1SUQA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r185545
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 134
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1suqA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1suqA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1suqA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1suqA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1suqA05
1REVA 4PWDB 2ATQA 3PW5A 3OJUA 3MFHA 1C0TA 3G6XA 2ETJA 3LZJA 1RTJA 1N5YB 3D45A 4F3TA 3SV3A 1X9SA 2GBZA 3O4NA 4IG0A 3DLGB 4ZVFA 2HWHA 5KFJA 2FJWA 4QWBA 4BE0A 2F8EX 1XWLA 4KHSA 2AGQA 5KFIA 3DLHA 2FVRA 1RBTA 4OGCA 4WE1A 3V6DA 3QNNA 3H40A 1T03A 1J9AA 2BRLA 4WYLA 3K5NA 3KIOA 4DF4A 4HVJA 1JLCA 3QLHB 2UVVA 2R8JA 1NJYA 3VA3A 4LSNA 4J2DA 3OL9A 3E01B 3NGZA 2WTFA 3KLEB 4M95A 3K5LA 1U4BA 3VA0A 3DYAB 4CK3A 4ED8A 3T5LA 2WOMB 2KQ2A 4F2RA 3L3UA 4KKOA 4RW4A 4DLEA 4CF2A 1UWBB 1NK8A 1S1TA 3KMQA 1IKWB 3TI0A 1J5OB 1O1WA 4DSLA 5HROB 4PUOA 1SUQB 2IA6A 1R0AB 4BWMA 1TVRB 3KHGA 3KLIA 1HQUB 1KLNA 5F9LA 4ELUA 4Q45A 2XY6A 2C22A 1N6QA 2J6TA 4KE5A 2ASDA 1RAJA 3DLEB 3DRSB 3BR9A 4GC6A 5KFVA 2YNHB 1WSEA 3CO9A 2AGOA 1HQEA 2A1RA 1TP7A 2WCXA 3MEGB 1C0UA 4DSEA 4Q43A 4WXWA 1LAWA 1DTQA 2G8WA 3MECA 3OS1A 4GMJB 2JC0A 1VRUB 4B08A 3DLRA 4FJ9A 1LW0A 2D0BA 2G8IA 5EUHA 1CXQA 4JLHA 2WHOA 5J2PA 5JS2A 5DQGA 1Q8IA 3G86A 4EZ9A 1T7PA 3DOLA 4IR9A 1SKWA 2D7SA 1D5AA 3ZSYA 4LH5A 3M9OB 3VN5A 4ZPAA 3ZSXA 4KO0A 3KHHA 3H5SA 4ED3A 3ICLA 3V6JA 1C1CA 3PV8A 4ZPBA 1MU2A 1B9FA 2FVQA 1UA0A 3RB0A 4NCBA 3DRRB 4EEYA 3M8SA 1IKYA 1TL3A 2DTUA 3E51A 5KI6A 2RN2A 3V6HA 3HVTB 2YNGA 3LP0A 5KTQA 1RTDB 4ZHRA 5J1EB 3C95A 3M8RA 4DFJA 4FVMA 4FM2A 4ELTA 1ZBLA 1KVCA 4WFXA 3UPFA 4NYNA 3KNAA 5KFOA 5CY4A 4KHWA 3S3OA 5JUMA 3OYEA 3B6OA 1FK9A 4IBNA 4DSKA 4CHZA 2IJNA 1VSMA 3IG1A 3P1GA 3NGIA 1RCHA 1RBVA 2CJQA 1K1SA 4DTPA 4KB7A 3TAMA 4FLYA 1Z26A 4EO6A 2R2RA 4MIAA 4O3RA 1WAFA 4KPYA 2IM2A 4LQ9A 4NCAA 2BE2A 3QGGA 2EC0A 3I0SA 2CKWA 3PX6A 3GIJA 1C0MA 1EETA 1VK0A 3LP1B 1SV5A 4MH8A 4NLXA 2QV6A 2X78A 2OPQA 3LP3A 4J9PA 4ZP6A 5F9NA 3CJ0A 1JLQA 3P83D 2Z1HA 3QNOA 4B9TA 4Y2CA 5CYMB 4IRDA 1C1BB 3ZT4A 3MR3A 3AVLA 3PJXA 5T14A 3CVKA 5DGBA 1KVBA 1D9DA 3I5BA 4RNMA 3G0ZA 1HYZA 4DEZA 2W9BA 5C25B 3KD5E 4IQXA 2C2EA 1NKBA 4CJPA 3D5MA 3JYTB 1VSFA 4NLRA 5KG4A 1D1UA 4CJRA 5CYQA 4CECA 2FLLA 4G3IA 1HRHA 1JLEB 2BQUA 1KLMB 2JEIA 1HNVB 1VSDA 4PA1A 1S1UA 3HSTB 1FKOB 4LD0A 1C6VA 3BQ0A 2XHBA 2KZMA 1HNIA 4CGGA 3HK2A 2GV9A 3IS9B 5T7BA 4CEOA 1TKXB 1RT3B 4O4GA 4CJQA 4CFDA 4NLSA 4RW7A 2YV0X 1LWFA 3T5JA 3BGRB 4Y3CA 3GIMA 5DLFA 1KRPA 4CF8A 4YNQA 2UVUA 2C28A 2W9AA 3T5KA 2BANB 2G8UA 4O3QA 2DPJA 3QERA 2QKKA 2PYJA 1BI4B 4R5PB 3WNHA 1Z4UA 1G15A 1TKZA 2QE5A 4B9LA 3UIQA 4W5TA 3OL7A 3PW2A 5KFNA 4FXDA 2FJVA 2G8KA 1DLOB 4IG3A 3DRPB 1X1PA 4ID5A 4E7JA 5KFKA 4J9QA 4Q5VA 2YNIB 4CHQA 3I8DA 1HYVA 4IH5A 5FDLB 2KFZA 1S1XB 3QIPB 2FC0A 3CJ2A 4M94A 3V9UA 4PQUB 1TKTB 4J9MA 3KK1A 1NNDA 4O44A 3NFAA 1KFSA 2V0NA 3SFUA 2GC8A 3NMAA 3SFGA 2IMWP 1HYSA 1J53A 4J9LA 3ZSZA 4CEFA 1VRTA 1X9MA 4AHVA 4E7IA 1WNEA 4URQU 1RDAA 1RT5A 3GV5B 5KFTA 4WZMA 2JLEA 2C2RA 4YR3A 4ECYA 2FBYA 4H8KA 4RW9B 1BQMB 2HNDA 4FJJA 5K14B 1QE1A 4KFBA 2O4IA 4PWDA 5HRSA 3QEXA 1Q9YA 1HPZB 5EDWA 3DMJB 5EWFA 1XC9A 3SI8A 1VSIA 4KHMA 3PO4A 1T3NA 4H4OB 1A5XA 2FVCA 3HXMA 4CERA 3KLGA 4IDKB 3DLGA 4LSLB 4OLAA 1D9FA 4MIBA 2YKNB 2B6AB 4FLUA 2F8TA 1T05A 3V6KA 4TXSA 2VA3A 3K57A 4RG8A 3KHLA 3OYNA 3OHBA 2W9CB 2FBXA 3NBPB 2C2DA 3L8BA 3ZSQA 5KFCA 3OHAA 3SUNA 4O0IA 4F4YA 3QLHA 1Q9XA 1U49A 1RDCA 4ZPDA 2XC9A 3E01A 3ZSRA 3LWMA 4Y1DA 3KLEA 2Y1IA 3DOKB 3QEWA 2HAIA 3PR5B 1S9GB 4O4RA 4BWJA 1S1VB 2I5JB 4NLTA 3S3MA 1IKWA 1J5OA 3VQPA 5HROA 1BGXT 4Q8EA 1R0AA 1UOCA 2HW3A 5C42B 4TSXA 1HMVB 1HQUA 3KJVB 4CEQA 3NAIA 3LPUA 5KFHA 3NF9A 2DFEA 3O4QA 1S6PA 5L1JA 4FBTA 3DLEA 3DRSA 3DLKB 1U09A 4RNFA 3PX0A 4B9MA 2G8VA 2FBVA 4ZVEA 2FLNA 4J9SA 3WNFA 3MEGA 5KG1A 4NLQA 3ZT3A 4FLZA 4ED6A 3FFIB 4LH4A 4FCYA 4DF8A 1ZTWA 4I2PB 5DG7A 1VRUA 5KFGA 4G1QA 2RF2A 5HBMA 4KHYA 4ECXA 3JSMB 4E7KA 1ZYQA 1SKSA 4I2QA 3PZPA 5KFDA 4NRTA 4DWIA 2RKIB 1T8EA 4FJMA 1VSKA 1QS4A 4O5BA 1S9EB 4J9NA 2KFNA 1TL1B 4N76A 4FZYA 3D0PA 5L1IA 3QGIA 2ASJA 3K5OA 2G8FA 4BDYA 4CGDA 4DU3A 1QQCA 4CGJA 3AVKA 4KHRA 2WRMA 3NF7A 2XWYA 2X6NA 4DQSA 4KAIA 2XCPA 3DRRA 1BISA 4E89A 4HUGA 3Q8QB 3OSNA 1CZBA 