GA 1BYPA 3ZZ1A 5CEZE 3DOIA 1RJZB 2PYEE 1HKFA 2Q7NA 2GSGA 4LBEA 3PFQA 1ZOXA 1RUQH 2XA8H 2EO7A 2X0WA 3SN6N 4G70B 2HT3C 2XSKA 3B2VL 3OXSB 4MQXC 4I85A 1F58H 2JJSC 1MCFA 2CALA 1IX2A 4M6AA 3GGWB 3PNWB 3QFJD 2IH3A 5DJ6A 1GSMA 2VC2H 2Z91B 2OTPA 4P3CH 1IZJA 15C8L 3FTUA 3MLWL 4FCAA 4EN3B 2BINA 3GXTA 1Q9LA 5D1QE 4FQQB 3FK3A 3OLDA 4Z77A 4F7EB 3QZBA 1R3HA 3CAFA 3FFCB 3KPSD 1P4BL 5TK4A 3Q7JA 3F58L 2EE9A 4EF3A 5ISZE 4M8RA 1FAIL 3BXNB 3VFNB 2FDBP 4XGZA 2DPKA 2R4SL 2CRIA 3I6LE 2DRUA 3K2UL 2VXQA 1B0GB 2FK9A 4FQJH 1XX9C 5GS2D 5C9KA 4NERA 4ZFQA 2FATH 5BOZG 2YGQA 4HWBH 3OZKA 4ZSOE 2XJKA 2WOBA 1MUJA 4BZ2A 1FV1A 4YPGA 4BRJA 2M2DA 1KSRA 4C83B 4UM9D 1DZ0A 3TJEL 1AHWA 1SVBA 2QLYA 1AY1H 1KLGB 4N0CC 4WEBH 1NJ9B 3EYVB 4F7CB 2BOCA 3DO7B 2IAMA 4YFDB 2DTML 4YXKL 2X41A 2YD5A 5G4OA 4GRMA 4GBXD 3M17A 2HT4C 3GRGA 3A6CL 4PWJA 1T4KA 4MQ7A 4GSRA 4Y2DC 4F92B 4JFVA 4DTGL 5GGSA 5D7JD 4NN5B 1T89C 4MNQD 3IKCA 3T71A 4CVXB 2DI9A 3O6FB 3HB3D 1P5VB 3AG3B 1LK3L 1OSPL 1DLFL 1ZIAA 2O5ZH 2YAOA 3BAKA 1B4LA 1WBYB 4U1HB 4M7LT 1PU0A 4FN0A 1XF3A 4LSTH 2VUOA 2H8PB 2NRDA 4YEFA 3I9GL 3CFUA 4G8GA 1TZOA 4Z78B 2PN5A 2IFGA 3O2WH 5DMGC 3VNYA 2RGSA 4GSQA 1PMYA 2XNAB 5GS1C 5B3JE 4JRXB 2QJDA 3PAVA 5D7SL 3ZDXE 3ZL1A 2X44D 1UYWL 3QUYB 1S7TA 1WFUA 3MX0A 3L08A 4ODBD 4W4NA 4XMKH 2OLDA 1PQZB 1WFIA 3QDJA 4X6BB 1N8ZB 4J1UA 4Y0GA 5KS9A 1BP3B 1S9WB 2C9AA 2EE3A 3HZYB 1ZE3C 2AJXL 5FYJU 5A3IC 3UYRH 2EIKB 4M5TA 1L7IH 4ERSL 2BIIA 3FU0A 3EH1A 4UYQA 2O61A 4E41E 1BEYH 3N50A 2D31B 1GAFL 2HXAA 3L1OH 1C8QA 1PG7W 1JXKA 2JKJA 2D3VA 1BVOA 2FBJH 3CFDA 2J2ZB 3D2UB 3FCSB 3JUZA 1KPUB 3QUGA 4HJTA 4HULB 4HJIA 3ULUL 1D5IL 4Z7VA 4E9VA 3HC4H 3U0TA 5JXED 1UZ8A 2EDDA 2NXZC 4GG6A 5L4FA 1OCZB 2ZCHH 4DEPB 3BPOC 3T0EB 3GSWA 4ZOEA 4ZPVA 3WEOA 1CDJA 3HC2A 1D6VH 1Q9WB 1RHHB 4B7IA 4LLVB 1CS6A 5A7EA 4Z23A 2QV2A 3HG1E 2Q87A 3MRMA 1OF2A 2OL3L 3L4UA 5SX4I 4NP4L 1RZQA 2DD8H 4WV1C 4NO3A 1XV8A 5IVXB 5KAQG 5KBKA 1NGYB 1XH0A 1B0RA 5DRXA 2P80A 2V3EA 3ARSA 4XNDA 4OLVL 2WXGA 3RUGB 1XIWC 1IEBA 2Z64C 5DO2C 4NO5B 5GGRA 1MFEH 1BOYA 2I24N 3COOA 1JTTA 3CNKA 1V10A 1UD8A 1WT5A 1JS4A 3GSRA 2YZ1A 2CM5A 5IB5B 1P7QA 3CN4A 3EJYC 1X4XA 2MQ3A 4L0ZA 4XAKD 1J05A 3GRBA 3BN9C 2F5BH 3LKOA 5KVEL 2VDPH 4IOSD 3IFOB 2E74C 4G6KH 3WFZA 3BAEH 4PJAA 4XMPL 4XWGH 5DTFB 1DDTA 3MOQA 2GTWB 3DX8B 2OP4H 2X6MA 5DWPA 3IMSA 2Z34A 2VLRD 2M8XA 4JDEA 1HH9A 3K8KA 5I0XA 2P5WD 1A1OA 4LPUA 1WZ1L 2VDOB 3ISRA 3QNZB 2DQTH 4KZ0A 1AG0A 4PW4A 5F71A 2A6KA 4S1QH 2CLVA 2BRRH 5HHMD 4GEIA 4OLYL 4EKXA 2W65A 1MZZA 1D5MB 3MCG1 1RUAH 1A7QH 1U58A 3G04B 4GRWH 3H0TB 1TFHA 3MUUA 1XBRA 5BZDB 1KACB 1MRCL 2HA1A 3LKNB 2VLLA 1YN6B 2OXHA 1QBMH 5FYJL 1MREH 4CMMB 2PKDA 3A23A 4MRCA 3DO4A 4QJ4B 4GKNA 4U2ZA 3SDCD 2WSDA 3ZVVA 2BERA 3F6JA 2CZNA 4OFIA 3QIUD 4KKAC 2YPKA 5C0BA 5I75B 4ETQB 4Z8FH 4LESA 4ZFZB 5LHDA 2NTFA 4K2UL 5HGAB 2BVTA 4IHBA 5DHYB 3SDXA 1MRDL 3IBEA 3VI4A 1URLA 1OT1A 4ZAKA 4PJGB 2XV3A 4G42A 1OALA 1JGLL 8PAZA 5IIEB 3RVTC 2WXPA 3MRNB 5JUEL 1FZKB 2AZUA 5GRYA 1BXUA 3TBSB 3FSZA 3P2DA 3HFML 5C0RL 3QG6A 2D7PA 2WSPA 3B7TA 4AV4A 3JBG7 3QA3A 1HWHB 4JDZB 3VSTA 3GSXA 5GZOA 2BWQA 1WT5C 1P4UA 3KPMA 2BRQA 3DKHA 3QP3A 4XO8A 3FT3B 4TLTA 1YYLL 3IDIA 1RIUH 4NBZB 4NPKA 4KNUA 2J1XA 4QKTA 1E4XI 4JFHD 1JPTL 1K4DA 4QHLA 4YBLB 3MV8B 5KVGE 1EFXB 2FWOA 4UYPA 5D7IA 4ZW6A 3ROLB 3GSOA 4XO3A 2DMBA 4WIQA 4PGBB 2FQDA 3MN8A 4I13B 1P6FA 4DEUA 4L8SB 4KRPB 5CBAA 2ZOTA 4ODXB 2WXHA 2BSSA 1O7SA 2EVHA 1RJCA 2ATPB 5CLWA 3PWPA 2CSPA 3TBTA 1OP4A 3BAJA 3DX6A 1G1CA 5I6KA 4L37B 4KGLA 2F08A 4IRJB 4YGVB 3VJ6A 5IR1B 5CLZA 1LO3L 3D30A 5A40E 1UD4A 3QIBB 1IV8A 4P2OB 1BQKA 4OQTA 4JQXC 2CLZA 3EF4A 4XAWL 1N5YH 1W91A 1HJBC 3RY4A 1QFOA 1T03H 4KY2A 4A37A 3LN5B 2VM4A 2DQCH 1IBGL 3C5SA 3FB7B 4KZDH 1A21A 4JFOB 3VVVA 5GGVH 1WYJA 3L6FA 3P3TA 4NNPH 2KLTA 2FX8L 1M1XB 2WYHA 1Y7VA 1SZNA 4L23A 1A25A 2KYIA 4DFHA 1KCVH 3SSGA 3MA7B 3BN3B 4EIBA 2ISDA 4C58B 2FZ3A 5ITBL 1D9KA 4JZNA 5DEFA 2OR8A 4BK5A 1KCLA 4XP1H 4GSDL 4UUJB 5D93B 1JHKH 4OSUL 1ID2A 1M4KA 4TM9A 1ORQB 1FH5L 5EU7C 5K39A 3WNPA 3VXRE 3KPTA 1S78D 1TLKA 4HWBA 3U46B 3VXUE 4CVZB 1TQVA 3J2PA 1A6WL 5I1JH 3AS1A 4MX7B 2F19L 5F7EL 1TO5A 2XG5A 3ZYOA 4YN3A 1CGSH 1B4JH 1CXEA 5CIPH 3NJIA 3KE0A 1YNTA 4UIMA 3PL6D 3DWTA 5E1AB 1RK0B 4F3FB 2HAZA 3S88H 1ZTXH 1ZSDB 2WVVB 2I26N 3T4AA 2EH7L 1BG9A 1F4YH 2PR9A 2SEBB 4XH2B 1WV7T 4NUGL 4N28A 3H6AA 2BFVL 3O4LB 3P4OB 4X42A 3K1KC 4FFZA 4IIQA 5EZJB 1QFUH 3QUZA 1TJIH 2QSCL 2WSKA 1E5CA 2VLKD 2XTSA 2VAAB 2WXNA 5B39G 1S7SA 4CADA 5JOPE 4Z7WB 3OWEA 1OWRM 4AYGA 3ZR5A 1WCQA 5ESAB 4OCLC 1I7UB 4L1LA 5LN4A 3T5WA 3NFNB 5IGXL 1ZEAH 3GZPA 4DT2A 1RIVH 2HFGH 3FZUC 4JNXA 1J5OH 5GRXG 1R4XA 2I32A 4NOBA 2E27L 3VFSA 4RAVA 1COBA 2ZUVA 2CO2A 3TXAA 1MCHA 1AXSB 2WXIA 4M48H 4N20A 4G80B 4JPIB 4NJ9H 1OGAD 1HQRB 4QRAA 3MOAH 1QSFD 5J6HB 1KXVC 5B39A 1GSKA 5BUPA 3TVMC 4TUKL 1MHHB 2Z93B 2ID5A 1ESOA 5I1IH 4XODA 2BDNH 3BYYA 2B4CH 4BK5C 5DD5H 2XX0A 3MNWB 1JZ4A 4PBWD 2V9UA 3CDGA 4B6ZA 2ZXGA 2LW3A 5FK9A 3X13A 3RZCB 3UJIL 1NFIB 1ZGLP 4M1DH 1BD2D 4KQ3L 3IE9A 3NA9L 3J8F7 4NQDA 1AD0A 3L2LA 3WY3A 2FEEL 2CXKA 4LLQA 5HJ3A 3S37X 2ZKWA 1WA2X 3CXDH 3BISA 4IBLT 3FU7B 2CCVA 4YWGH 3SBQA 1BJ8A 4MA8L 3QCVH 4LVOC 5D7LA 1DFBL 2A6DA 3OAYH 2Y2WA 4LLYB 1NC4D 1R3LB 2B8OT 1V05A 1FO0H 5DQ9B 4LKCB 1UWYA 1F4WH 5EORH 5D71L 2Q8AL 2IG2H 4M6MH 5FIEA 3VFOB 3T4AC 1Q0EA 4TOYH 3GJFB 1B2WL 2DYPD 4X99B 2VUKA 5E8EB 4P9HL 3IRZA 1HDMA 3NIDF 5E9DB 2GSMB 2NDFA 4MNHB 4B0MM 3D5OF 4P5RA 4YBQD 3VM7A 3KBHE 4NPJA 4I77H 2XTJB 4OB5H 4XCNA 3B56A 2EDWA 4E9RA 3L4VA 3HN8A 2BVOA 2OMYA 3NTCH 3DJZA 4X5RA 1PLAA 5EU4A 4YSEA 4TVPL 3QGVA 5F1SA 5IQMA 2B3RA 5AVSB 4XN7A 3UO1L 3IGUA 1SEQL 4LEXH 1FG9C 3LPWA 3NCJH 4NM8L 3MNDA 1OCWH 3OLEA 5I9QB 3X11B 3Q5TA 1DVFB 2YD2A 5JIHA 2X89D 4I3RH 4WCYL 2AV1B 2GBUA 2B9BA 4NO2A 4N2NA 3SE9L 3UPCA 4B9IA 1UM6H 2QHRH 4QRUB 4FZ8L 5E51A 4AVHA 4AVJA 4C56D 1XH2A 1H8SA 5D55A 2KI6A 2GB2A 3F6LA 1IGIH 2CDFB 4IM8A 4WJ5B 1CG9B 3PQYB 4HOMA 4KUZL 3Q2LA 3ZTNL 4NO0A 5CEXA 5I23A 5LCVH 4TL5A 4DP7X 2J56A 4JG5A 4AXWA 2VAJA 3HN5A 5E2WH 5B7MA 1X6NA 1FFOB 4NKMA 3II2A 3APMA 2OYLA 5JA8B 4XP9L 1H5BC 1MH5B 2P7TA 5C09E 4P2CG 2OMUB 3B9VA 1KULA 4I3GA 3IDGB 5CD3A 1HOEA 1N0XH 1X7QA 3DUSB 2CK0H 1ZV9A 1OW0A 4I9XA 4RMTA 2J1ZA 4Y4HA 5BW7C 4HUMB 4L3EB 4PRAA 3GMRB 5IF0A 1J9RA 1NL0H 4PJXF 2CE6A 4W9DC 4WO0A 2D0HA 2A9ML 4WJG3 2TAAA 2WUCH 4PRDB 3T1FA 3K71B 3FTZA 4X4XA 4FEMA 4KMTH 5E23A 3U7YH 1I8UA 2K7QA 1J8HA 1MIEH 1XT5A 5IBTH 2EDXA 1NMBH 3OV6A 3SQRA 3I3BA 3TN0B 3CSYA 4LSUL 4BINA 3UAJD 2R1YB 1YMMA 2BO0A 3DX9B 1JZ8A 3L4TA 2VABB 2QZQA 3Q2VA 1BG1A 2H0FA 4L9LB 4IU2A 3WSQL 2AK4E 3T8MA 4LVNB 3RGVA 4BCXA 4IBVA 4N2AA 2QHLA 3Q1EA 3RYMA 5HJDA 3JQOB 3VVWA 4FZEL 4Z76B 1ZHKB 4FJZA 3RBGA 3AY2A 1YEKL 2Q9OA 5ECJE 3IS1X 4M7LL 4OGZA 4ACTA 4ZO7A 1MCQA 4JE0A 4ZX3A 1G7HB 1FP5A 3P4NA 5E00B 5A7BA 2XOTA 2X4NB 3T8XB 5TDPB 3DRQB 1AZRA 3UAFA 1YYCA 1KJVB 3BT2H 4KU1A 4FABL 4TTDC 2ODIA 1NCBH 2VKXA 4PJCB 4U1MA 1NMCC 1J86A 4MKMA 2HH0H 1AR1D 4NQEB 2NW2B 4M43H 3UMTA 1T83A 3G6DH 4NZUH 5BXFB 1NCHA 5TJWK 4D2NA 2WTRB 2J1WA 1IGFH 3ZT6A 4NP9A 5EV7A 3WEBA 3Q2NA 3JWDH 1HXMB 5FB8A 2XKUA 4Y4HC 2XFXB 5ECGA 3MPCA 1HHGB 3N43B 2IBZX 4APXB 1MCRA 3O11B 3LS4H 4RGMB 4KXZH 4JRYB 5DLML 1E9PA 2XWCA 3BX7C 5BO0D 1GJIA 1RHFA 1ZHNA 3RVUC 3QEGL 5JDSA 4Y16D 4DP4X 3G9VA 4X6EA 3ZKSD 3AXLB 2GCYA 2X6BA 3ZHNA 3AACA 3HNTL 4C4KT 3L7FB 2QPSA 2Z31A 3OJDB 3DRTB 1CGXA 3HBPA 3LDBC 5CIPA 1NEUA 4KI5E 4ODVL 1G7QA 5HPOA 3B7UX 4G8EA 4KK8C 4I1RA 5C2BL 1JXJA 4ETYA 5I2IA 4F8TA 4FAAB 1QUPA 3MA9H 2JKNA 4CDHA 3KMDA 3QQDA 4IKLA 1EZVY 3DI3B 1OK0A 1XL4A 2H26B 5DMKA 4AQEB 1BWWA 2CKBH 3GZKA 3P9LA 2C3VB 3U82B 4U31A 1NDGB 4ZUUB 5D5MF 4DVRH 1W6WA 3MACH 4OZ4A 4AMKL 3SGKA 4CC4A 2R7EA 2VWEC 3NFSL 4D8PB 2DQ6A 1VDGA 1RSYA 3EOTH 1MHCB 1ROCA 2A99A 2AEIT 4ZD3H 1NGWA 5E6IA 3OAZH 1X3DA 2QKIA 3TTYA 5ABZA 3KPLA 4GUCA 1Q9KA 5C07E 5ICXB 1AGDA 4C4BA 5INCA 3T0BA 3IU3B 4MJ6B 5DA4A 4WUUB 2X4OA 2I9LB 1REIA 1CT8A 4QRPD 4U3CA 2WB7A 1FLRH 3INOA 1KGXA 1HNYA 1LLAA 4N26A 1EHXA 1HL5A 3LZFL 2ICEB 4KZEH 3VD1A 1BX2A 2F15A 4K8RD 1MJ7L 4LBAA 1CTNA 2YBRA 3R4RA 3GJFK 4OGXH 3MZGB 3EJTA 2IH1A 4AJWA 4JRWA 4Q89A 2R69H 1BMGA 3BPLB 2IPUK 1EXUA 4PGDA 1VKXA 3CK0L 3MRKA 4IBTA 2JJWA 3IJSB 1ZV2A 1MCWM 3GUTB 3WI9A 4AENB 3WL9B 1JL8A 3MQIA 4H8WH 1JTOA 4Q6IA 4RMQA 3VWKD 3WTXA 1H3XA 4NCDA 1T5WA 3EG9B 3PJSB 5F7AA 2HTLD 2B1OA 1HKLL 2UY7B 5T1KA 3UOAB 4BJLA 3D05A 1LM8V 3B3BA 1SN5A 3W0WE 1QLEB 1I1FA 5DR5L 1GC1H 3MROA 1XHHA 4MJIA 2YPVH 2ZWYA 2OA9A 1Z5HA 1JF1B 3SKNA 4MA3A 1FO0A 3M1CA 1T22A 3EGXA 4TUOA 3SY0A 4R8WH 2N4IA 1MDTA 4K3DH 2IH8A 1WITA 4YDKL 3TNMB 4DP0X 4IBUA 4CBZA 4ZUTA 2H3KA 1N6QH 2F58L 1HZHH 3MFFB 3V7AG 4KROB 1RPUA 1VPOH 2UZIL 2V5RA 4R2GC 1F3DH 4WI0A 2CNZA 1SM3H 3MRBB 4CC4C 3BUBA 3HPLA 3T6WA 4P8QA 1L3WA 4IS6B 3KLAA 4PB9H 3WY4A 4BIKA 5F88A 4ZXBC 3VRLF 1GR7A 1KCRH 1ASPA 4E5XG 2QKIC 4DZBA 1NKGA 3SO5A 2FB4L 3BVDB 1LP9E 1MFCH 1DQLL 3MODL 3PGFH 4YHLH 5IEHA 1MFMA 2EDEA 3QFJA 2J7LA 4RGND 5KVEE 2XBTA 2EO9A 1NIDA 1P1ZB 2AXHA 3MLVH 2JWYA 4DK3A 1N0LB 2ZWNA 3TZVD 1S9KC 1KYOK 1OPOA 2WZ6A 4RISL 3RIAF 2GUOA 3Q8BA 4PJDB 3AITA 1T2QH 4RVBA 3LQAL 2XXGA 1M71B 5EF2A 3IE4A 4WI9A 5AZEL 4CNIB 3MMEA 1OAQH 1VGKB 2B4CC 3UTQB 2NXYB 4WLCA 4E5XA 1MF2H 3EFFA 2KH2B 5C0CE 5I1KL 5EOCH 3C08H 3WO4B 2VXQL 1LEGA 1PLGH 2NX5E 2X4PA 2Y7LA 4WKXA 1ES0A 1UZ6F 4HJ1A 4GKSA 4NIYE 4OZGB 5BVJA 4ZO9A 4OFVA 4Q0XH 5LCVA 4LCCA 3O81A 4BFNA 2UWEB 3MV9B 1WC7B 5FYJE 5G4NA 2PUQT 5CJQL 4BZ2L 4UM9A 4RIRB 1FNLA 4CKVX 3TYFB 2JIXB 5IKCA 3R7RA 2P44B 4POZD 4DUVA 3SDAD 4Y8AA 4XZUA 3QQ3B 2BVPA 4GBXA 3I02A 2XKNB 1JRHH 4UDUB 3FT4A 4TSBH 4BQCA 1T7VA 1IGCH 3ATDA 3S5ZA 2CJSA 2HRGA 1PX3A 1R6VA 4LASH 1LDPH 1ULVA 3VGBA 3S3JA 1HWGB 4F2MA 4UQ2A 3P3UA 5D7JA 4G3YH 4MJHA 4U1NA 4MNQA 4B53A 3QYMA 1KLFB 1X5GA 1JFQL 3LRMA 5JHAA 3ULVE 2DL9A 5EHFA 4O9HL 5CP3A 3SBPA 5IROD 1DO5A 4B9FA 4G1MA 3KGRA 3BD5A 1IGTB 4ZZKA 4PS3A 3BAWA 3U4EB 5I1CL 4OLXL 5AOIA 5E08L 2QLVB 4L4TD 5F7MC 4V1DE 3KYMB 3U48A 2DYRB 3WKPA 1IC7L 4F7PB 4LGRB 3RDTB 4AQZA 1BXXA 1KFGA 