4IFVA 1U48A 2FVPA 4Z4GA 4EYIB 4K4ZA 3C94A 2QK9A 3V4IB 1CZ9A 2JEGA 3HVTA 4FLWA 1JXLA 4W5NA 4KAZA 3KLFA 1RTDA 5J1EA 1JKHB 4HTUA 3BSOA 4R8UB 2ATLA 2IM3A 3KMSA 3AA3A 1JLFB 4J2EA 1KHWA 3VQEA 4EP5A 1TQLA 4X2BA 1NK0A 1SH0A 3TVKA 3O3HA 4FJXA 4RZRA 2VWKA 4O55A 4IRKA 4CJVA 3QINA 4ECUA 3NGDA 1LW2B 3DLBA 3K2PA 5EWGA 4OVLA 3T5HA 5KT2A 4CJWA 3ITHB 5J2NB 4QCLA 5JXSA 2E6LA 1QAJA 1S0NA 1DTTA 1WSHA 2QXFA 3OYMA 2E9RX 4YR0A 3LP1A 5L1LA 1L3SA 2IM1A 3HVAA 3CJ3A 1YT3A 1QSLA 4Z4FA 3S9HA 4O3OA 1JLGB 5CYMA 4ECWA 5DQHA 3I0RA 1JLAB 3VQ9A 1S5JA 1BIUA 4KHUA 1QTMA 4EP4A 1JL1A 3IRXA 4KTWA 4H4MB 5C25A 1GOBA 3JYTA 3N6MA 2HVIA 3QGHA 4MFBB 2R8GA 2YHAA 2V4RA 3OYFA 1JLEA 4M3WA 4NYFA 4DFKA 4CGFA 5D3GB 4F4KA 4ECTA 1KLMA 4FJIA 4FJLA 1HNVA 4RW8B 2BQ3A 2PYLA 2B4JA 2Q3SA 1FKOA 4ED0A 3M8QB 2XY5A 2F96A 3U6FA 3PW4A 3IS9A 4CFCA 4RU9A 3QZ7A 1TKXA 1RT3A 2WK4A 5F8NA 4QW8A 4FM0A 2AU0A 2EX3A 1EXQA 3BGRA 4EBCA 1TKDA 3UQSA 1NKCA 3V1RA 2E4LA 4O3SA 1RBRA 1S9FA 4CFAA 2BANA 3VQ7A 1BI4A 4R5PA 5HRRA 3KKSA 1RTHB 3DM2A 2O4GA 1U04A 4NZ0A 3SCXA 1GX6A 2HHXA 1DLOA 3RTVA 2YHBA 3DRPA 5F8GA 1HJRA 4GW6A 2WB4A 2YNIA 3LDSA 3SQ1A 4ZVGA 5FDLA 1NHVA 3N6NA 1S1XA 3FRZA 4ZMMA 3QIPA 4M3TA 3GIIA 3MXJA 3PY8A 3H5YA 4B3OB 3EPIA 4WYWA 2VG5B 4EBDA 1IKXB 3MEDB 3TAPA 4Y2AA 2OH2A 2OA8A 2HWIA 1KSPA 4TYBA 4CK2A 1TKTA 2FBTA 4NLPA 1RILA 4JRQA 3TAQA 3SUOA 1RT7A 3OYJA 3AVGA 3V81B 4K4TA 3VQDA 4KI4A 4IR1A 2KW4A 3SPZA 1KCFA 5KFUA 4NCGB 3UDLA 1KVAA 4AHSA 4KI6A 1BQMA 2X74A 5K14A 3MF5A 1RBUA 4BDZA 3FQLA 4FK4A 3AVNA 2BDPA 3NAEA 3HM9A 4TQRA 4DFPA 1JLBB 1HPZA 4U7CA 3AVBA 3DMJA 5HRPA 1IM4A 4RW6B 1TAUA 4H4OA 3V9ZA 2D3ZA 2UUWA 1TV6B 4Y34A 3OL8A 1SH2A 4DU1A 1EX4A 5DQIA 2YKNA 4ECVA 4E1NA 2IM0A 1C0TB 1WSJA 4M41A 4DSFA 4IFYA 4YQWA 3KK2A 2W42A 1NK7A 1KHVA 4HCCA 3FDSA 4TY9A 4F2SA 1XR6A 1ASWA 2PY5A 2W9CA 2YNFB 4IG0B 1QAIA 3NBPA 3M9NB 4J2AA 3QEPA 2E9TA 4CHNA 5KFLA 1EP4B 4QPXA 4F4WA 4KV8B 3HPOA 3IGNA 4JV2A 3OYKA 3EY1A 3CWJA 3AVJA 4C8NA 3DOKA 2ZD1B 3GV7B 3ZT0A 3V9WA 1LV5A 3GQCA 1F21A 1NK9A 3MR5A 1ZBIA 1S9GA 3H08A 3HHKA 1S1VA 5KT6A 1K6YA 4FK2A 5FRNA 5J2MA 4RNOA 5KG2A 1B9DA 3MXMA 3G6YA 2GIQA 4KB1A 4M45A 1OS5A 3C6UA 4OLBA 3KJVA 3CDWA 2D0AA 4JRPA 2RDJA 1W9HA 3KOAA 4CJ5A 4CEBA 2QKBA 4CJUA 2XRIA 1QUVA 2R2UA 3KLIB 5EU7A 4KTQA 5C24B 3MR6A 1D0EA 1JXBA 2BRKA 4U6PA 3SV4A 3BQ1A 3QO9B 5J2QB 3BQ2A 4CIEA 4AH9A 1GX5A 1T94A 3AO2A 4M3RA 1C0UB 1RT6B 3AA4A 1LWEB 3HYFA 3VQBA 2ILZA 3KLVA 4BE1A 1CSJA 4ED2A 2HHWA 1GOAA 1S9EA 1TL1A 1XHZA 2W7OA 2ALZA 1Y97A 3OSPA 4B9UA 4I9LA 3NL0A 1IH7A 5J2PB 4DQPA 1NOYA 3M9MB 5KFZA 4FZXC 1NJXA 4XO0A 2GIRA 2HNYB 1X9WA 2FLPA 3G6VA 1RTIB 1A5WA 4M3ZA 2IC3B 5F8HA 4KO0B 3CIZA 2IAJB 4ZTFA 2DFHA 3V4IA 3AVFA 5F8LA 2V9WA 3LP2B 3KD1E 4DL2A 4ECQA 4O0JA 1HARA 4JUZA 3PHEA 2IBKA 3MFIA 3BSAA 3NCIA 1IKYB 1JLFA 2HMIB 4WFZA 1SKRA 4JV1A 3LP0B 2JC1A 1U45A 2IDOA 4ZHRB 3NGYA 5DLGA 2DFFA 2DY4A 4R0EA 4ICLB 2B43A 3QETA 2XY7A 3K59A 1S48A 3OYGA 3AO1A 4I7FB 1N5YA 3OLBA 4ZP8A 1B92A 1Z25A 3ITHA 4URSA 5J2NA 2W8KA 1JXEA 4NLOA 5KFBA 4I9QA 4FJNA 4Q0BB 3I5CA 3L2QA 2P5OA 3DDKA 1GOCA 1WSIA 1LAVA 4DL6A 3PJWA 3KLHB 5KFFA 2B5JB 3L2RA 2BE2B 3I0SB 3RMDA 3LPTA 4LQ3A 3SUPA 3PO5A 5KGWA 2OPPB 3PW7A 1RDBA 5E41A 2ZE2B 2OPQB 4DTMA 3AVIA 1JX4A 1XHXA 3DYAA 4CIFA 1JLQB 2WOMA 2XO7A 4J9KA 4E0DA 1RT2B 5SWMA 4HKQA 1UWBA 3SI6A 3ZSVA 2D0CA 4DTUA 2OYQA 2XI3A 1SUQA 3S3NA 3L2UA 4DG1B 2NUBA 3TAGA 1TVRA 1JL2A 2Z1IA 2W9BB 1ZTTA 3L2VA 3AO5A 4OJRA 4RW8A 3M8QA 1S97A 4FLVA 1CLQA 2R2SA 1A5VA 3RMAA 1QSYA 3MR2A 3VQCA 3NF8A 2YNHA 1RT1B 1S10A 4OPJA 2V4QA 4HUFA 4EZ6A 3PW0A 4K4WA 4KHNA 1L3VA 3FSIA 3VQ5A 3C6TB 3SPYA 4GVMA 4W5OA 4N47A 1L3TA 4DMNA 4O4GB 3RR7A 4XIUA 3PR4A 3CFOA 3IN5A 4EYHB 1BQNB 2A1SA 4W5RA 2HHUA 2XI2A 3PX4A 5F8JA 2HNZB 1RYSA 1S0OA 1CXUA 2VG6B 5CZ2A 1NK5A 3BSCA 4CJEA 4CHYA 2R8HA 2Z1GA 5HP1B 3DI6B 2P5GA 3MAQA 3FQKA 1YTUA 2O5DA 2HVHA 1J54A 3H5UA 5L1KA 4BACA 3RBDA 4IG3B 2VG5A 4CJKA 1IKXA 2ITGA 3RRGA 4MK7A 1YVFA 1L3UA 4TY8B 4IRCA 4FW2A 5KFSA 4CHPA 4NLGA 2XGPA 5F8IA 4QOZB 4N41A 4RUAA 4EO8A 3L2WA 4H54A 4FBUA 4PY5A 3OYLA 3QEIA 2OPSB 3KK3B 1ASUA 3OYBA 3KK1B 4Y1CA 1K1QA 3OJSA 4NCGA 4B9VA 1C2PA 4ZVHA 4K4SA 2VA2A 1VSJA 1S1WB 2LSNA 3CQ8A 1JLBA 1VRTB 3TR8A 3U3GA 2VWJA 3TWHA 3RR8A 4RW6A 2G8HA 1RT4B 1N4LA 3BDPA 3K5MA 1U47A 2AX1A 3SYZA 3GILA 4MKBA 4J9OA 4KFBB 4CJ4A 4URGA 4MQ3A 2XCAA 4J2BA 3OLAA 