3X3FL 1U8KA 1O75A 2BP0B 2DWXA 3AU0A 3EF7A 1XGRA 4MDIB 3CJJA 5A2IH 2ZUWA 1KIRA 3AS3A 3GBEA 4L18A 4JFDB 5AW5B 3QK0A 4XBGA 4BDVA 2EYRB 4HUUA 4JPKL 2RHEA 4X5XB 1AIZA 3JZ7A 1A7RH 5A43C 3OG4B 3MLZH 1KJ3L 5AYQA 5GIRA 5IMKA 3EO1A 3U9WA 1M05A 4QRRD 2X7LA 3QAZB 1OO2A 2BC4B 4GP5B 1NTDA 2ZKHL 2ZX6A 4LCCC 3UCRA 1BQHG 3S2CA 1IT9H 4GP8B 2NY1C 4KJWD 5E0FA 1BWMA 5BV7H 2A6JA 2DIJA 3KPRD 5SWSE 1MLCA 1OAXL 3ZMEA 1Q1JH 5HY9B 2YA1A 3RWHA 4NRYB 3HLAB 3INUL 5D2LA 5FOBA 4I18A 3KGSA 1HYSD 4NSKA 4GBXC 5ICYB 4HIQA 2AJUH 1VEOA 5IW1B 2AAAA 3VFUB 2ICWA 2HJFB 5TQ2H 1YO4A 2A6IB 4RNRB 3RWDB 2WHVA 3GBDA 4H2CA 1GZHC 3QZOA 1O6SB 5CINH 2HWZH 5D7JC 4HH8A 2Y06H 2EEDA 2WUBH 1EO8L 1BQHA 3JYCA 1JGVL 2OYKA 4JVUA 3V4VB 4B50A 3KL5A 5FWQA 5AB0A 3HB3C 5ID1B 3TEYA 4LNRA 3VI3F 3UMNA 4DN4L 2HT2C 3L3DA 5F3HA 2ALAA 1X7SA 4POYA 1S7WB 1L0PA 3JWNC 4QO1B 4GUPA 2LFEA 2FE0A 2F54D 2WP3T 2A9CA 2AV7A 5FGBA 4IOSA 4M7JL 4QIRA 4R7VA 3FSVA 3K6DA 1T7ZA 3ZO9A 2CKBA 5D4HA 3FFCE 5IMMB 4C4KO 3U1SH 3VH8A 3HZVB 2YD1A 5DJZA 4Z3GA 3L3OC 3T77B 1C5DB 1MCSA 2C7UB 4I1PA 3CLFH 2DI8A 5ADOL 1EERB 2B39A 4P59H 1NBYA 4IMLA 3ZKQD 3TCLB 1MWOA 5JPMA 3NEEA 5DD1H 5A2AA 1FNHA 4NHUB 4BELD 2WQ8A 1N7ML 3N9GL 1YPZA 4JFXB 4PJBF 4WWKD 4XVUD 4P99A 3W9DB 3IFNL 4QXGH 3IVKA 5E5LA 1FL6A 2C8NA 3DVFA 3Q01A 2EZ0C 4NQVB 2DQGL 1GHFL 2DDQH 4OBRA 3BWAB 4AZ8A 4GQ9H 2EYSA 4S11A 3HRZB 5J06A 3K6SA 3ARDD 5DT1H 4NWTL 2L0DA 5JXEC 3SDCA 1VSCA 2YFNA 4QAMB 1EEZB 1PZUB 3MCLL 4PCSA 3OKMB 5I5IA 3SEPA 5FECA 3CDFA 2R0ZH 3NJJA 4JFFD 4QT5B 4JPSA 2R69A 4I18C 4PRBB 2EE0A 5B3JF 3GBNL 1YYML 3ES6B 5CWSB 5D9SA 2IDTA 3PP3K 6FABH 1F4XL 4NQCB 4PRNB 5B22A 1U8JB 2R39A 3ZDXF 4BZYA 5I18L 5ISZD 2GBAA 1SHXA 2GJRA 3MAWA 3V5DB 3ZSTA 3A24A 1FN4A 3I6LD 1PZBA 1INEH 1GS6X 1WZMA 4XCFH 4N3TA 4ONFL 2B5IB 1KF9B 3PWJB 4FFWC 1C5BH 3L3KA 1KN4L 2HFFA 3I75B 3RTQB 2P3YA 1XCTA 5C9JB 1F8TH 3CLWA 4Q74A 1XGYH 2YPVA 3NP3A 3RWCB 1RMFH 5JW5A 1JZ2A 1E42A 3KLSA 3AREB 1FORL 4JRXE 2EECA 1MHEA 3CDZB 2J5LC 4GAGH 3GNML 1HC1A 1HOCA 1IARB 1FNEA 1UXSB 3FF7A 4R0LB 2C3WA 4OCYH 2YRBA 4TULH 2KZKA 1E90A 4EMZA 4GT7A 4NC0B 3AG2B 4Z0BH 5TFSH 4X4YA 2FIKB 1AYOA 5F8RC 4A6YA 4M6OH 2A3TA 4AKOA 4PJFE 2I7SA 4MHHI 2CJTA 4POUB 1GGBH 2YR3A 2DQFB 1RUQL 2XA8L 5H35A 3MRCA 5I8KH 3JV6B 3EOBA 2D7OA 5D7KE 3P69A 4XN9A 4BWUA 3ZTDC 1F58L 1KUMA 3H4FA 2WGXA 1A6VL 2Q1EA 5LKNA 1BZ9A 4FE9A 3P9MB 1TTRA 2XETA 3DUUA 4AY0A 1AQMA 2OJEB 2VC2L 2XWJB 1G7MA 4P3CL 2MTAA 2ZSVA 3RG1C 1JXDA 1QA9B 3EO9H 5E2VH 5KN5B 3WMPA 3ILPA 4OF5A 1VZGA 3SDCC 3T0EE 3KCPB 2BXZA 3VMOA 3W37A 3KGUA 4GP4B 3QIUC 2WLZA 2NYYD 5J13B 4N8VB 1UJTA 5HP5A 4W68A 3FFDB 1NGXB 3D18A 3ZZSA 2BM3A 5IVXE 1HI6B 1RXLA 1VFAA 3VD2A 1TZIB 2EAEA 5CU9A 4WEMB 4H8WC 3C6SA 2YKKA 4OZHE 5FFOA 4F37F 2FATL 3VSVA 5JR1H 4CJ1A 2R2HA 5JO5B 4HWBL 2DYSB 1L9SA 4NAQA 2VNCA 1CB4A 2YAQA 3T6ZA 2YS4A 2CCWA 3IPEA 2UVFA 1GYWA 4P2RE 3MUY1 3SYPA 4RMVA 1AY1L 2EIZA 4WTWA 2WQSA 1QZNA 4WEBL 5HYSA 4JR9H 2BSTA 4AH2B 1Y0LA 1ACYH 4YDJA 3BPCB 1JZFA 1UXWB 5I6XB 1SYVA 3S96B 2X3CA 4YDIH 3QNYA 4IBYA 4WNQB 3TH2T 1G87A 3PABB 1JJUA 1SHWA 3NJLA 2PCFB 4A7VA 1OLZA 1DQIA 4NUPA 5I0WA 2VLKA 4FFZL 4WGVB 2GK2A 1ETZB 4BE6A 4RWYH 2XN1A 4KJPD 1XF4A 3UZQA 1UJ3B 2B7DT 4NUJB 3V5HA 2C3HA 2QTEA 3P0GB 1XGPA 4NZFA 2HRLA 2AVGA 2X1PA 3V0VB 4LSTL 5DDHB 2R56H 3DI2B 5IB1A 1O9WA 1BQLH 3O2WL 5DQJA 1BXVA 5MI0C 1N18A 3E1ZA 1S3KH 1QYGL 2HJKB 2YD4A 2GT9A 1I3RB 2LLLA 1KTJA 3A6BH 1OGAA 4IEFB 5K9QI 1HE7A 1AGBB 1QSFA 3UTZA 2WKOA 3STZB 2V9QA 3OXRA 4H13C 3T0DA 2R59A 4XMKL 5DC2A 3VMPA 1QRND 3UAAA 3QUKA 4PJGE 4LOEA 4XXCA 5DYOA 3WIIL 3E38A 4QMEA 4CSSA 4F7TA 3US1A 3UYRL 4Q14A 2ORBH 3JTTA 1L7IL 5DUBB 3RBSA 4LLAA 3DVGB 4J39A 3U79A 1O7DC 2AJZB 1E4JA 1BEYL 2ESVB 2YPLE 3FAWA 4IRSB 3S4SB 3U4KA 1A66A 3K7UA 3V6BR 3L1OL 4JUSA 4OJFH 3P77B 4DKTA 3CZFA 1KZQA 3L9YA 2FBJL 1MOEA 2APWA 3IXTA 1T80A 3DX1A 2ERJC 3B43A 4MMXB 3HC4L 1TITA 1U8QB 4Y89A 3VWJD 2O6EA 5DEJA 4H0LC 4R5TA 2C4XA 3MTXA 3VXSA 3PL6C 1NC4A 4BA0A 2ZCHL 3FU5A 3MV8E 4K5PA 3FUJA 3VGAC 1HX0A 1D6VL 3QDGB 4O5LH 5IB4B 3ARZA 3C8KA 5D1XB 4EZJA 1YECH 3I9IA 5A2KH 1OQOA 2DYPA 5LBSH 2AVFA 4S0TD 1ZT7A 1XMWA 2DD8L 1EK3A 2XQ0A 5FAAA 5ETUB 5D2NC 1IE4A 1U3HB 2YJQA 3QCUH 4WI6A 5I30H 4OR1A 4O51B 4WGWB 5KSBF 1PZSA 3KH4A 3RY5A 4BSVB 2C1PA 5IG7B 4HUWA 5D6DA 1X44A 1MFEL 1QFWH 3SDDD 4NNXB 1DBJH 3EOAA 3NQIA 3ASNB 4N1CA 5JW4N 4U3SB 5LAXA 4U1LA 5I1DA 2HG0A 4J3TA 5LG1A 4TNGA 1QQDB 3HS0A 2P8PA 3DIDA 1G9MC 3QUXD 2ZYRA 1KGWA 2F5BL 1FZOB 4Q2ZB 2VDPL 4X6CB 3U25A 5A2BA 1XF5A 2VE6B 4WHYH 4G6KL 3FQTA 3BAEL 2O1AA 1K72A 3X1FA 2OXGB 4YLQT 4XWGL 2O5NA 5EU6B 2OP4L 3LMJH 3IFPB 3QRLA 2YO3A 1R5WA 1KDIA 1LQSR 2YUXA 3QQ4A 1E27B 4UTAH 2WP3O 3IWUA 2OCCB 2DQTL 3ALWA 4S1QL 2VDKH 2BRRL 3G5ZA 4C56A 3L1GA 2DEXX 5E99H 3BUQA 3NZSA 2ALWA 1Z9SA 1RUAL 1I9IH 1RZ8A 3ZBMA 4GS7B 1TOXA 3B2XA 7PCYA 4JFEE 4TYUA 2W60A 1AMYA 1U8PA 1NANH 3FJTA 2XIIA 2G5BA 4MCYB 1XF2A 4UT7L 1V54B 4ELMA 4HD9A 1QBML 3S5LG 3WE6B 4PGJA 4EPSA 1Y18B 1CYXA 4NN6B 4BWTA 1MREL 3BPNC 2Y0SA 4DP2X 1U8LB 3D52A 2P8LA 3WS6C 3UG4A 4DESA 2GK0A 4FNLL 4W9KC 3V95A 1ADQH 4WTZG 1JG9A 3VRIA 2WLYA 4YDMA 3VTMA 5IOPA 2H32B 1A4JA 1J1XH 3FDWA 2DKMA 1K8IB 2MOGA 4HS8H 4W4OA 3QCTH 4Z8FL 1OAJA 2C4FT 2F5AH 5C08E 3HVNA 4X7TB 3QEHB 4XOBA 3MJ7A 2CJUH 2RIKA 4Q9BA 3U36A 4LOUD 5I73B 3IF1A 1Y1UA 3SKOB 3WNLA 1JSYA 3G6JF 4L3CA 4HDIA 5F97E 3S5LA 5EPMA 3R1GH 3VXRD 4RFOH 4YBQC 3QQXA 1A9BA 2Y5TA 3H7LA 3VXUD 3T2QA 1A22B 1RUKH 3FN3A 2R9HD 2RJMA 4WTZA 4WI8A 5TH2B 5D4IA 1TUPA 3L3HA 3UAJA 1QVOB 2OR7A 5D8JH 5KYNA 5H2BA 4R5XA 2XU9A 1RIUL 1FPTH 4N9GA 4ADJA 2PWFA 3LQMA 4YNYB 5L2KD 1JWSB 4XNQB 1T1YA 2GFBB 1IILE 2KPNA 1A1NB 1JV2B 4OF3A 2F8IA 2KQMA 4GY4A 4U4BA 3F7RA 3H4HA 3LIUA 4AOFA 4BZ1H 2XXCB 1BFOB 1FHNA 5EH1A 2GHWB 4HCRA 1KTBA 4HKXA 3UBXG 5HHQB 1JZEA 4N6QA 3EYFA 1FQ9C 1DLHB 5A16B 5KYXB 2GAZA 1G5AA 1ZLUH 1NKRA 3VFPB 4JB9H 5DFAA 1QR1B 5K9KA 1IEAB 3HKZA 3T0AA 4NDMB 2FT6A 1UD5A 2VH5H 3L9RA 4L05A 2G3XA 4U3HA 1N5YL 2BJML 4Y5VC 3WELA 3RX8A 5AVWB 1T03L 1MW2A 2HTKC 4OGAD 4X6DF 5IK3B 2DQCL 1RZJC 5IY5B 3GMLB 2GY7B 4URTB 5GGVL 2BCMA 5JMOC 5L8LB 2NMSA 3MXWH 3M1OA 4NNPL 3VXTB 1W72H 1HHJA 3UBXA 2WXLA 1KCVL 1TJHL 2AJSH 4TMPA 5ICZA 1YRKA 2EIEA 4NGHH 3LPFA 4NS0A 4W4OC 3UL4A 3WTVA 4XP1L 2LTQC 5FF6A 2TSAA 1HZKA 4WQOA 1JHKL 2NTSP 3Q44A 5CSGA 4BE5A 5BJTB 3DNKA 3MLRH 3OKNB 3LV3B 5GRWA 3ARGD 2FO1A 3LRKA 3FNKA 5I1JL 3KDMA 4UAHA 3D0LA 4PJ6A 2LV4A 4J5VA 4N90E 5F21B 4R7NB 3KEDA 4XR8C 4AQ8A 3CSFA 5GRVL 3GD1C 3UAJC 4OVVA 2CGYA 1TCRA 1A6AB 3S88L 3CFMA 1ZTXL 5EBMA 2EC9T 2KZWA 3VDBA 3V6OE 4GRLD 4CA4A 1IJ9A 2NZ9D 1F4YL 5I6PA 1TU2B 2NY3C 4PVNA 1A9VA 5SWZA 2JXMB 2P48B 2ED9A 4FDWA 4R4NC 2ARWA 4PLKD 2FR4B 1S9XA 4JM4H 1QFUL 1TJIL 1G7JB 3FMGH 3Q8AA 4OF7A 2A83A 3ZW3A 4TUJB 3TNNB 4DO5A 4I2XA 3R06A 1GYCA 2AKRB 2XY1A 4OH2A 2XZAH 5CEZH 4DPRA 3TASA 4QTFA 5KYUA 2B59B 1LYQA 1RIVL 2EYTA 1OSYA 1W9XA 2HFGL 3NZHH 1J5OL 5LGHH 3T6VA 5AW6B 5C2UB 4QRPA 1U93A 2Y6SD 3PV6B 4IRZH 4FNSA 3T04D 3VE0A 4M48L 3JZYA 4LOFA 3T65B 4HQQH 4NEHB 3KXFA 4PB0H 1BLIA 4MSWB 4X7CC 5L0QB 2EEFA 2BIQA 3MOAL 1RFDH 2XVBA 3CFKB 1CBVH 3C12A 3FF8A 1S7RB 1PS3A 1ECZA 2WWNA 3FB5B 4L3EE 3V4PB 1PJWA 1G7PA 2N0MA 1PJ9A 2BDNL 4JM0A 4XCEA 2B4CL 2KPWA 1XCQB 5IVOA 3PDOB 5DD5L 2YA2A 4PRHB 4KZCA 3MRJB 4GMTH 4OFYA 1Z66A 5C0DA 2G9HA 3ZKXB 5E70A 3FYEB 5CEYB 5T3ZE 4HHGA 1SXBA 1CFSA 2ITFA 4HJGA 1W15A 2R1XB 4M1DL 4MMZB 4NRXA 1YY9D 2B2XH 4Y16C 1JK8B 3IXAA 3ARUA 4HD5A 4XZ4A 3SQBB 1OTTD 4PJ7A 2AK1H 2BOBA 4WHTA 1BW8A 2DV6A 3N42B 3O9WB 4GOSA 3CXDL 2P42B 3HUJF 1JYNA 3MSPA 4OM1H 1KIUA 2QQQA 4AYFB 2VIRB 2KS0A 3ETSA 3CC5B 3NRFA 3QCVL 4HZLB 2XC8A 4RDBA 1OT2A 2VL5B 5DFTA 3NZ8A 5ANMA 3U2SA 1JVKA 2GW5A 3QDHA 1FO0L 1M7DA 1JN6A 1DSWA 4P3DB 1U4FA 3TO2B 1F4WL 5EORL 1HWWA 5MEPA 2IG2L 3MRIB 4M6ML 5LBSA 1BMZA 1GL4B 2R0WH 3BZFB 4PJEA 3VXMB 4TOYL 4WHYG 2VMFA 4K5OA 1WD9A 2ARJA 2VQ4A 3ARBA 1FNSH 1PYWA 4EXPX 1OT4A 2GI7A 3WDJA 4HHAB 2I60H 4E42B 4ZMZA 3BZ4A 2ZONA 4YSUA 5F70A 1XXFC 3BWSA 2BWIA 3BEWB 1WLHA 1MWAB 4OB5L 5GHWH 5GSRB 1OVZA 3P3RA 2ADIA 4HWUA 1DDHB 4PJCE 3F64A 2WAQA 3V0IA 1HHHB 2V0AA 4AMXA 1MVYA 1CQKA 2BNRB 3KLQA 4NQEE 1FFPA 3WKYA 1KJMA 4LEXL 3F5WB 5JIQA 2IMMA 3IJ9A 3ECVA 3NCJL 3TZVA 3W11D 1T1WB 3V6FA 1OCWL 4K8RC 5F1NA 3ME0A 4U6HA 4KI5F 3R4DA 2WGNB 2D8KA 2GKIA 4PJAE 5DJAB 2AABH 4YVNA 4UTAA 3L5XH 1T20A 2VLJB 1FBIH 3NT0A 2WZPD 3CHOA 4TQ8A 3QO0B 4DHLA 1UM6L 3REVB 4JRYE 2GY5A 4U6XA 4HK0B 4JW3A 3LKQB 3FB8A 3IJ8A 3HE7D 4J4PD 5EIVA 3HVDA 3KYOB 5IJCC 4XN8A 3HFFA 1G0XA 4LCIH 4FC3E 1IGIL 1H0DA 3VWKC 4MB4A 3GS7A 2XYBA 3UZVA 4F9LC 1P2CB 2WINB 1KLUB 4PBVC 1V3JA 2NNAB 5LCVL 2NW3B 1ZT4B 1GY1A 3BWUF 5E2WL 3ZUNC 4EE2A 4LEBA 3CPLB 1VGEH 4AEHH 4AQ1A 1NCOA 1ADQA 4GFXA 3ZKND 3S3SA 4QF1B 4DPBX 4L3FA 4U1IA 1FFNB 3SDAA 5A6LA 4PV9B 3AQXA 2VRKA 1N0XL 1VADA 4AGLA 3KZ8A 2CK0L 4UU9A 1JPGB 1R3IH 4XP5H 5CCHE 4NRZA 2FLMA 2J72A 4N9OB 1IBFA 4PEEA 3GXMA 4AZUA 3ZHDA 2Q3AA 4U1SB 1MY7A 3Q1SH 4F24A 1NL0L 4LDEB 3NOIA 3NFPA 4U6VH 4OI8A 2WLHA 4XXDA 2WUCL 5FDWB 3GI8H 1QI3A 3AG1B 3BZEB 3FTSA 4G8IB 3ZGHA 1VZIA 4KMTL 3UJTH 5IROA 4RBPH 4NQTA 4WUUE 1MIEL 1E3ZA 5IBTL 1NMBL 1X5YA 2YAFA 1XR9B 3VX1A 4N24A 2AQNA 3NSFA 1L9NA 4FQXA 4RAHA 1E4KA 4L4TA 4KI5D 4UQIM 4G1EA 3VXNB 2VXTH 1HH6B 3QXWA 1WUZA 3AB0C 3WXWH 3NPSB 3O8XD 5I76B 3ULUF 3K4ZA 3V5KA 4PJ5B 2BVEA 3FOMA 3L5IA 4K7FB 4M4RA 1ZD6A 3RX5A 4BZ1A 3O3UN 4QOKA 4KPHH 4HBQA 4P2YA 1A3LH 2ZOLB 4PVBA 2FJHA 3R8BB 2Q3ZA 5GGTH 1A8JH 2AJYH 3A5VA 3NCFB 4O2FA 3FB6A 3QDMA 2F1BA 4IKKA 1FAKT 3BE1H 2N01B 1T21A 3QJOA 3TU6A 5C6TL 3LPOA 1BPVA 1BQUA 1MSPA 2Z8SA 5C07D 3ALXA 5GS1B 1CE6A 1IKOP 3BT2L 4G72B 4XHJD 2IH9A 3CFIC 1NCBL 2E56A 3N44B 1XEUA 3QZWG 4GKZA 2L7UA 4CVUA 1IQWH 3HEIB 4G7QB 2JI3A 3G5XA 1QFWM 3BIKB 4M3JA 3KPRA 1OD7A 4QHNB 4U49A 3WOVA 1W72A 4M43L 4NZUL 3QZNA 4MVBD 3D0VB 4POZC 5C0IA 3QPQD 3SDAC 3TOPA 3QUMB 3QPXH 3S8FB 4X9YA 2X40A 3L45A 3JWDL 3OR6B 1KYUA 1G9NH 3EHBB 2QADC 3C5ZD 2RCSH 1BVZA 4RSYA 5E8PB 3LS4L 3HE6D 2XPYA 3BRDA 2OMWA 1DE4A 2YMXH 1OSZB 3QZWA 3B5GA 3NA4A 2B15A 1E9QA 5B21A 5BNXD 2LE9A 1CBJA 