3AVHA 1S49A 2RPIA 1N48A 1SL0A 4IH6A 1XR5A 3VQ4A 4DL7A 2D3UA 4FJ7A 3KLGB 3Q8SB 2YNFA 4C8MA 1C1AA 1C1BA 4FS1A 1EP4A 4CFBA 4K4YA 1T05B 4KV8A 4KREA 1RNHA 3NE6A 4KSEB 1EKEA 5KG5A 2ZD1A 3I5AA 3ZCMA 4QWAA 3QZ8A 2UVRA 3SNNA 1ZBUA 5I42B 5KFMA 1SL1A 1QSSA 3HKWA 3GV8B 4DTJA 5KG0A 4CGHA 4ZP7A 3WNGA 1S6QB 3CFPA 2WONB 5KT7A 4HCBA 1I3AA 4FM1A 1TK5A 4FS2A 2XY8A 5DMRA 4DLGA 5HLFB 4JS4A 1I6JA 1D8YA 3QYYA 5DG9A 5C24A 3QIDA 1QHTA 1ASVA 3EZ5A 3RWUA 4OPKA 1MMLA 3RRHA 1FKPB 1S6PB 3O3FA 1I39A 3LAMA 3CJ4A 5KFRA 1FXXA 3BREA 3QO9A 5J2QA 1TGOA 5CZ1A 3CM6A 4BE2A 1RT6A 1TK8A 4K4VA 2RDIA 4K8XA 1LWEA 2OPRB 1RA7A 1WLJA 2VG7B 2X6SA 4G1QB 1LWCB 2RF2B 5HBMB 5KT3A 4NLDA 3BJYA 1YVUA 4ZP9A 3RMBA 2FJXA 4IKFA 3QESA 4DTRA 1BCOA 3LAKA 4OKJA 4DTSA 4I2QB 4XPEA 3AVCA 2IS3A 4DL5A 4J9RA 4E7HA 3M8PB 2HNYA 5L9XA 3KKRA 3K58A 4NLVA 1RTIA 2P51A 3MEEB 3T3FA 4KB0A 4CEEA 2IC3A 4PQUA 1IKVB 4OGEA 2IAJA 1TAQA 2YKMB 1NK6A 2PZSA 3MTKA 3LWLA 3LP2A 2AGPA 3SUQA 4BDPA 2JGUA 2HMIA 4IFVB 3GIKA 3HVRA 1IG9A 3OYAA 3SQ2A 3OVNA 4CCHA 4RW9A 4QAGA 3KLFB 3SJJA 4M3UA 3CFRA 2R7YA 1NK4A 4O3PA 5I3UB 4F8RA 4K8ZA 2E9ZA 4ICLA 4QW9A 3T19A 3A2FA 3OL6A 3CYMA 4DQQA 4I7FA 2KZZA 3QIOA 3EYZA 4E19A 4IDKA 3DM2B 3H4BA 2IOCA 4LSLA 3AO3A 1REVB 5KFAA 3H4DA 4CF1A 4Q0BA 2B6AA 1N56A 4Z4IA 4DSJA 2AWZA 1IO2A 1WN7A 3H5XA 3D28A 4FW1A 3CJ5A 3LALA 1RTJB 4DTNA 1RDDA 3KLHA 4DQRA 1W25A 1YTAA 2B5JA 4E7LA 4QWDA 3AA2A 1DTTB 4CHOA 2OPPA 2BGGA 3Q8RB 3AVAA 2ZE2A 3TABA 4DFMA 4AHTA 3TAEA 1ITGA 4CK1A 3V1QA 4WE1B 3V6DB 4NLWA 3SQ0A 1T03B 5KFWA 1RT2A 2W8LA 3HPGA 3KTQA 3I0RB 3ZSOA 1JLCB 4CF9A 3RMCA 3V9XA 2I5JA 4B9SA 4LSNB 2R2TA 1KFDA 3HPHA 4DG1A 4CEZA 3OYCA 4FYDA 2HHQA 3IRXB 3HO1A 5C42A 3HL8A 1HMVA 2ZQBA 4KKOB 4RW4B 4YMEA 2JEJA 4Z4HA 4TQSA 4F4XA 5DGAA 4FJKA 3L3VA 1S1TB 2OZMA 4WZQA 4CJLA 2OZSA 4PUOB 3VQ8A 3DLKA 2W7PA 1RT1A 4FK0A 5DG8A 3FFIA 1N6QB 1RDRA 3C6TA 4I2PA 2ZKUA 3GYNA 1BHLA 2F8SA 3JSMA 4UQGA 1HQEB 4K50A 1BQNA 3CG7A 1L5UA 1SH3A 3AV9A 4B9NA 2HNZA 3F9KA 2HHTA 1DTQB 3MECB 2RKIA 3PVXA 1ZBFA 3QEVA 2VG6A 2BR0A 3NKYA 2D5RA 2HHVA 1BIZA 3TAFA 3VQSA 2Y1JA 1LW0B 3NH2A 4B8AB 5HP1A 4Z0UA 3DI6A 4TYAA 4DSIA 1ZETA 4HHTA 3H2LA 3SZ2A 1WSFA 1XI1A 3ULDA 4AHRA 4Q44A 3DOLB 3ZSWA 4WXOA 3HJFA 3IGVA 1S4FA 4XPCA 4IH7A 4TY8A 4YR2A 3VQQA 1C1CB 4HYKA 1MU2B 4YFUA 1JKHA 2BQRA 3UR0A 4R8UA 3RB4A 1XR7A 3KHRA 2OPSA 1TL3B 4DL3A 1SL2A 3KK3A 4M3YA 3EZUA 3OS0A 5FRMA 4JS5A 2UUTA 1KTQA 3NF6A 2YNGB 1RBSA 3RB3A 3WNEA 3F73A 3CM5A 3CDEA 1TK0A 1NKEA 4ZPCA 4CEDA 1RT7B 3PUFA 3H59A 4AHCA 2JEFA 4DU4A 3ZT1A 1S1WA 5KFXA 4TN2A 4CJ3A 1LW2A 4QWCA 3RBEA 1NOZA 4ED7A 1RT4A 1JIHA 3HVWA 4DS5A 4K4XA 3Q8PB 2IJFA 1FK9B 1NJZA 4FJ8A 5EWEA 3IG1B 4DS4A 4CESA 3TARA 3V9SA 4Z4EA 3N6LA 1VSLA 3TAMB 2AQ4A 4KBIA 4DL4A 4ZTJA 1JLGA 5KRTA 4FJHA 5KFQA 4F50A 1EETB 1JLAA 5KRSA 5C5JA 4OKEA 3RAXA 1SV5B 1RYRA 4DTOA 4F4ZA 4DQIA 3TANA 5KFPA 4E3SA 4CJSA 4IFYB 3AA5X 3KK2B 3O3GA 4C8LA 1BCMA 4H4MA 3NHGA 4CEAA 3OYDA 4N5SA 4RUCA 3EPGA 4RNNA 4ECRA 4AHUA 3ISND 5I42A 3HP9A 4MFBA 4M42A 3P5JA 4TLRA 1RA6A 4CE9A 4AILC 4O3NA 1BL3A 4JV0A 1S6QA 4LY7A 3LANA 1WAJA 4CGIA 3RB6A 5D3GA 4KHQA 2WONA 4E1MA 4NYZA 5FROA 3V1OA 3VQAA 1WSGA 4MK9A 4C8OA 4FJ5A 2KTQA 2ASLA 2P1JA 5CYQB 4ECSA 2Z1JA 3OS2A 5HLFA 5J2MB 4GC7A 4L8RB 3OYIA 4FZZA 4OL8A 5KG3A 4RNHA 4DTXA 4IKAA 2EHGA 3C6UB 1S1UB 4NRUA 4B8CA 3NH1A 4WFYA 1HNIB 2J6SA 4M3XA 3ISNC 4NLYA 1FKPA 2HB5A 5KG6A 4CIGA 3B6PA 4RW7B 3MXIA 1LWFB 1UA1A 3NAHA 5DK5A 4MKAA 4OKKA 1RTHA 2AJQA 2OPRA 2XGQA 4ED1A 4ECZA 3OY9A 4ELVA 2J6UA 2VG7A 5KT4A 1LWCA 4CJFA 5KGXA 3RAQA 3T1AA 3ASMA 1TKZB 2GUIA 3BSNA 3OYHA 1VSEA 4HUEA 2E6MA 1UAXA 5SZTA 3H98A 3M8PA 1NHUA 3NH0A 4C8KA 2R8IA 2FVSA 3AVMA 4B3OA 3CDUA 4Z4CA 4ID1A 3MEDA 4ID5B 4NLUA 2UVWA 3MEEA 3G10A 4FLXA 3HT3A 5KFYA 2DPIA 1IKVA 4CF0A 3TQ1A 4FLTA 1WNSA 2YKMA 2R8KA 3SQ4A 3NDKA 2AX0A 3ALYA 3V81A 4W5QA 2HHSA 3IAYA 4QWEA 1ZBHA 5KG7A 4O44B 5KT5A 3U3YA 3THVA 4IOBA 4F3OA 5JS1A 5HRNA 4FJGA 2I1RA 1HYSB 5I3UA 4KTZA 1NJWA 1VSHA 2ILYA 4YP3A 3ZT2A 4K4UA 3VQ6A 4N56A 4Q8FA 1RT5B 4CJTA 3HP6A 5KFEA 4KRFA 2IGIA 2D41A 1W0HA 4MK8A 1TV6A 2HNDB 4EBEA 3LZIA 5F8MA 3AO4A 1S0MA 1QE1B
chains in the Genus database with same CATH superfamily