3HNVH 4G9DB 5AAWC 3WCYA 2NXZB 4ZK8A 3OR7B 5HPMA 4KXAA 3H9HA 1H8LA 4MZIA 3ULUD 3W0WD 3BPOB 5IJVB 2CG9X 2F54A 1E4KC 3AAZB 3C2SA 2BH0A 2CUAA 3MA9L 3EGSB 3NK4A 4NFBA 2OMXB 2L3BA 4PJDE 3MLUH 4HOXA 4WV1B 5DHVH 3GXNA 4M29A 5TQ0H 2HVJB 4ONHB 1GGYA 2CKBL 1UWXK 3LH8A 1T0OA 3EYQD 1UWGH 2P8MA 4QYOA 1H15B 2J8UB 3QZLA 3TIDA 4ZW5A 5KVGH 5EEVA 1XIWB 4DVRL 1ZHBB 3RKPA 3MACL 1PLCA 1KGIA 3E9UA 3CZLA 2VKWA 1H9DA 2X4RB 2WVTA 3QEUB 4U1KA 5GZND 4R97C 1W0WA 4Y5YA 3EOTL 4P23C 3QORD 1OM3H 4ZD3L 2PYEA 4OZGE 3QIWC 5SWQB 3HOGA 3LKRA 2HUHA 4OZIF 4L2LA 2UWEE 3E8VA 2ATKA 4HEME 1RAMA 3RNQA 3MV9E 3PDGA 4XVSH 2VQ1B 2AXWA 1H8NA 4IRZA 4DAGH 3O2DH 1AGFB 1DZBA 5CN2A 1FLRL 1G7IA 1M6OB 4KJWC 3ULVF 2CGRH 4DVBA 4RZCB 3ECQA 1TQSA 3NJNA 4R7DB 4KZEL 2NT0A 3V6ZA 1KB9J 4BHUA 3CBKB 5D1QA 4Z9KB 1U95A 1A6TB 2NY4D 2OMZA 1SXAA 2X3BA 4M7ZC 1IM9D 4OGXL 4LPTA 3FN0H 1HYSC 5IQ7L 3E6HB 2R69L 3T3PB 2VOTA 3HBQA 5JLZB 3LJ3A 1AFVH 5GRJH 5TK2A 2AQRA 5ISZA 1VFBA 5DC9B 2CRYA 1A9EA 4JG1H 5DVMA 5LNGA 5I0DA 5IW6A 5C0CD 5LGJB 3VFRA 3MJ9H 4H8WL 2E7LA 4R90H 2I69A 2WXOA 3BH9B 5F0PB 4GQQA 3WJJA 3L2NA 5C0GB 2BXYA 2ADGA 4G8FA 3BP4B 3CXFA 4ABVA 5IMOB 3T3MF 1OGTB 1NINA 5FYJD 4R96A 4XB7A 5CCKH 1GC1L 3GMOA 3QH3B 2A9BA 3FRUB 3EO0A 1SY6H 2YPVL 2ICWJ 4U7SA 5DJYB 3O3DB 4Z7OF 3L4ZA 4YQXH 4R8WL 3LRSA 3GTVA 4GLRH 4ZW8A 1CK0H 3E6FB 4K3DL 4PREB 3L7EB 4DGIH 5B8CC 2XG4B 3FCUB 4N2OA 3HAEH 4U1JA 1A4AA 4XOEA 2F7RA 5DSCB 1QUNA 1N6QL 4JN1H 1ET8A 1HZHL 5BCAA 1NCNA 1VPOL 3SPIA 4AKQA 4A6YL 1SM3L 3BP7A 1R5VA 3W9EA 3A6OA 3F3HA 4PB9L 1HSAA 1KCRL 3ULVD 4WWKC 4XVUC 4YE0A 1XXDC 4FKKA 3NJMA 2YXWA 1XAUA 3QZMA 2G9KA 4HSAC 3PGFL 1MFCL 3LXUX 5DRZA 4YHLL 4HJ0D 5EFIA 3P4LA 4IOFD 5TGBA 5I28A 2IWGA 2FD6L 3ZK0A 1MI5B 2G4EA 2LGNA 3ARDC 4L4VB 4OD1H 1U30A 3BH8B 32C2B 3JVGA 3MLVL 3VG0H 1DVZA 1R46A 3LH2H 4JY5H 4N86A 3FC8A 1R0AH 5AFAA 1T2QL 5F9JA 1VACB 2HVKA 2WN2A 1FVDB 4LQFL 3KHQA 1PZ5B 3QI9B 4HV8B 4QRQA 1OAQL 5HYQB 4F7MB 3HG4A 1MF2L 2UZXA 1KB5B 1G43A 2C3XA 5AVTB 4RFEA 1ZWIA 4LLMA 1DUYB 3BRGC 4F91B 3C08L 3RJOA 1PLGL 1JHTB 3AWEA 4EDWH 1DEDA 2EJ1A 3BIAX 1A6ZA 4JEGB 4Q0XL 4URKA 3KPQA 4E41A 1JI1A 3WJJC 5L4JA 5E9AA 1IVLA 2RTTA 3D3VB 1H3PH 4K7PY 2XN0A 1AKPA 1YEJH 3RKDC 3VCLA 1T0MB 3EJQA 4M4PA 1NDMB 4LLUA 1YZZA 4JPVH 3WN5A 1BSIA 2LAGB 1HXYA 1J1PH 4FQ1H 4MD4A 4X7DC 5HHNA 1VEPA 4TSCH 3MBWA 4K7PH 2VN4A 1XSKA 4WFHE 1ANUA 3N1PC 1JRHL 4TSBL 2UXTA 4JFQA 1IGCL 5AW8B 1KG0A 3N40F 3NCXA 1F3JB 2WK2A 2VDQH 3P4MB 3HG1A 1LDPL 4LASL 4RZKA 3AQYA 4TL4A 4YGAB 1XB8A 3TO4B 4JCWA 4G3YL 1JF5A 2IPKB 2D9CA 1P7KB 2VLMD 5IBUG 3UG3A 5I19L 4W9HC 1F1AA 1NC2D 4I3SL 3VNZA 1QWHA 4JHWH 2ITCB 4JO4H 3EGDA 1YN7A 4NENB 3RWEB 5A2LH 2VT0A 4J6RH 4X9FA 4ZBJA 3QT2A 1F90H 1J8HE 2X09A 3PWUA 1G7LA 2N7AA 2DQIL 1A3QA 4BD4A 5CD5C 4MAZA 2FEDD 3C9NA 4KITB 4UNIA 3MNVA 3ZOAA 4EN3D 3QR0A 2E7MA 3NMEA 3RGHA 4F1SA 5L2JA 4AIEA 1F3DJ 2JB6A 3HC3H 5F9OH 1GZQB 5JHDA 4Y19B 4JY4A 5L0QC 2NYYC 4NHCH 1QFHA 4NQCE 4IDLA 5GGTA 3B7SA 2B14A 5AW4B 2ITEA 2IC2A 3AM8C 3AMKA 3C60D 3UZEA 1ETJA 1I8KB 1DANT 4QXTA 1NM4A 3LIZH 4P2QB 4OCMC 3G5WA 3M88A 2HJLA 5JW3H 2H4EA 4BH7A 1A7RL 3LQZA 3MLXL 3LXBA 3MLZL 1WICA 4M8UA 3NJKA 4PJFF 43C9A 3RURA 5F7KC 2A4CA 3IJEA 4P46B 1ZA3A 1IT9L 1NFDB 4PY7A 4XE5B 5BV7L 4QRTB 3WJLA 1S9VB 2MCMA 3VWJA 1EEQA 2XLLA 4Z3IA 1Z3GH 3LS5H 1Q1JL 3TVMB 5LG6A 2P9RA 3QRBA 5DI8A 2A1WH 4EVNA 1XB6A 1I31A 1CN4A 1V8HA 3AMLA 4WTXA 2AJUL 4E2OA 3BEVB 2C9XA 2PO6A 3KM2A 4WNSA 2XZQH 2V2WB 5TQ2L 3JV4B 4R4BA 2VN7A 1YC8A 3GLAA 3D4YA 1THCA 4PTUB 2DLFH 4PV8A 3V8OA 5CINL 1G4MA 2HWZL 2Y06L 1ZXKA 2WUBL 5DGRA 1W0YT 3O6FD 5AKTA 3RLSA 4KJPC 4XN4A 3QHZH 3B83A 1MJJA 4BH8A 1UB6B 3FO2B 4E9XA 4FL4C 5KSAC 3N85H 3S35H 4Y1TA 5EZLB 5FGSA 5IWLA 2P45B 5IJKA 4WI2A 3K6IA 1L9TA 5CP7A 2VO8A 3PFUA 4LVOB 1HNGA 3QULA 4X9IA 4OZHF 5IEKA 2H2SD 5F93C 5E5MA 1KNOA 1SOKA 5DWUH 3WS3B 4GXUN 5DHVA 1EQWA 4UDTA 3WTSA 3QEQA 1RURH 4TLSA 5EBWA 5T33H 4L8DA 1JUFB 3QUYD 3U1SL 4E0RA 3HC0A 4LK4A 3CLFL 1PDKA 4GI8A 4RX4A 4X9GA 4KDTC 2G0LA 1P0SE 4HS6B 3REWA 1Q94A 3OGCA 1F13A 4P59L 2KLSA 3UIZA 5DJ0B 1BXAA 1DJXA 1NM9A 4PG2C 5DD1L 2R2BA 3OJMB 1PY4A 3OHXA 4IHOB 2EKSA 1S9YA 3DV4A 4IMKC 5EC2B 1OY3B 1RJYA 3O2DA 2K6WA 4J6IA 3CFQA 2EDMA 2FBOJ 3B5TA 3RL1A 4BK4A 1HILA 2PW1A 5D7KD 2DDQL 3JV0A 1DQQA 3M7FB 4GQ9L 2C26A 1N2RA 2X4UB 4ODWB 3FONB 5DT1L 5EEWA 2FYVA 2YXVA 4AGQA 3BUYA 3QFDB 4XPHH 2G60H 3VWJC 2IADB 5EG6C 5C8JB 5CN3A 5EUOF 4FLRA 4TQIA 4LHUG 1TYEB 2R0ZL 3T0ED 2YRLA 4IJ3C 3V0GA 4Q56A 4P4RA 2EDFA 5E8OA 4Z7UB 2VDLB 1G0YR 6FABL 3HAEG 2X1XR 4RQQA 5I1AA 3NG5A 4UZGA 4MD0B 1DQMH 3MJ9A 2MQ0A 4TQHA 1IM3D 1INEL 2DQHH 3BQUA 3T1WA 3F04A 4XCFL 3VXRA 1F4AA 1SLUA 3IDJB 1AE6H 4PJGF 2HLFD 3VXUA 3LEXA 1C5BL 3SDDC 1PEZA 4M61B 4KV5F 2VITA 5TE7H 5IWLC 4XXWC 2OZNA 5IJKC 1H5BB 5BQ7A 3T6QC 1ZJAA 1YEWA 3CBJB 4GAYA 3EDDA 4R83A 1F8TL 4LHUA 1JPSH 1SY6A 1TG8A 1Q8MA 1XGYL 1RMFL 2JTDA 2WZ0A 4JLRA 4PJIB 4WU7A 5TD4A 1FC1A 1LO0H 4G6MH 1CXLA 2NY0D 1PKQB 1KJ2B 3PE9A 4P2RD 5FLUA 3QUXC 5BZXA 4GAGL 3SOTA 4R7XA 1MCLA 4O02H 