1REVA 5KQDA 3MFHA 1OVYA 3PIOQ 3G6XA 3U8XA 2I9SA 1RTJA 4FDFA 3IR5B 1N5YB 3DLLL 3DLGB 2HGNA 4ZVFA 4LF7J 3FVYA 3FZMA 5D15A 2R7OA 2F8EX 5E3PA 2OANA 3ENQA 2DTJA 2FF6A 3QMLA 1RBTA 4IEEA 3CCUS 1HIYA 1H38A 2ZJPQ 3GP9A 4CT9A 4B3SJ 2PT0A 2UVVA 3W61A 2QTWA 3C14B 4LSNA 4S0MA 4DJBA 2HQDA 3NGZA 3KLEB 3LDQA 4ED8A 2QLBB 3J7ZT 2KQ2A 4YOVA 1K8KA 4LSZB 2VCPA 5L46A 2KL8A 1RB0A 1IKWB 2QG9B 5HROB 4NI2B 1SUQB 3FSYA 1KLNA 3HSJA 1QTNB 3N01A 5GVQA 2MZJA 3AJ1A 4X4PA 5A0YA 4KE5A 1X0FA 1CVJA 3QICA 2DXFA 3CO9A 3I87A 2AGOA 4CLWA 1TP7A 3MWPA 2NUHA 4Q43A 2BOPA 3GE9A 1EARA 2Q0RA 2E1YA 3IA0A 3WUHA 3VEZA 2UUCJ 1A7GE 4GMJB 4B08A 5GAHI 2E20A 1NGHA 1HWIA 4Z37A 4JI2K 1LW0A 2ASMA 2V7YA 2G8IA 4I6MA 5EUHA 2CPEA 4AUKA 1CXQA 4JLHA 5JS2A 2WBMA 3G86A 4EZ9A 1T7PA 1SKWA 2D7SA 2P9PB 3ZSYA 4LH5A 4DV6F 2DT9A 3ZSXA 3KHHA 4ED3A 2ROEA 3H5SA 3VPZA 3V6JA 3OR2A 2RE2A 4FXVA 1C1CA 4ZPBA 4V19S 3K0JA 2DGQA 1UA0A 1N34J 4NCBA 3M8SA 3X1LB 4HT7A 3WQTA 4FZVA 4K0KJ 3TJ8A 1QLNA 5J1EB 3EZWA 1YJWS 1UW9A 2DR6A 3TU5A 4QJVA 4FVMA 4ELTA 1ZBLA 3IXQA 1WC6A 1TMJA 1FRHA 2C2KB 4WFXA 3UPFA 2O01C 3KNAA 5KFOA 2VODA 3OYEA 1FK9A 3M1FA 1PAUB 1IR0A 3JB9k 4CHZA 2E5LJ 3W66A 1RCHA 1RBVA 2G0CA 2XS2A 1KEKA 3TAMA 1M90O 4DR1J 4EO6A 2R2RA 2ERRA 3WEEA 1Q86O 3RGIA 2G1HA 4ITSA 2BE2A 4F36A 4OHXA 1C0MA 1EETA 1VK0A 1ELOA 4LVNP 2Y0BB 3EXCX 1SV5A 4GNIA 2DJWA 2P9KA 4OPHA 3C46A 4J9PA 2BM1A 3O6WA 4ZVOB 2Z1HA 2A10A 4CTAB 2AMCB 3AQOA 3LL3A 5CYMB 1YWXA 4X4RA 4HTIA 2YX4A 3HZEA 1AROP 3I5BA 4ZJQA 3SBTA 3RZAA 2W9BA 5C25B 4H5NA 1WKLA 2DKOB 4IQXA 1Y10A 2C2EA 1LWXA 4CJPA 1FJCA 5KG4A 2BVZA 3E9LA 1OY6A 4AQYJ 4FF2A 2QMWA 2EWHA 2X3DA 2RJZA 1HNVB 1S1UA 4F3MA 3J7YU 4WP8A 1FKOB 3OBYA 4EGLA 1C6VA 2DB1A 4JI1J 4CGGA 3CDBA 1RT3B 3FMBA 4CFDA 1F60B 4NLSA 4RW7A 2YV0X 1LWFA 3SMZA 3T5JA 2QJ3A 1T6CA 3RAMA 3HOTA 5DLFA 1ZS6A 4RKUC 3A3NB 1ZA1B 2MQ8A 1UVIA 1FCAA 2C28A 4CVNE 4LFCJ 3OTOK 2RNEA 1U1PA 2G8UA 4O3QA 3EVWA 2F5GA 3QERA 2PYJA 1F5CA 3WNHA 1Z4UA 4RU2A 3BYRA 1G15A 3IWXA 1TKZA 2QE5A 4B9LA 1S6OA 3UIQA 4PG5A 4NLCA 4W5TA 1YI2N 1SJFA 3TJAA 5K9FA 6FDRA 2R7SA 1FX2A 3CCJS 4ID5A 4AM7A 5KFKA 2YNIB 1YJVA 3BDEA 1RWMB 4OLOA 1RLCL 1IWGA 3W7BA 4YY3K 2AP6A 2QLJB 2QWQA 1WOSA 2UUCF 1RUSA 3M1VA 3TJ9A 4M94A 1N5VA 5LMNJ 4LFAK 1TKTB 3FEYB 1Q8LA 4DR7K 3KK1A 3I82A 1KFSA 2YCHA 5F1XA 4B3MK 1Q5YA 2CGJA 3SFUA 3U7JA 1KD1O 4LMZA 1QAYA 2OEJA 2B4VA 4JI6F 1MLAA 5M2PA 5J1NA 2H51B 2A41A 2P2CB 1WNEA 2NQPA 2KU7A 2JLEA 4ECYA 2FBYA 4NL5A 4RW9B 1VQMS 2HNDA 4F02A 1QE1A 3HT0A 1HNWJ 4KPCA 5EDWA 3DMJB 1FRIA 2E1AA 1XC9A 5EWFA 4USKA 3KG4A 4KHMA 4RCHA 4R25A 2Z2LA 1FDNA 5BYQA 3DDNA 2YWWA 3DLGA 2NXJA 3FMWA 4U8YA 4OLAA 2B6AB 3SBGA 1LK7A 4LF9K 3V6KA 1TMMA 2VA3A 3Q8YA 3JQMA 3UCZP 2ZJQL 4K25A 3D1HA 5M2RA 2C2DA 2GCFA 1NAQA 1IJFB 3A4TA 1Q9XA 1U49A 3C14A 1CBKA 3KLEA 4ENOA 2VFSA 3W8PA 3QEWA 2PAVA 4JYAJ 1S1VB 5HMYA 3BO3A 1IKWA 4P2XA 5HROA 1BGXT 2FPHX 4RWXA 1UOCA 2J8AA 4TSXA 3BY5A 1H0HB 2PIIA 1EWRA 3KJVB 2G1DA 3L0QA 4CEQA 3NAIA 1KONA 2MJUA 3NF9A 3FE1A 5L1JA 4KY3A 4FBTA 4X62K 2VC0A 1U09A 4TKTA 2G8VA 2FLNA 3CCMS 4FF3A 1P9QC 2V34A 4FCYA 2LEBA 4I2PB 1VQKS 4NMXA 4WPAA 3MN7A 4E7KA 4EK2A 2GO9A 4KIAA 4H5RA 1I1GA 1JCGA 4B1WB 4EHTA 2GHVC 2DHXA 3GCWP 1VSKA 2YWHA 3ADAC 2O8BA 1NBWA 3BH6B 2G9OA 3NWRA 1GMWA 3THPA 4N76A 4FZYA 5D0HA 5L1IA 3ENWA 2G8FA 2ASYA 1QQCA 3J81U 5AXNA 1D3WA 5E2QA 5GMDA 2NRHA 2R42A 3M6GA 2DNMA 4HUGA 4IFVA 3CD7A 4EYIB 4K4ZA 4C1NI 1VQ5S 1JXLA 4KAZA 3KLFA 2U1AA 5J1EA 3UE5A 1TFWA 4BVOA 2KKZA 4CD3A 3O4WA 2QWLA 2L9DA 3SLCA 4JKGB 1JLFB 4J2EA 3VQEA 4QOTA 1NK0A 1MWKA 3O3HA 1REGX 2DBBA 4ZOSA 4DV4F 3QINA 1YJRA 3DAWA 4QIGA 2YKOA 4YB7A 1LW2B 1OQ6A 3DLBA 1M1GA 3S1TA 4NZ6A 4BC7A 4QCLA 4C8ZA 1T3VA 2W6KA 1U25A 4HHHA 3AAQA 3TZWA 5L1LA 2MZQA 3RW6A 1YT3A 2LQJA 3C8YA 2OMOA 2UXCF 3S9HA 1EKRA 2IBOA 4CTAA 3NP5A 3HULA 5CYMA 3GYGA 3VQ9A 2HAFA 1BIUA 2XHWA 5AQFA 2HLUA 5IWAF 2CJBA 4DR4K 1JL1A 1BC6A 2MZRA 4DR6K 4C0BA 4X4SA 5C25A 2FQQB 1GOBA 4G65A 3A0IX 2HQGA 1ESVA 3BEGB 1FI4A 3J81O 3N6MA 4NXMK 2QFIA 4MFBB 3QSIA 2MZTA 1NNEA 3THYB 4DFKA 1RDUA 3A1YG 4QR1A 4FJIA 1HNVA 5T7LB 2AZ3A 2DGWA 2Q3SA 1FKOA 2XY5A 1XNRJ 3U6FA 2GZOA 3HX9A 4OLPA 3LW5C 4B3TJ 1WF0A 1RT3A 2J8SA 1BG3A 4QW8A 4FM0A 2AU0A 2EX3A 2MXYA 3W9HA 1NKCA 4AXIA 4DV0K 1NWKA 5HI7A 1RBRA 2GAHC 4NPOA 2HRUA 3SMSA 4CFAA 2NRVA 3CJCA 4NX9A 5HRRA 1HKGA 4YOXA 1KDNA 1U04A 2ZBQA 2F4FA 1WI6A 3SCXA 1GX6A 3S41A 3C15B 1NLKL 3I4HX 1FF2A 2YNIA 3LDSA 3SQ1A 4HL9A 4UT4A 3N6NA 5KPTA 4ZMMA 1PILA 1O5JA 2M9KA 3PY8A 2L9NA 1RHRB 4WYWA 4KHPK 4QIVA 4Y2AA 2OH2A 2OA8A 2HWIA 1KSPA 3F0NA 4CLUA 1BA0A 1TKTA 4MLHA 1B4SA 1HBNB 3TX8A 3SJHA 5D0RA 1AFIA 3SUOA 4O0NA 1RT7A 3N4PA 1UVLA 3AVGA 1CPZA 1RCOB 4J5OA 4JV5F 4C0HA 4KI4A 2BTFA 1VQLN 2UXDK 3KNGA 3EO3A 1KCFA 4ZLJA 2GELA 1KVAA 1B0VA 1FESA 2ZF5O 4DHYA 4BDZA 3FQLA 2BDPA 3NAEA 3HM9A 1RWWB 2H3GX 4QZVB 3GIRA 3DMJA 3AOBA 4Q2LA 4RW6B 2W25A 5DDOC 3OL8A 3HF5A 2N4CA 5GIOA 1M0SA 2BKPA 2ZH5A 2D4WA 1TL7A 1EX4A 2F7VA 5DQIA 1C0TB 2XEXA 4CW7B 3GJRB 4BRGA 1NK7A 2W42A 4OYAA 4HCCA 4CZFA 1XR6A 2GNKA 4J2AA 2YNFB 2E9TA 2DK2A 2DNLA 2KVIA 4F4WA 1URRA 3W5ZA 4KV8B 5EOYA 5AQQA 3T1HJ 4C8NA 2VOOA 2K3IA 5ADXA 3V9WA 1LV5A 2E8AA 1NK9A 1YDLA 3HHKA 3PIOL 1S1VA 2XYGB 2ZDPA 3NGKA 4FK2A 2I2YA 3G82B 3MXMA 4F0MA 1M1KO 2CIMA 3G6YA 2O8DB 1UFWA 4KC5A 2ZHOA 3KJVA 1W7WA 4JRPA 2XMUA 2QXLA 1BLUA 3AFGA 2RDJA 5AJ3K 3P6YC 4CJ5A 1NGDA 1UEVA 2QKBA 2CJAA 2V63A 4M63C 1RAHB 3HI9A 1FXLA 2XRIA 1DFDA 3BUZB 3O5BA 2ZJPL 1FEEA 5EU7A 5A8WA 5JVHQ 4BRDA 3W9IA 3MR6A 1R0BG 4LFBF 2GQQA 4CZGA 1RLDA 2YJFA 2O8FB 3J8AA 2RMLA 1CQMA 1FVSA 2W6LA 1HBUB 4DKWA 3QO9B 1NZAA 1ATSA 3TEHB 2VWBA 2XLJA 3AO2A 4M3RA 1RT6B 1RWOB 2EFOA 3VQBA 3CUNA 4PHTX 4BQLA 4PKDB 4CM2A 4ED2A 2HBLA 1GOAA 4CNYA 1YSJA 4YN3B 1T9VA 4ZLLA 3GB0A 4B9UA 4I9LA 1EWQA 1RGIA 3M2RB 1GT8A 1NJXA 2D9OA 3G6VA 4H5VA 3P3DA 3D2WA 3I96A 2KT3A 1NGEA 4PXEA 4P10A 5AQZA 1LEOA 5F8LA 3DNCA 3H1VX 3LP2B 2HS4A 4DL2A 1FWKA 3D4JA 4GKKF 3PHEA 3EKUA 1JLFA 2E5JA 4YB5A 5FPNA 1R8BA 1VQ6N 2OTLN 1SKRA 1NO8A 1HW8A 3LP0B 5U47A 1U45A 2IDOA 3U02A 2N82B 5DLGA 2DFFA 2DY4A 4CLTA 1X4DA 4R0EA 1D4XA 3MAAB 2MGZB 4ICLB 3AJDA 1T11A 3DWLA 2RQMA 1KBRA 3FR0A 5K8PA 3OLBA 2V51B 1Z25A 4URSA 1EKSA 3OTOF 2W8KA 4I9QA 3DDKA 1GOCA 3UDVA 4CO2A 4QYZK 1S12A 4ETZA 3PJWA 3CJAA 3KJQB 2AW0A 3L2RA 3I0SB 2MPUA 3AD7C 2JVRA 5I4MA 3SUPA 5KGWA 2ZZTA 5DJBA 1J27A 2K2PA 5GADI 2GQ2A 2OPQB 3QT7A 3TQEA 3CDAA 4U9RA 3IWNC 5JMNA 1DRZA 4YY3F 3H6EA 1VRQC 2XO7A 4ILMA 3SI6A 3HHLC 3ZSVA 1X4BA 2D0CA 4L76A 4DTUA 4JI8K 2XI3A 1MDUB 3L2UA 3THYA 1TVRA 2EEYA 2EG2A 2AZ1A 3R1HA 2DCUB 1ZTTA 3L2VA 1V4SA 5T7LA 4NO7A 4OHYA 1S97A 4LIWA 2R2SA 1XUPO 2BV3A 5H1SQ 1A5VA 5LSOA 3RMAA 3MR2A 1AFJA 3VQCA 1F5BA 2MKIA 4OPJA 2V4QA 3AT1B 3W62A 4EZ6A 4HUFA 4I6WA 4ED5A 3PW0A 4KHNA 1CJKB 3L4BC 3FSIA 5D0EA 2C3MA 4GVMA 1VQ8N 4N47A 2WBRA 1G99A 3VV2B 3CFOA 4USWA 5AXKA 1BQNB 1BHNA 4ILHA 1IBKJ 1YJTA 3E9PA 1X7VA 1TELA 2VASA 4ZCLA 3MPWA 1QM9A 3C15A 5CABA 5KAKA 4CHYA 5AQWA 2Z1GA 3MAQA 2OFHX 3RSEB 2O5DA 3VGTA 5A8RB 2MHNA 2RRAA 1J54A 3JTNA 2VOPA 4OHVA 3FBBA 3H1QA 3VHQA 3R6MA 2XZTB 4F0KA 3Q83A 1XNQF 2ZDOA 4A61A 3VGSA 3CCUN 4YHHF 1HBNA 3ENBA 2XTJP 4QOZB 2ZBRA 4DV7J 3QEIA 4B1YB 1HNZJ 1ASUA 3PRDA 3L9ZA 1C2PA 5BYSA 1WEZA 2WAQD 4A5BA 3CGIA 4DHVA 1OH8A 3CQ8A 4MIWA 3MUMP 2VWJA 2BM0A 2EWSA 2GO8A 3RR8A 4RW6A 4CZHA 4EMDA 3BDPA 3M8YA 4B1ZA 1U47A 5E3CA 3SYZA 4KFBB 1TL5A 2YX1A 4B3RJ 3UKUA 3GSIA 4J2BA 4DV1J 5GAEP 1QZ6A 3HOSA 4DL7A 6AT1B 1IQTA 1I5OB 5DDPC 2HIYA 3Q8SB 2YNFA 5L9NA 5BPLA 3TZZA 2ROPA 1I94J 3GMGA 2NRXA 4CFBA 4KV8A 1F9HA 3UI3A 4KREA 2GV1A 5IV4A 2DR5A 2P9IB 2ZOGA 5KG5A 1U1QA 4DCJB 4X84A 5F41A 3SNNA 4BC9A 4UQTA 1SL1A 5EX3A 1NGBA 3HKWA 3SCKE 5KG0A 1T95A 2DH8A 3ZFVA 2GW8A 3G82A 1CULB 4KGVB 1N32K 2DGUA 4YOEA 2PA3A 2O8DA 2B56A 1RAAB 2QWPA 4HCBA 4FS2A 1FNMA 4MDAA 1OWXA 3BN7A 4DLGA 2UUBF 4B1VA 3BYPA 3MHYA 1YZ7A 3GCXP 1I3OB 4JS4A 4GO7X 1VQNS 4DUZK 4U7BA 4FWRA 2KHDA 4M5NA 4DPTA 4P72A 1ASVA 3VF2A 5K8NA 4OPKA 1YJWN 2GEMA 1HHSA 5KFRA 1FXXA 1GLJO 3BREA 2OSRA 2D9PA 3PLAA 3QO9A 3FUYA 2F4VF 3CM6A 1RT6A 5AQGA 1RE1B 3WIVA 4RL1A 2VONA 3FBFA 3VGUA 1LWCB 5HBMB 2B3TB 5KT3A 1VBKA 3RMBA 4IKFA 4KQZA 3JS9A 1KS2A 2ZBCA 4OKJA 4E2FB 4DTSA 3I56S 2YH1A 3AVCA 2IS3A 2W1BA 4J9RA 1BQXA 2DNNA 3M2RA 2N7CA 4OX9K 4M5JA 3J7A1 2YWGA 2DXDA 2HRYA 4PQUA 4OGEA 5C2FA 2E7XA 3HHNB 1NK6A 1KQFB 2CQBA 5JICA 3LP2A 1RHMB 1LXNA 3NXZA 4FWQA 2AGPA 4WKYA 5DRKA 3A5NC 3UNYA 4LR8A 4BDPA 2JGUA 3ZZ0A 3T41A 3CJKA 1S4EA 4MAKA 4HH1A 2I8EA 1DY3A 3F41A 2P9GA 3MAAA 2KXNB 2MGZA 4ICLA 4U7UK 4BRCA 1VFJA 3OL6A 3CYMA 3OTDA 1U1MA 2WSCC 5BR8K 3LGMA 2KZZA 3QIOA 3UDCA 4IDKA 3DM2B 3EL2A 4OHZA 2O66A 2AEFA 2F9JA 1PGZA 4CF1A 3VAMA 2B4OA 1IO2A 1WN7A 2K1RB 2ATCB 4FW1A 3B8HA 2C3UA 3BGLA 3LALA 4DTNA 1W25A 3ZX2A 4E7LA 1SJ1A 1UZHA 4QWDA 2PBDA 3AA2A 2Q36A 4CHOA 4JI0K 1J5EJ 2BGGA 3FZBA 2C3OA 3Q8RB 2BJ9A 4AHTA 2IYGA 2XM3A 1X31C 2QTDA 4ZPWR 3AB2B 