3HAEA 1JTPA 4K9EC 2WMPB 2X70B 4OCYL 1X4ZA 4TULL 2FCBA 4OV5A 3PF2A 5J1AB 1SLXA 4O58H 4DK6A 2C7FA 4PJHB 4Z0BL 2MRYA 4PTTA 3ULSA 4M6OL 4CSPA 7CGTA 2COVD 3FT2B 4FXGC 1MZYA 5T1LB 4Y9FA 4JO3H 4KJQD 5CFHA 4MXQD 4LCWD 3AU1A 4ZDHA 3ABLB 1TMCB 3L9EA 1GGBL 1KTCA 3SY6A 2F6AA 4ABWA 1T7WA 3OHXC 2F7OA 2ZD0A 3WEXA 2OM5A 5FW7A 5I8KL 1DQJB 3KPPB 3QJHA 1BOGA 2WOYA 3FULA 1B3IA 3RNKB 3U4AA 2E9WA 2VXSH 2H7WA 3LEVH 2UZYB 5SX5K 2F18A 4DWHA 1UURA 3EO9L 4N68A 5E2VL 2K8QA 3L9BA 3LZPA 1GZPB 5JPNA 4N2BA 3QDGE 1TO4A 1S7UA 3MRHB 3W3BA 2H6UA 2QGEA 1MXGA 4YBHA 1AZBA 2G3MA 4OKVA 5IJDC 3GSUA 3N1GC 4FXKA 1UYWH 4G71B 4BSWA 3QHFH 1JZDC 1MCDA 3QXDA 1UWEH 3SKMB 4XRCB 3LB6D 1CLYH 5B4MD 4ZX4A 4M8QB 4HVBA 4KAQH 4HFWB 1NAMH 1BF2A 2K3TA 4NIKB 4OI7A 3ARGA 4LOUC 1A2YB 4BSJA 5JR1L 1J0IA 1Q0YH 1T0NB 4WKZB 5F9WC 1PEWA 1NZRA 1AGCB 3HRPA 1UADC 2YPLD 4Q58C 2IOOA 4OGYH 4OLWH 5BO1H 3FXIC 2R9HC 4NNYB 2DMGA 4JFPA 2DQMA 1KV7A 4X6CE 1UM5H 5J8OA 4JR9L 1ACYL 1LTXA 1NBZA 1F1DA 4J3BA 3FBKA 4FG6D 4FA8A 1A4KA 2Y5EA 2B08A 3I84A 2H9GB 5EU6E 5E6UB 4U0QB 4H7VA 2K1MA 2XHNA 4PAZA 3MRRA 3RJDA 4L8BB 1A02N 5EN2A 3SE6A 2WWKT 4FYQA 2BMKB 4KRPD 1B3JA 4ECNA 4P5KB 5I8EA 4RWYL 2FWUA 2NY5H 4TRPH 2UXGA 3GXIA 2OI9B 3PJNA 5F3FA 2OQJB 1X5XA 3LDBB 4PP2B 2NSQA 4EUPG 2DKSA 4OTXH 4IRJD 2ZAGA 1DN0A 1LD9B 3L4WA 4G9FD 3VGHA 4DKDC 1TQCC 2R56L 4P2OD 1YHPA 4AQAA 1BQLL 2J88H 2R51A 2FWLB 1SUHA 3OLGA 2J20A 2GVYA 1S3KL 1TPXC 1QSVA 2FL5A 2YWYA 4OGAC 3ARFA 4FF9A 4UQ3B 3A6BL 2LT9A 4BKLA 5J12C 1IAOB 3UO8B 2F68X 4CN6A 1BM3H 2PXYA 3V7MA 3QRFM 3HHMA 3HG0A 4EI0A 5H94B 3TJHD 3UTSB 2OMNA 5CLXA 1D3CA 1S7QA 5E4OA 4YHIB 3O2VH 3BHBA 4EUPA 5B7FA 1JPFB 1MIMH 2W07A 1TVHB 3F7VB 1JDCA 3SGDH 5I8CB 3JV5A 4KVCH 1ZK9A 1R24A 2ORBL 4YO0B 5HGDB 5FM8A 2KDGA 4OLYH 3CE1A 4HGWB 1CGVA 1KTLB 3MRGB 4JFSA 3THMH 4YE4H 4QGYA 4JFED 4OJFL 5KSUB 3QXVA 4P5TB 5LWYH 3G5YB 1S2EA 2QFRA 3ESVF 4JFYA 1IBBA 2A74C 3V55A 4Z3JA 2GC7C 1DQDH 1UACH 3NJVA 5C1MB 4UQ9A 4NPYB 5FYJH 1DTUA 1GTFA 3ZE0F 2KC0A 4N8UA 2ARJQ 2IJ0C 3AUWB 5L7XH 3GSNB 1GGIH 2CDGA 3MUGB 4JY6A 5C09A 1HVXA 2GJZB 1FZMB 1FL3B 1P7BA 2ZZUT 1KIQA 4O5LL 5AVXB 2QEJA 3KPNA 4G83A 3MUJA 5FYKU 1YECL 4GRLC 3CIAA 2NZ9C 2P46B 3BDBA 5DEZA 5F7BA 2CBQA 3RE0A 3CFEB 5LBSL 4UNVA 1HEZB 3WTUA 2EEAA 3RQ3A 5C0AB 4Y88A 2W0FB 2VR7A 3I6KB 2BHFA 4OD2B 4Y1SA 5C08D 4M62H 4MLSA 5KSVA 1G0DA 4PLKC 5DRNA 1J8RA 3QCUL 4GW4B 3BVWA 2EC8A 5I17B 3ET9F 1U6AH 1ML0A 1ODUA 3HR5B 2Y25A 1H19A 1QFWL 2W91A 2VDNH 4QTIH 1J0YA 4NLHA 3U9PH 1AOHA 4NZRH 3ULVH 2XVKA 3RY6A 4BFIB 1R5IB 1OCCB 5KEZA 2K4WA 1SLVA 4AIZA 2V7HA 4HIHA 1BECA 3NCYS 3GIVA 3MGTB 4ZW7A 5G5DA 3V52H 4EI6A 1U8OA 4LVHC 3UABA 1HJCA 2AK4A 3DXAB 2AJ3A 3DV6B 4R2GB 3LMJL 3VXQB 3GK8H 3FQWA 1SQ2N 4ZS7H 1FVEB 5IQ9A 4JANB 4UWQB 4UTAL 3FQRB 4ZXBB 1FJ1A 1I7RB 4MZ3A 4NUMA 1UT2A 2VDKL 1J0ZA 5E99L 1IGJA 2PCPB 3RZCD 4J4PA 2EABA 1I9IL 4YH6A 2X4OB 4E9SA 1YPZE 5HGBB 1T6VN 1MNUH 1I1YB 2DWTA 3PWNA 4LO9A 1ZPUA 2EDTA 4NQXB 2IXQA 2FJGA 1XAKA 2BK8A 4LQ1A 3C6LA 1I1AB 3T4YA 2GSIA 4W93A 4HG4J 4PI0A 3VD4A 2HLAA 2NUPA 2CK2A 1KPRB 2RFXA 2UYLB 4TNVK 4G43B 2ATAA 3LN4A 1ADQL 1T66D 3OBAA 4F9PC 3GTNA 1QLRB 1V7NH 4HIEB 3LPGA 3RWGA 3OAWA 3D87B 2FX8H 3VXPA 1GTNA 1J1XL 4ZUVA 3CH1B 4HS8L 3QCTL 3NH7H 1E4HA 2VZUA 2XWBB 2WLKA 2HP4A 2CJUL 3BZ5A 2Y23A 4MB3A 2OYMA 3BO8B 4M5ZH 4NFCA 2X4QB 1ZVSB 3R1GL 3C8HA 4YHOH 3H56A 4Y5XA 4RFOL 2FH6A 4YHPA 3SKUD 1RZKH 2WIIA 3RA7L 5KS9F 5AZUA 2IQ9H 2N7SA 2JKRM 5BS0B 4N90D 3NIGB 5D8JL 4WFFD 2GUYA 2WLLA 2C9UA 4MA7H 3H53A 3FO1B 4J3VA 4O02A 3NESA 4NC1C 1FPTL 1ZVNA 4D0CA 1BHGA 3N2JA 3PHAA 3W11C 1CFNB 2IAMD 4LEOA 1DJSA 5E8NA 2J3SA 3ZO0A 4Z7VF 3LHAA 4IGBB 4Y4FC 5F89A 1ZT1A 5CZXD 1AHMA 2BZCA 4XE0A 2WBJC 4BZ1L 4OLZH 4GG6F 2A73A 1J1OH 4XO4A 5LDSA 3VTAA 4FX5A 4ZUWB 3WFHA 5HYJB 2CDEB 2PMZA 2O26U 1VZHA 3CHQA 2GIMA 2GBVA 1HCFX 1KEGH 5TDOB 3AROA 3DX2A 4FEIA 3HE7C 4N0FA 4HX1A 3L3GA 2FO4B 4JB9L 4CAGA 2LAAA 3Q0HA 4PG9B 1F18A 5C07A 3KHOA 4XNZC 4CMHC 5LGKA 2XIBA 2VH5L 4ALAH 5DC4B 3W57A 3OAUL 1EJFA 1UQSA 2CO4A 1TETH 2E27H 1WGOA 4ORGB 1ONQB 3MXWL 4PP1D 3KPSB 1T3FA 1ZJBA 3ZKNC 1EBPA 1W72L 3UROR 1YY8B 1SFHA 4LFHG 3GMNA 2E4TA 1JAEA 2AJSL 2VZOA 2W0LA 2BW5A 4B60A 4NGHL 1I4FA 3O3BA 25C8L 3HJ0A 5JNYA 4PS7A 2VW7A 1IVTA 3CSTA 1WHPA 4TUKH 1NAMA 5KAQF 1XZ0A 3GF8A 4PJAF 3E7JA 3QDJD 3MLRL 4KTDH 3ECBA 3RVXD 4CKQA 3WUZA 4J7RA 3WKNA 5I6LA 1JNHB 4P2AA 3PU7A 5T3ZD 1F11B 3MJ8B 3UJIH 1QLFA 2NY1B 1NOFA 5K33A 3FUHA 1BQRA 3DYPA 1UVQB 2FJFA 4PR5B 1AXIB 3HHRB 4KQ3H 3QXTA 3RIKA 2MCPH 3TH3T 4A2GA 4AUYA 1EMTH 2EACA 3A3YB 3F12A 5EIIB 2BNRE 1SNRA 3W0WA 1F5WA 2VQUA 4OUUA 1DSFH 5A2CA 3TFKD 5LQBH 4NZ8A 1PIFA 4Z3EA 4KI5C 5DMYA 3AFLA 4AITA 2DKUA 3TBYB 4FOMA 4JZJA 1I8LA 3NQKA 4H1LB 4HWNA 3O8XC 4QR7A 4PGEB 3TWCH 2R1WA 4K23H 1OD9A 2AEQL 4NC2B 3RPIA 2VLJE 5CJXA 4JJ5B 4PJ9C 1FSKC 2D3LA 2DBJA 3F83A 4JM4L 1P5UC 3TPUB 3FMGL 5EO9B 1L9RA 5GZNA 3L5WA 1QHQA 1XGTB 5DS8A 2NR6C 3QAQA 4AUUA 4ONGH 3VSUA 3TC9A 3MREA 1YA5A 2XZAL 3PWLB 1OGPA 3EH3B 5CEZL 3DTDA 1UH4A 3BWUC 1OP3K 1D7CA 5ADPH 2RMNA 3HG3A 1EPFA 3NZHL 3RU8H 5LGHL 4XHJC 3D25B 4KO7A 1IC4H 1LP9A 2JJTA 2WWKO 4I88A 4IRZL 1JGEA 1U8IA 5EBGA 1P7QD 4IK6A 4CW1B 2V4LA 4HQQL 5TTRA 3LXCA 5E2JA 2G0KA 3L3OB 4NX0A 4PB0L 1OKEA 4MVBC 1DEEB 2FSEB 3HI5H 3F7PC 3WXVH 1RFDL 3PHQA 3QPQC 5IHBA 1CBVL 2BNQB 4CBPA 1CIUA 1WWWX 5H8DA 1JNNH 4FLSA 5FA3A 2W1NA 3QRGH 4LLDA 3LHPH 4HKZA 1FG2A 5IVZA 3C5ZC 2CO3A 1BIHA 4AGPA 5IFHL 4GMTL 4E9LA 1WCBA 4JN2A 4JRYD 3HE6C 1MEXH 1HSBA 3GUFA 5D7IF 4YSAA 2QQNH 1YEGH 2D7MA 2B2XL 2NX5A 2Z7UA 1WFTA 5IP4A 4AV5A 4ZYKB 2AP2A 3B9DA 2AK1L 2APBA 1QWUA 1U9KA 3FQUB 1D6EA 5LN8A 5D6CA 4LP8A 1T6BX 1U8CA 2BIPA 2Q7YB 5FGCB 4GI9A 5IV2A 4XMVA 1I85C 4OM1L 5DJ8A 4LF3A 2OSLB 3PGCA 3ULUC 3D6GA 5DZAA 1RZFH 3QWRA 1NIEA 2ZWSA 5CZRA 5AKRA 3DBXB 4FG4A 4XI5C 1R19A 1UA7A 5IESH 2J6WA 3VXSE 5BRQA 1MQKH 2DQEH 4JZJC 1XVSA 4ZUSA 3Q3GA 8FABB 3P0VL 4JJHA 3G6AA 2Y7QB 2XN9B 2R0WL 5DRWB 5IB2A 3SKJH 3ARQA 1FNGA 5C0BD 3SIKA 2ADJA 3EYQC 1C08A 5CJXC 1BBJB 3KL0A 4OLEA 4HXBH 1FNSL 4FXLA 4F8OA 3TBCA 5F7HA 5CBEA 2VXVL 2I60L 1TEYA 4ZAKD 1PNCA 5CCJA 5AOKA 3WHXA 1NGZB 2VDOH 4KXZI 3QORC 5F2FA 1ECYA 5GHWL 4NT6B 3GHPA 3AUVA 3OKOB 1J87A 1DHKA 1SOXA 2Z7YA 4JHUA 4A2DA 3V0WL 4DCQA 2A9AA 4WUUD 4RAUB 1UH2A 4MWFB 4LGSB 2J5LB 4PD4K 4QHKI 4OJYA 4ILDA 3KVDD 4MJJA 2BNUA 1HL4A 4X6FA 1AD9A 1PZCA 4V1DA 4FA7B 1WG3A 5EUKA 4YC2C 3ATAA 5F7FA 2X1OA 1QW8A 2MQCA 2VLRB 2NY4C 1MXDA 1NCCH 2AABL 1C1EH 2P5WB 1YNTF 3NACH 3L5XL 3CZEA 3KM1A 5B3NA 4ZMPA 1DVTA 2ZXWB 4HMCA 4F8LA 4IU3B 3GMMB 1BZ7A 2AS5M 2HUEA 3FOLA 1SDDB 3DJSA 4H26B 4BQ9A 1NCAH 3D50A 5IHZB 1P1VA 4YR6A 3GB7A 4OY9A 1FDLL 4N2DA 4AW7A 3PWPD 4KKQA 4R3SB 2BVQA 3Q43A 4FNTA 3A67H 4XPGH 4MXWH 4JM2A 4KNQA 5LXVA 2Z92B 4OZGF 1ZAGA 3TBVB 1IJNA 4YLCA 1VGEL 4AEHL 1CMOA 1AGEB 3QIUB 2A77H 3FQNA 1USZA 5G55A 2GYSA 5HD8D 4L8CB 1Z9NA 1JPST 4OFDA 5ITFB 5SWSA 1E6OH 3T0WA 1U8MB 2J8HA 4MAYC 1MJUH 5ID0B 4LL9A 1BFTA 4HUNB 1R3IL 2OTUA 4XP5L 1AR2A 2J8UE 3H9YA 1SJMA 1BVKB 4KWUA 1LNUA 5J11C 4HSQA 3Q1SL 1UASA 3ARYA 3DX7B 3TGXA 2BFGA 4K94H 1MFBH 1D9KD 1QSEB 2YEVB 4JFUA 1S7VB 2GEQA 4KROD 4U6VL 2NY6C 4BFRA 4NOFA 4XVOA 3GI8L 3BUTA 1RJZA 3W39B 1NC2A 1ERNA 1PY9A 3ATFA 4MTMA 2VDMH 3UJTL 3OPUA 1OV8A 3ELQA 4TNWF 3DJTA 1ORSB 2DW5A 3ULVC 3OXSA 1PL3A 3ZUCA 4EDXB 2YD6A 3N55A 1I7ZB 4U4IA 3APCA 3UACA 3GGWA 3PNWA 5ES4B 1FWXA 4HJ0C 2RD0A 3LY6A 4IOFC 2JI1A 4Q6YA 5IOKA 2Z91A 3D1MC 2VXTL 3D09A 3CC1A 4EN3A 3EYUL 4N4YB 4FQQA 4HWZB 3WXWL 1GCFA 1OL0A 4WFGE 4F7EA 3L48A 3FFCA 4R9HA 4A7TA 3D0AA 4Y2OB 1A3LL 1LEKB 5AOMA 3FHEA 2E9BA 2BSEA 2WZAA 3BXNA 2NXYD 4GAAA 4I4WB 3VFNA 3NEXA 5GGTL 1K5NB 3VG9C 4YEEA 2AJYL 1B0GA 3QUZD 2IF7A 4HZAA 1KCKA 1M3IA 4KK5C 1KCSH 3LVTA 3BE1L 1PZ2A 2VMEA 4M02A 3W56A 3LZRA 5MI0B 1T4WA 2WO3B 3B8SA 3MO1B 5LNDA 5DHDA 5HHPB 1BF5A 3LD8C 1IQWL 1GPOH 5E8DH 4C83A 3L1FA 3FHQA 3O6LH 3NN8B 3IDMB 3KBPA 3A47A 1KLGA 1NJ9A 3EYVA 3BC9A 3IWVA 3EADA 4F7CA 3DO7A 1HYRC 5ENWB 4PW9A 3FTGB 4NCC1 3QPXL 4OCXH 1J48A 1T04B 3EJPA 5EC1B 2AI0H 1A0QH 4FQHB 1G9NL 4FRWA 2PW2B 2RCSL 2R0KL 2YMXL 4CVXA 5FO7B 3O6FA 5FO2A 3ZIYA 1P5VA 1YVLA 4APQB 2X5PA 3OB0K 4M6NH 5DMIH 2X3AA 5B1BB 1ZLEA 3DC0A 3VGGA 3UGUA 1WBYA 2ERJB 4U1HA 4FYRA 2H8PA 3HNVL 1JNJA 5BZWB 3HNSL 1JCKA 1L7TH 4NQDD 3RWIB 3PL6B 4GRWF 2VERN 4F8NA 4NBXB 4FTVB 4Z78A 3NP4A 1MI5E 4L4VE 1VCAA 3VGAB 2XNAA 4KJYB 5DR5H 2YOAA 2FEDC 2Y7MA 2WXJA 4JRXA 3RVVD 4U0RC 2OCJA 4EN3C 1LILA 1CFQB 4YX2H 3MLUL 2C5DC 5JQIB 3RDTD 5D7HA 1KELH 5TQ0L 1IFHH 3QUYA 1CJYA 3FQYA 5BMFH 1JRHI 1G6VK 5D2NB 5EIQA 1UWGL 4QEGA 5KVGL 4G6JH 3FH7A 1PQZA 1UZGA 2QL1A 4X6BA 5SWZE 1N8ZA 4G6AC 1S9WA 3BCDA 3BMWA 5GGUA 3HZYA 3C60C 4FADA 3IT8D 1HQ4B 1OM3L 1I3GH 1ADWA 3DPDA 4HW6A 1IKNA 5L9DH 3D4GA 3P1VA 4JFZH 4OAWB 4XB8A 2D31A 3B2UD 3D3VE 4TNFA 4XVSL 3RFZC 2DL2A 1FVCB 3C5JB 5AOLA 4DAGL 3O2DL 3D2UA 2J2ZA 5JIDA 3FCSA 1KPUA 3SBWA 1T2XA 1WJ3A 4H0IA 2CGRL 4JRFA 3FSOA 4LIQE 4PRPB 4LSRH 2HN7B 5JQHC 1AQDB 1DJWA 4QTHB 3T0EA 3H54A 4HJSA 1Q9WA 1RHHA 3EJJX 3S3PA 3K8MA 3FN0L 1A5FL 2ZXEB 4LLVA 3VQLA 3BMVA 3ZDYF 2JELL 3LZOA 3RVWD 5I0YA 1RJLB 3CZUB 4ZFFB 1AFVL 5GRJL 5IVXA 3GJFH 3WU1A 2ZKXA 1NGYA 2K6ZA 4ENED 1CDBA 2D3NA 1S5HB 4LSQH 4JG1L 1BD2B 2R29H 3CH8A 3DECA 1NCDH 3GM8A 3RUGA 1QNZH 2ZJSH 3MJ9L 4NO5A 4R90L 1U8HB 5KJRH 4LL4A 4K15A 3VFVB 2WBWB 3GDCA 4KKNA 3BPNB 3MRFB 1OK8A 5IHLB 4N0UB 5IB5A 5JIPA 1Z9LA 3FO9B 5CCKL 1AAJA 1NH6A 2H2SC 1SY6L 2MHAB 5DUMH 1FNAA 4WK0B 2DIAA 4GUQA 4YQXL 2XY2A 2IMNA 2JCCB 1CK0L 3BH4A 3IFOA 4Y19E 4DGIL 3DDFA 3TT1H 4YSOA 5I66B 5DTFA 3SOBH 2Q20A 4HHWA 3OAZK 3QUYC 2GTWA 3DX8A 1TTBA 5C7XH 5GGSY 2YEZB 4CC1A 4WW2B 5GS0D 4JN1L 4LSVH 2E0PA 2IGTA 4P9HC 3QNZA 4P2QE 3QJFB 1D5MA 4YL9A 2Y3AA 3G04A 4GW5B 3H0TA 3IAQA 5BZDA 1NFDE 3LKNA 5B1JA 1J8HD 2K0RA 3QWNA 2C9RA 1CE1H 1YN6A 4KFZC 2CGZA 2QQLH 3VFMB 4P0DA 2W81C 2IALB 4HJUA 2C34A 4CMMA 1YMMD 3ARRA 4CGUB 3VG0L 2PCXA 5GRZA 3LH2L 4JY5L 3CHPA 4XPBH 1G9HA 2AXGB 5I5JA 4ANWA 1R0AL 1N5AB 1EJ6A 1YJDH 4UT6H 3BUIA 4ETQA 2MEJB 3M1BB 3RGVD 4ZFZA 5HGAA 3X1EA 4NQCD 5DHYA 5HDLA 3QJVB 1E30A 