1EJ7L 5H1SV 2BX6A 4UY8T 4U8VA 1Y9OA 2UXBJ 2AEMA 1UWAA 1JLCB 4B3RF 2I5JA 3S8SA 1N8RT 2A2CA 3OYCA 3IRXB 3CCJN 3HL8A 1HMVA 1Y11A 3DXMA 4A8QA 4RW4B 4Z4HA 4RUBA 5DGAA 4FJKA 5MLCQ 4ETXA 1S1TB 2OZMA 2IVFB 4DZ6A 4Q7AA 2OZSA 1WDTA 3M8ZA 5C12A 3VQ8A 2OEKA 3NRBA 2QEXS 1Q0NA 1HHTP 1CJKA 2CQ4A 4MT1A 5D4NA 1BE4A 3GYNA 3J7AN 1AYEA 2XMKA 4UQGA 1BQNA 3CG7A 1L5UA 1PYTA 1UEKA 3B78A 3CMAS 1SH3A 3AV9A 2J7UA 3OXGA 4B9NA 1ZBTA 1DTQB 4DV2J 3MECB 3PVXA 1SXLA 3D7EO 2YWFA 2Y1JA 3NH2A 1HL6A 2NZTA 2K06A 4HHTA 2EK6A 3AD8C 2V8DA 4CLKA 3H2LA 3RSEA 4X64J 2A1BA 1WSFA 1XI1A 4AHRA 1VQ4S 4DX6A 3FZLA 4JI7J 3HJFA 2UUAJ 1S4FA 1Z1ZA 1U6BA 2Y8WA 4YR2A 3VQQA 3CJ9A 4DXLA 1MU2B 3UR0A 1TL3B 5HL7Q 2UUTA 4BG8A 3QRRA 5BN8A 1SKUB 4OYXA 3WNEA 2F1FA 4DX5A 3CDEA 1TK0A 4BS2A 4CEDA 3H59A 1EZZB 1X5PA 3RBEA 1BXNA 1OY8A 3VTHA 1R6VA 4K4XA 1IBLK 1WELA 1WD6A 3IG1B 2ZHAA 2ZFHA 3TARA 4CYUB 5HVHA 1WOQA 4ZVPB 4Z4EA 2AQ4A 2FIUA 3VOVA 4DL4A 3GPAA 1K8AT 5C5JA 3H7HB 2PD1A 3O8WA 3TANA 2CUYA 3THXA 3O3GA 1VQKN 5B0DA 5AZJB 1P9YA 3NHGA 3I4PA 1RJJA 2P9IA 1NJIO 2RRNA 1NSAA 4WTYA 4CEAA 3OYDA 2PMHA 3NGUA 3VAHA 1VHFA 5M1KA 3ISND 4M42A 3TUZC 3IMXA 4CE9A 4O3NA 1ITPA 4X66F 1RI7A 3IM9A 3ZETB 1CULA 3ENAA 4KHQA 5CHIA 5FROA 3VQAA 1XMQK 1M5HA 4FJ5A 1J5EF 1FRMA 2P1JA 5CYQB 4Y6IA 2Z1JA 4XH1A 5J2MB 4OJ1A 4OL8A 2NR0A 4ANCA 1QDUB 4I4BA 1GMWD 2DH7A 4DTXA 3H25A 1HWUA 3C6UB 2NPFA 1VQ5N 2AP1A 2UXBF 4WFYA 2W01A 4NLYA 3FRYA 1VHXA 4IJNA 3B6PA 1B7YB 1NXIA 5ETPA 2PO4A 3NAHA 5DK5A 2DHHA 1BMQB 5CCLA 3JTOA 1Q18A 4OYOA 5C10A 3SCJE 4ECZA 3PACA 2VV5A 4ELVA 1D9AA 3W1YC 5AXLA 1LWCA 5KGXA 3W63A 2OAUA 1NSPA 2QA4G 3BSNA 1UJ5A 4C8KA 2R8IA 3K2YA 4B3OA 3WQUA 2CWKA 4ZVUB 4QQBA 4U67Q 2GQCA 4NLUA 5JVHL 4P9SA 1H74A 4JI2J 3DLJA 3HBTA 2W40A 2HFZA 4MMOA 1EAYC 2O67A 4W5QA 2HHSA 2E29A 1VLYA 4KGKA 4QWEA 4O44B 1WBBA 3MM8B 3EWGA 4IUFA 1HBOB 3CPEA 4DR5J 1C0FA 5JS1A 1FERA 5D78A 2I1RA 2YKQA 1HYSB 4I0WA 2HVEA 1H7XA 1NJWA 2ILYA 2EFQA 3ZT2A 1SJRA 3E1YA 4CJTA 3HP6A 2IGIA 2E88A 2CH6A 1W0HA 4MK8A 1VOMA 1TV6A 3KVGA 1MWYA 3LZIA 3TP2A 3DM2A 1MG7A 1Q8BA 2VL1A 3MCSA 1WUAA 3ELHA 3PW5A 3OJUA 1XMOK 2DR9A 3OFFA 2K1RA 3PYEA 2H4YB 3NNHA 3D68A 1NCLA 2ETJA 4B02A 3SQGB 1PJ6A 3A8KA 2ZH8A 4OV6A 3SV3A 1VCTA 2FJWA 1P8ZA 4DU7A 1XWLA 1WHWA 2NS1B 5KFIA 3MX5A 5G0RB 5IS2A 2XMJA 4DF4A 4HVJA 1JLCA 3QLHB 1NJYA 3R1XA 3BO2A 3R8YA 3VA3A 4QIFA 4NMLA 3E01B 2WTFA 1U8WA 3DYAB 4P74A 4C3LA 4CK3A 3L3UA 4RW4A 3TZYA 1UWBB 1JQGA 1NK8A 1S1TA 1H2TZ 2WZ1A 3KMQA 3TI0A 1RHJB 2DNQA 3OBIA 2IA6A 3C66A 4BWMA 3ZZPA 1KQSM 2DNYA 3OFEA 1FNOA 4QS9A 2RD5C 4CM0A 5D4PA 2FLOA 4Q45A 2XY6A 4P2FA 1GLAG 3GLJA 2ASDA 3MM6B 3BR9A 4M5KA 1WSEA 3A8JA 3KWIA 2Q6CA 1RADB 1TFYA 2A1RA 1FJGK 1FXRA 4WXWA 2PSZA 1DTQA 2G8WA 3MECA 2VQEK 3OS1A 3B54A 3J80U 3HFZB 1R27B 3CPWR 3L4QA 4BR0A 5EN1A 2LU2A 1WB9A 2ZUGA 2D0BA 2NRTA 4QPTA 3QJJA 2WHOA 5J2PA 2JNJA 3MD1A 5DQGA 3OW2M 4F4AA 2OELA 2P9SB 1D5AA 5ETKA 4C48A 5LSRA 3LDOA 4GO5X 4H4KC 3G2XA 3PV8A 3AGKA 1NZ8A 1MU2A 2O8EA 2ZC3A 2FVQA 3M7VA 2AJ2A 1HNXK 3PCOB 3CD5A 3ZZYA 2CQ0A 4EEYA 2B8QA 4OX8A 1TL3A 2FSJA 2RN2A 3S6EA 4GKJK 3QATA 1QJHA 3VQTA 5KTQA 4JKBA 1VISA 4P2SA 3PEJA 4USUA 3C95A 2J0WA 1XC3A 4QS7A 4DFJA 2KM8B 1UEUA 4YDUC 3QFHA 4JB8B 2E1CA 3S3OA 3PDNA 2FJBB 4IBNA 4LFAJ 4DSKA 4A8MP 2IJNA 4DR7J 3IG1A 3P1GA 4B3MJ 3JQKA 4CYUA 2CJQA 2JWKA 3MMAB 2P5VA 1WAFA 4KPYA 2IM2A 2FB0A 4QU6A 4FPRA 2LVWA 2F9TA 3QGGA 2EC0A 2CKWA 1JWWA 3GIJA 3LP3A 3J80O 4CI0B 4C2MA 5AZJA 2Q3PA 3CJ0A 1JLQA 3OHRA 5ETNA 1N0UA 1C1BB 1WUUA 3ZT4A 2DHAA 4WF9Q 3PJXA 5T14A 3KJFB 2LLZA 3D2EA 3CVKA 5DGBA 3QBWA 1KVBA 1OIAA 3AARA 1HYZA 2KRRA 1Q5VA 3WX8A 4LF9J 1DKGD 1SQEA 4MKYA 3D5MA 3JYTB 4ES1A 4LF4F 1VSFA 2B9XA 1D1UA 5CYQA 4CECA 1VBYA 4IDHA 1JLEB 4FWNA 4UOFA 4JI3J 1YZ6A 2V9KA 2JEIA 2GVDA 4CZKA 2XHBA 3BQ0A 2H5EA 4N7TA 3O3LA 3HD1A 2M2BA 1TKXB 5H9EK 2KG0A 4CJQA 3Q0AA 3CQYA 3GIMA 2R7VA 2GS8A 2FJEB 3T7ZA 2FHJA 4YNQA 2IHR1 2XHCA 1N33F 2QL5B 3T5KA 4YDDB 4JI0F 1BI4B 2QW9A 4R0JA 1HR0F 4X62J 3CJSA 2QA4S 5KFNA 1NM2A 4FXDA 1DLOB 2LMIA 4IG3A 3DRPB 1X1PA 2E1MC 4E7JA 1WOOA 4Q5VA 4CHQA 3I8DA 4IH5A 1WBDA 5FDLB 3QIPB 2WBNA 4CZIA 5ADZA 3R2DJ 3CJ2A 3IFEA 2V52B 3NOGA 2CNKB 1BUXA 4FF4A 1T9TA 1KAZA 2QLWA 3TEGA 3V9UA 4J9MA 4O44A 3VAIA 2GC8A 3NMAA 1HBOA 1P90A 3QT5A 3W9JA 4CZMA 4PPZA 1HYSA 4J9LA 4CEFA 2F9DA 2FC8A 2AIRB 4AHVA 4URQU 4RO0A 1IR1A 2X1BA 3OXFA 2B9EA 3GV5B 4KBOA 4ZVSB 2H9ZA 2RB7A 3P39A 3CJ7A 2NCKL 4ZDNA 1HBMB 4A5AA 3TUJC 3SQGA 3ULHA 1JNZB 3HSGA 4C1NK 4CERA 4NOHA 1TU0B 4AE5A 3HMJG 4PKGA 1D9FA 2YKNB 1R31A 2Y8YA 4PABA 4RG8A 4WJBA 2V67A 1NGJA 4LF5K 2E1RA 2FBXA 3ZSQA 5KFCA 1X4HA 4F4YA 3QLHA 4GV9A 2DNPA 1SCJB 4FP9A 2YQ3A 3E01A 3ZSRA 3LWMA 4Y1DA 2Y1IA 3KDNA 2DNHA 4FPAA 3RBXA 4MTPA 3PR5B 1S9GB 2NZ4A 2RAQA 4JK7A 4A8OA 4JKHA 3A8EA 3S3MA 1LNQA 4LF8K 4DI6A 3E9OA 4C11B 4CO1A 1RWUA 4JEPA 2RHSB 4ZCMA 4DR4J 3I9V9 5KFHA 5H9FK 4NZ7A 5ADXH 2Q66A 3O4QA 4GVEA 1S6PA 4JI4F 4PKIA 1IBLF 3MM6A 4C4WA 2XQCA 3PX0A 2FBVA 1WOPA 4NXMJ 2HHHJ 3QFWA 3K9JA 2N7YA 1IJEB 4J9SA 3WNFA 1RHKB 4NLQA 1HJOA 8ATCB 4ED6A 3FFIB 3THWB 4WU2A 2APOA 5DG7A 2IVMA 1YX2A 5IQ6A 2ZM6K 3JSMB 2P9CA 3P5TL 2CQGA 1KN6A 1ZYQA 1SKSA 1IV0A 3PZPA 3M8WA 4NRTA 4YEAA 3ZLJA 2RKIB 4FJMA 3TSUA 3N5BA 1OSCA 4O5BA 4PKHA 2P9SA 1NMEB 4KH1B 4DV0J 3KXDA 1JMTA 2KFNA 3D3CJ 3D0PA 3QGIA 4ZIWA 1KKHA 3LH2S 3K5OA 2MLZA 3SDEA 4CGJA 1O6XA 4KHRA 3N9UC 3HSCA 2V2ZA 2WRMA 3HD2A 1VI7A 2XWYA 2VKZG 1NRKA 1YXQA 3OA9A 1D8ZA 4DQSA 4KAIA 4WBFA 1BISA 4E89A 2BEFA 1E6YB 1XMQF 1U48A 2D0OA 2FVPA 3MAHA 2VQFJ 2QK9A 1OO0B 3C0BA 2C1EB 2ZBPA 1JKHB 2Q97A 4JKCA 4R8UB 3KMSA 3AA3A 5ETTA 4FNIA 1KHWA 1MSWD 4X2BA 4KHPJ 1PBUA 4FJXA 1J6ZA 3C65A 1IBMF 4DMZA 2VWKA 4O55A 3J7YP 3HDSA 3KWMA 3EE3A 1TR0A 4DV3F 3NGDA 4ECUA 4HTJA 3CC2S 1VQNN 4CJWA 2UXDJ 3U9ZA 4F04B 1WSHA 4YR0A 2WVBA 1HHQA 3VAGA 1YJUA 3KJNB 5CHCB 5HL7L 4Z4FA 3GG0A 1GMVA 7FDRA 3KHYA 3KK7A 2QN6B 1DGKN 2DGXA 2HQFA 3R5DA 1SB6A 4UUXA 1EIYB 1CJUB 3WXJA 4ECWA 5DQHA 3I0RA 5E26A 1JLAB 1O0PA 2E1PA 3CCTA 1BWVA 5GAEI 4BRHA 4H4MB 2M0GB 2NLWA 5I3QA 1S72S 4DV6K 2VGMA 5E84A 3JYTA 3I56N 3V5RA 1YRUA 3R5BA 3SAHA 3QGHA 4E1JA 2HZCA 4NXNK 2V4RA 4KH4A 1JLEA 4M3WA 1P1LA 4NYFA 4CGFA 5FIIA 4FJLA 2FZKB 2IRYA 1NGCA 2PYLA 5CZXA 3J81Y 2CRLA 4CFCA 3U9DA 3QZ7A 1TKXA 4OYIA 3IUCA 1EXQA 3R5AA 1TKDA 3H45C 3UQSA 4CNZA 3T6BA 2BACA 1MWZA 1S79A 2E4LA 1S9FA 4ES3A 2VBWA 2FZGB 3ONQA 1UP1A 1BI4A 3KKSA 1TYQB 3AOAA 5AQMA 2HQCA 4LR7A 3ID6A 3Q7BA 2HKEA 1DLOA 1RCXB 2YHBA 3DRPA 1UVKA 4ANDA 1HJRA 1VS3A 4HI1A 5BR9A 2ZZMA 4Y65A 2PDAA 4ZVGA 3B4DA 5FDLA 3QIPA 4FPIA 4A2AA 1ATRA 3GIIA 2MKYA 1UVMA 1CLFA 3MXJA 1T6DA 4FN5A 4F9OA 5HQLA 4EBDA 3MEDB 3MN5A 5BPNA 5D6GA 2RH3A 3NNAA 4CK2A 5B7WA 1RILA 3SSSA 3J7AP 1B0PA 3Q8VA 5D77A 5EX0A 2LEPA 2UU9F 4K43A 1HLUA 3OYJA 4BY9C 3V81B 4K4TA 1VQPS 1MN7A 4U96A 2KW4A 2RHQB 1SPBP 2HURA 3GWCA 4X65F 3SCLE 5KFUA 4GRSA 4ANEA 3MF5A 4JKDA 4ZPTR 1F1BB 3AVNA 4U67L 1FJGF 4TQRA 4DFPA 3AVBA 3DKDA 5HRPA 1IM4A 1HBMA 1HKAA 4CBWA 1Z2ZA 5RUBA 1U8SA 1TAUA 1CJTB 4B3SK 3MDQA 3NS6A 1AT1B 2UUWA 1Y3JA 1SH2A 2QEXN 4FWSA 2YKNA 4ECVA 1FNXH 1WSJA 2CPZA 4DSFA 3KK2A 1KHVA 3FDSA 3QSYB 3MM9B 3POTB 5IOLA 4L74A 3CMAN 3A3OB 4CHNA 3R5CA 3HFVA 4DCOB 3IGNA 3OYKA 3Q23A 2MYFA 3CWJA 4OZNA 3AVJA 4QYZJ 3JSRA 2ZD1B 1ZM9A 2EVZA 4DUTA 4D3HA 3ENVA 2LP4A 1F21A 2ZGYA 3IFRA 2W2QP 1S9GA 2OSQA 2KN4A 2YHWA 1Q4RA 1VQ4N 5A6WA 2P9NB 5E0OA 3NNCA 2G0JA 2DY9A 2GIQA 2UUCK 3IR7B 4K42A 2YX7A 1K8KB 4CH7A 3KOAA 1NDPA 4CEBA 2BJ3A 3MCPA 4LF6J 1RQ0A 1LOUA 2QZ8A 3KG0A 4G6VB 5IT4A 4CJUA 2R2UA 4JI6K 3EN9A 4NA2A 1OVQA 3WXLA 4BGAA 1B70B 5AQKA 2R7RA 5C2CA 3THWA 2OEMA 2DNOA 3SV4A 3BQ1A 3BQ2A 2RHKA 4FWKA 4K41A 2ILZA 1CSJA 3G96A 1E3MA 1E4GT 3OSPA 3NL0A 1IH7A 5K20B 1KC8O 3M9MB 3UKRB 2MQLA 4BG9A 2GIRA 4BLGA 2FLPA 2CDQA 3E8OA 1RTIB 4NASA 1JXVA 1S7HA 4M3ZA 2HBQB 1E6YA 4DPWA 2OCEA 2IC3B 1B0TA 3OFGA 1XERA 2IAJB 3CIZA 1KNZA 2DFHA 2MQOA 2CNLB 2J7WA 3OVAA 3OR2B 3NGSA 2V9WA 1PIEA 1U1NA 4ECQA 3IRWP 1YBUA 4DUYJ 1HARA 2ZBIA 3BEXA 4BRAA 2DNGA 1UL3A 4RBUA 2DGOA 2HMIB 4WFZA 3A3PB 4WQ4C 2PA8D 2NZCA 2JC1A 4HVZA 3M32B 3BS9A 3QBXA 3ZTQA 3LPYA 3MCNA 3ZTRA 1I51B 3K59A 2XY7A 4OZ1A 2VFRA 1U24A 3NS5A 3UD5A 1N0VC 1B92A 3MCMA 5IT0A 3QT8A 4ES2A 2XMVA 4AFFA 3IC1A 3PYGA 4Q0BB 4ZCKA 3I5CA 2P5OA 1YF5L 1C4AA 2L41A 2MQMA 3WEEB 5JVGQ 1XBWA 4PQAA 3NG8A 5KFFA 2B5JB 5D0GA 2BE2B 3RMDA 4LQ3A 5FLXY 1CJUA 4AQYK 1RDBA 2Z56B 1FFSB 4XAKA 2NXEA 1JX4A 2WOMA 4J9KA 2VDIA 5SWMA 4OFZA 4M5LA 3FNNA 1X5SA 1F0XA 1X4EA 4A8XA 2EFGA 2X1FA 4DG1B 3TAGA 1JL2A 5CXTA 2W9BB 3M05A 2ZITA 5AQXA 1ILYA 2K7JA 4OJRA 1R3NA 2VYPA 2B4UA 3EGZA 1N8RO 2CZVC 2DISA 2YNHA 2Q31A 4FPBA 1RT1B 3N4WA 1FFWB 1S10A 3HTVA 2CPJA 4K4WA 1IR2A 4WF9L 1N32J 4KYZA 2F65A 3C6TB 4A2BA 4OI2A 1TUGB 4DMNA 2I6WA 