1B2YA 4PJGA 1NIBA 1EUTA 3PLYA 1U92B 5IIEA 2CHWA 2ENPA 3MRNA 3WD5H 4WSGA 1WUNT 1FZKA 3TBSA 1J5CA 1Z1WA 2NUTB 4EDWL 3NRPA 4MMYB 4Y5VB 3DSNB 1DUZB 5T3ZH 4Z3HA 2P5EB 2HLFC 2E76C 3DMMB 1D5RA 1H3PL 1UGKA 1OM9A 3UC0H 4B9GA 1YEJL 4JDZA 1E8WA 4H4NA 4JPVL 1JV5B 1T5XB 2Q8BH 1T1ZB 2VZSA 2VM9A 3FT3A 3ARED 4P5MB 4FQ1L 1NOLA 2NY0C 4JDVB 5C7ZA 4TSCL 4K7PL 5AOJA 3MV8A 3NIDB 3EYOB 1DBBH 3KNBB 1EFXA 2LTQB 2MKLC 2H3NB 3H3KA 1RUMH 3ROLA 2XTLA 4RMRA 3DJRA 3DOHA 2VDQL 4ORZC 4PGBA 3SPVB 5DFVC 1ZTMA 1PNDA 3B9KC 4L8SA 4ODXA 3F85A 2DQUH 1TKWB 4KJQC 5FYKE 4MXQC 2ATPA 1RZIB 5GGRY 3CVDA 4S0HA 1EX0A 2WNKA 4JHWL 3IDUA 1JGVH 1KYFA 1N67A 4JDTH 4JO4L 4EI5B 2HPOA 4L37A 4IW4C 3F7LA 5I74B 4YGVA 4IRJA 4J6RL 5DQDH 5IR1A 1F90L 5IBLD 3QIBA 2AZAA 4P2OA 1AG6A 4ISVB 2Z31D 3BGMB 3N6YA 5FDYA 1FE8H 3MR9B 3LN5A 4Z7QF 3FB7A 4J8RB 3GDBA 3V9CA 4JFOA 2NY3B 4YHNB 3IU4H 1YEIH 3HBGA 3HC3L 5F9OL 3WIHH 1M1XA 2VR6A 3D7PA 5B1CA 4IBZA 3MA7A 4ZTOH 4Z7UE 4NHCL 3Q9PA 5I75C 4QOKE 2JVUA 2Q7AA 4UUJA 1AKJB 3LB6C 1EZLA 3ABMB 5DF0A 4LL1A 1ORQA 3NCYP 4LLWB 3ZT5A 1WFJA 2PTTB 5A2JH 2YLHA 2J21A 2ZUYA 3U46A 5IM7B 2ZYIA 4J3UA 1THAA 4CVZA 5E6ID 2OSWA 3RIFK 4FMFA 4MX7A 2FX7H 1XQ4A 1TYJA 1G6RB 4PJIE 2DQGH 3H9SB 1PKQE 2CR0A 4XPFH 5DD0H 1TCMA 2NCEA 1MVFA 1Z3GL 5E1AA 3LS5L 4PJXB 1JGUH 4N2HA 4NWTH 1RY7B 1RK0A 4F3FA 1YCSA 4NBYB 3BIBX 2A1WL 1ZSDA 2RQ8A 2WVVA 2XA3A 3MCLH 1NUGA 1BJ1H 2A2QT 4YBLC 1RKRA 4FG6C 1ZS8B 4PJHE 2SEBA 4XH2A 2XZQL 3FW6A 3O4LA 3P4OA 5C3TA 4BXVA 5AOZA 2YSTA 2DLFL 2VISB 5EZJA 5JYMA 4Y16B 2CNYA 4QHUB 2VAAA 1CU4L 4L8SC 4KVNH 3TYGH 5AL8A 2RH0A 1GGCH 3QHZL 4Z7WA 1P84J 2IGFH 3SGJA 1BDYA 5L8JB 3WFBH 3N85L 3S35L 1S8DB 5ESAA 1I7UA 1SOSA 1IC5H 3NFNA 1LK2B 1AP2B 4P2OC 5KBPA 4Z7NB 1IZKA 5MENB 7PAZA 4LCUB 1XH1A 1KY7A 2YD3A 1AXSA 5DWUL 3VFGL 4G80A 1QPKA 1RIHH 3I3DA 4KXCA 2DLEA 3STBA 4JPIA 5KBNC 5FW6A 1AOZA 1RURL 4WI5A 1HQRA 5T33L 3EAKA 5J6HA 4JKPH 2QMJA 2HRHA 2K7PA 1XSJA 1Q1PA 4X6CF 3VQMA 2PTVA 2HLEB 1MHHA 2Z93A 3TJHC 5EU5B 5JA9A 1WAAE 5IQLA 3I2CH 3MNWA 3DX0A 4ZQKB 3CFBB 1QBLH 2BWDA 1GY2A 4ZFGH 6TAAA 3RZCA 1WSST 5F7UA 1NFIA 1L6XA 5CJBA 3MCKB 2XCMC 1K2DB 1K4CB 4IRSD 2DM7A 2IPUG 1AYRA 2VMJA 2W80C 2C1OB 3BP6B 3GKWH 1A64A 1WBZB 3HI1B 4UM8B 4HKBB 2K8MA 3D85B 4BYHA 3FU7A 1A6VH 3HS9A 3HZMB 3U2JA 4RETB 1QLEH 4BFGA 1NWOA 1XL6A 2ZOKB 4OQTH 2G60L 4XPHL 4LLYA 1I8IB 2J1KA 2CUHA 3WIFB 3LRHA 1R3LA 4A7SA 2DJMA 5DQ9A 4LKCA 3CXHJ 1E2ZA 1H6UA 2ZUTA 3VFOA 2LU5A 2B1HH 1I1RA 3GJFA 4X99A 3FTYA 3EOYG 5E8EA 3P11H 4UT9H 2MMXA 2R29A 1EJOH 4NLAA 5HHVH 1CTMA 1DQML 4GXVH 3VWKB 1ZKAA 1SF5A 5E9DA 3FTWA 2DH3A 2DQHL 3PP3H 4MNHA 5CILH 2BSRB 1D7DA 3B3IB 2BOBB 1AE6L 5C0ND 4DF9A 3ZRFC 3VD5A 4AEFA 1PGRB 4XBEH 3TL5A 1TZHB 5TE7L 3GMPB 1JPSL 3HZ3A 3H8NA 3D69B 1LO0L 2UUDK 3HCVB 4G6ML 4N1EA 4YZFE 5D5MB 2JI2A 3RI5F 2LABA 2AW2A 1R34A 5MEPB 4O02L 2VL4A 1CDIA 2X6CA 3MRQB 3O45B 4OV6F 4PBXA 1DVFA 3X11A 2AMGA 5KZCB 4HALA 2FJUB 4FQLH 2VR4A 3UTSE 4AWJC 1WE5A 2VWEE 5DURD 2B0SH 4O58L 5EU6D 3V6OA 4K73A 3UGEA 2D3JA 2AV1A 4FKHA 2CA3A 5D2LF 2EDOA 4JO3L 2FO8A 2PYFB 4QRUA 3ZY7A 1TLMA 3DURB 1F2XK 4FFZH 1JK9B 4Y1AB 5J3HD 4KKZA 2E46A 3RZCC 1DJIA 4QRSB 2YEQA 2CDFA 2UX6A 3NIFB 1JFHA 4WJ5A 1CG9A 1AMXA 3PQYA 3H42H 2IVFC 1I9RH 3QWOB 3L3IB 3WLBB 3OMZA 4NKDB 1LEIB 1KOAA 2VXSL 4N1HB 5FKAB 3F7YB 1XD1A 1FFOA 3LEVL 3DA0A 1MH5A 4WFED 5AVQB 1QYGH 3MGAA 2OMUA 4UT6A 4DGYH 4XN1A 3IDGA 1C12B 3V4UH 1G1KA 1YMHB 3DUSA 5I26A 1HFUA 1H6EA 4DOHB 3TIEB 2E6QA 5K1NA 3LTVA 3LQAC 4KUCF 4RA0C 4DW2H 1PW3A 3QHFL 4L3EA 1DCLA 1CLCA 1UWEL 3GMRA 4YDVB 1CLYL 4LOVA 1MCKA 2YMTA 4KAQL 1NAML 4G7VL 4HLEA 5TDNB 3WIIH 4PRDA 1VERA 2B1AH 1KCUH 3U6RB 1XSIA 3K71A 3CVIH 1HT6A 5GPRA 1MCNA 1PF3A 3UPRB 4UQDA 1JIBA 1Q0YL 5EMYA 4MJ5B 1A7OH 5HDRA 2E9GA 2J43A 4OGYL 3PGDB 4OLWL 5BO1L 3TN0A 1NANI 2BX5A 3OKKB 4JHVA 2AAVA 2R1YA 3NCBB 4DSYA 5CJOH 3DX9A 4Z95H 1YPZF 4TF4A 2VABA 4CDGC 3D48R 3X17A 4XP4H 3VFTB 1UM5L 1R3KB 3H1ZA 3TA3B 1AHWC 3P2BA 1DJZA 1YUKB 4J23A 4L9LA 3OKLB 5AQ0A 2X9YA 3DXAE 4ZJ9A 2QADB 4YJZL 1A3RH 2IAMC 3D9AH 3R19A 4ZFOB 1KXHA 1WZAA 3V6OC 5CHNB 5CZXC 2D2CC 3FUMA 4Z76A 1ZHKA 1SPDA 2GJ6B 1HNFA 1X4YA 5CLTA 4F33B 2DWYA 1JP5A 3E3QC 1AXTH 1O0VA 2NY5L 1VFOA 2W0KA 4TRPL 3FU3A 3WTTA 1IL1B 1G7HA 3GRWH 2WY3B 5HVGB 4E9TA 2QTVA 2WKGA 4N5EC 5E00A 4OTXL 2FT7A 3UIYA 5GGQH 1QFPA 2X4NA 5TDPA 4MS6A 2Z1PA 3DRQA 3T8XA 1H3TA 1KJVA 4NN7B 1II4E 4MD5B 4PJCA 3ZRSA 4LU5H 1JGDB 1NEZB 2J88L 4OF6A 3OZ9H 1ASQA 4PFEA 3CFJB 2DH2A 2NW2A 4NQEA 3WIHA 3UTOA 3S34H 5BXFA 3ESUF 4KUCD 2IEPA 3LRGA 5E1HB 2WTRA 1IQDB 4PP1C 3K46A 1M7IB 3MV7B 5JHDE 1BM3L 3SE3A 1OP5K 4KQ4H 1JWUB 4P4KB 4UV7H 4P9MH 4KKPA 1HXMA 1WD8A 1KXQE 4R97B 4P23B 2XFXA 2V6HA 1AIFB 2MPAH 3O2VL 1HHGA 3IN0A 3WLWD 3O11A 2OSXA 2WWOA 3QIWB 1MIML 4APXA 1ETA1 4JRYA 3D2TA 4KVCL 3BOVA 3ZYJA 5K69A 2P24B 3WTYA 1B90A 2H0EA 3RVXC 4QRRB 2DWDB 2XPGB 3AXLA 5BPPA 2X4TB 3V4VH 3ZT7A 2Z4TA 3THML 4YE4L 3L7FA 3N3EA 4H0HB 4B9PA 3AQZA 1MCBA 2YMOA 3OJDA 2QGCA 3DRTA 3NIGE 5BS0E 4B41A 4JGJA 1DQDL 1UACL 4FS0A 4HUVB