4NEZA 2LDYA 5KPZA 2A1SA 4DV4K 1X60A 2XI2A 3PX4A 1TYQA 5M1FA 3ATVA 2DNKA 4HEA9 1S0OA 2MDAA 1JCFA 3DGPB 4DUZJ 1T44A 4ZVTB 2VG6B 5CZ2A 1R8AA 3BSCA 2CNNB 4LC9B 3W60A 9ATCB 2OD6A 3ZX3A 2YTCA 3T69A 1IQZA 4HHJA 2P5GA 3FQKA 1Y3KA 4YB1P 1RAIB 1VIXA 4D3GA 5L1KA 4CLSA 5C0YA 2ITGA 3O9SA 2ALYB 1U1OA 1YVFA 1L3UA 4TY8B 3H8YA 4FW2A 4CHPA 3TW0A 5IWAK 3DOMB 2Z2ZA 4LF8F 3JQJA 2ZNZA 1N5SA 4N41A 4RUAA 4EO8A 1YK9A 4IO1A 4K8RA 5BJRA 3KK3B 3H3NO 1M90T 3KK1B 4OX9J 4YB6A 1BO5O 4L75A 3BB5A 4K4SA 2VA2A 2ADBA 4O23A 1VQ7S 4DR2F 1L3KA 3CC4S 3CULA 1T02A 1RT4B 1LFWA 4QR2A 2HHPA 1CJTA 3MPVA 1Q7LB 2ZM6F 1SIWB 2LU1A 1V5IB 4DUYF 4URGA 4CJ4A 3OLAA 3AVHA 2BJEA 1S49A 4DR3F 1SL0A 2FSNA 3IP0A 1KR4A 2D3UA 3MM9A 4JYAK 4PAAA 3POTA 1VR6A 2MLYA 2WSFC 5BR8J 5E5NA 1C1AA 2XNRA 4UF4A 4K4YA 2L9WA 3M2UB 1PC4A 7AT1B 1RNHA 4BRMA 2ZOFA 3NE6A 1CJVA 1X9JA 2ZD1A 5HN0A 4Y2KA 1QSSA 5I42B 1KXPA 3FFKB 3GV8B 2P9NA 4M5MA 2KKHA 4ZP7A 2RRBA 4EWTA 3SK3A 3HHLB 1NEEA 1YJNS 5KT7A 1QVFM 2JH3A 4FVCA 2E5GA 2XY8A 5DMRA 5IV3A 3EE8A 4BREA 1ZBSA 3HZGA 2H1YA 3QYYA 1ROFA 1RU1A 5LSLA 1RBAA 4LREA 1M5VC 4JV5K 4USHA 3QIDA 1W97L 3ZEUB 3LDNA 3RRHA 1I39A 1N5TA 2Y9HA 1RKJA 3LOUA 3PYFA 1T0TV 5HOOA 4WK3A 1SC1B 1WLJA 2VG7B 1OH5A 2P6SA 3BJYA 1YVUA 4NLDA 2FJXA 3C6HA 4DTRA 3TOQA 1KD1T 4WIQA 3UKRA 2ZH6A 1Q81O 1RTIA 2O8BB 2XLIA 2HK3A 3T3FA 2IC3A 2IAJA 4UW2A 5FPDA 3TA0A 2YKMB 3VERA 4NXNF 2XS7A 2PZSA 3LWLA 2YWKA 3I32A 4QYRA 3MDFA 3D2FB 2OFGX 5M1NA 3SUQA 2LYVA 3CJ8A 1Q95G 3ISZA 2HMIA 4IFVB 4JI5J 3GIKA 1PO6A 1RDWX 1IG9A 1NPKA 2XMWA 3OVNA 4JKEA 3KLFB 1MW7A 3M32A 2DNRA 2YVSA 1KP6A 5JLFA 4K8ZA 3T19A 3T1YF 3A2FA 1VBZA 3CJQA 2QWOA 3TTFA 3BGOP 2UV8A 4LSLA 3G87A 4Q0BA 2KXHA 1WC4A 4DSJA 4Z4IA 3RBZA 1IBCB 3H5XA 3D28A 3FGUA 4LFBK 3H3OB 4DQRA 1RDDA 2GX8A 2GHWA 2B5JA 4FL9A 1OMSA 3VWSA 3GBTA 2H3EB 4OZ2A 1VHIA 3SIPB 5B08A 3ULEB 3TABA 4DFMA 4UUWA 3TAEA 1MMDA 2CQIA 1FKAF 1ITGA 3CJRA 3SQ0A 4I1TA 5AE2A 4TU7A 3E2EA 2W8LA 2CQHA 2QYGA 3KTQA 4A59A 2X1AA 3RMCA 3I55S 3RRKA 2FHJD 4B9SA 2R2TA 5B09A 1KFDA 1YKWA 4DG1A 4CEZA 5C42A 2A0FB 4KKOB 4V1Ak 4YMEA 1FT8A 4LF7F 1EQMA 2WW4A 4PUOB 5GMEA 3DLKA 4HR2A 3W0LA 3VGLA 8RUCA 1RT1A 4GKKK 4FK0A 5DG8A 3GDQA 4M63A 1N6QB 1W2IA 4XK8C 1Q82O 3TYTA 4B3SF 3C6TA 1K0TA 2R7UA 2ZKUA 2WVFA 1VC6A 3FCWA 4FYXB 2DNZA 3AA8A 4K50A 1N36J 4A8KA 1BA1A 5I9EB 2DR8A 2EKYA 2HHTA 3DGPA 3ZZZA 1ZBFA 2VG6A 3OXLA 3NKYA 3U4LA 4M5HA 1YHQS 2L3MA 3GYXB 1NB2A 1G7CB 3JSBA 4TYAA 4R79A 2CPXA 4K5SA 4Q44A 4EI2A 2H48B 2W2MP 1S76D 2V2QA 2QYCA 3IGVA 1C0GA 3K8VA 1NU0A 4TY8A 1X3MA 4Z7CA 1URNA 3DOMA 2NSBA 4CWBA 3SBMA 2COLA 2PEBA 1RTZA 3KHRA 4DL3A 3KK3A 4M3YA 1OH7A 4LVOP 3BH7B 8AT1B 2CQ2A 6FD1A 2GGPA 3RB3A 1NLVA 3PTWA 3CM5A 4ZN1A 1SAZA 1NKEA 4ZPCA 3NWGA 1RT7B 3PUFA 1ZAXA 1UPMB 2JEFA 4AHCA 4DU4A 2OMLA 4ED7A 3MGJA 5LJ5Y 1RT4A 3GSDA 4ZA1A 1GTEA 1NJZA 1IUJA 4DV5J 4DU8A 4CESA 5IC6B 1ZPWX 4CLPA 3V9SA 2HYIB 5HJXA 1N34F 1NB7A 1JB0C 4KBIA 5A76A 3BM7A 4ZTJA 4K0KF 1JLGA 1YBAA 5KFQA 5KRSA 1TL7B 4CO3A 4FKYA 4OKEA 3UN3A 4F4ZA 2VDHA 1SZ2A 3C7NA 3M2UA 1SIZA 1XMOJ 3BKTA 4J8FA 3EPGA 3FZFA 3K89A 4RNNA 3CD6S 2E5LF 2MB0B 3HP9A 5I42A 2H4WB 1KVIA 3P5JA 4TLRA 3VVTA 3AD9C 3FBCA 2IPOB 4DR1F 1WI8A 4ZPVR 5M2UA 4DN9A 4MYTA 3RB6A 5D3GA 4PXDA 2J4RA 1APSA 3HHLA 3LGHA 4MK9A 3SSQA 3PIPQ 4C8OA 4CDIA 1XNQK 2ASLA 3OS2A 4YHHK 4FZZA 2CPIA 5DZ6A 3J7Z5 2EHGA 4QIWD 1H98A 2C3YA 3H0PA 4NRUA 3ZEUA 3EICA 3NH1A 2FYXA 2VPZB 3BV8A 1IWAA 2OIHA 4ZVQB 1UA1A 5AQJA 5A8WB 4CO0A 1RTHA 2W41A 3OY9A 2CJXB 4KH0B 4NEYA 4JKAA 3GJSB 2VG7A 3RG6A 3D66A 4CJFA 3WC0A 1SQGA 4AQYF 1LFPA 1VQSA 3FZ2A 3CCSS 3T1AA 4ER8A 3CC2N 4FOEA 3RYLA 2MKJA 2GUIA 1S5ZA 1U6FA 4HUEA 5SZTA 3NH0A 2JSXA 4JI1F 3SXLA 2ZEJA 3KFWX 4ID1A 1Y64A 2VQEJ 3HT3A 2DPIA 4PEOA 1HFEL 2D1CA 3QPIA 4FLTA 2YKMA 1AZSA 1VK3A 3DXKB 4CLLA 3ALYA 3D2FA 1Z2LA 3VMFB 4LFCF 1ZBHA 1JK9B 2BOAA 1HQ2A 3U3YA 4JK8A 2M4MA 3THVA 4IOBA 5HRNA 4N8NA 3AB4B 1XN9A 1S72N 2FJDB 2NRZA 1VSHA 3SMPA 1RT5B 4OJHA 3W5YA 5HQMA 4KRFA 4YDXA 3RJMB 4LRBA 2UUBK 1WTBA 2LQ5A 3CCRS 2BZ2A 3O8MA 3AO4A 1S0MA 2V68A 4GKJJ 4PWDB 4BRPA 3GFZA 1ZXOA 4LRAA 4OI1A 4RBTA 2VU5A 3U27A 1FA0A 3LM9A 5LMNF 1WG5A 4BROA 4F3TA 2AYMA 1CS4A 3O4NA 4IG0A 1S3XA 2HWHA 4QWBA 4BE0A 5FPEA 3J7YI 1FHTA 2F4VK 1P1TA 5B0GA 2AGQA 3ULEA 5AQVA 1T9WA 3IKMA 1FE4A 3DLHA 5MAOA 2FVRA 2AHOB 5CD4A 1WDDA 9RUBA 3H40A 1GNKA 2BUNA 2BRLA 4WYLA 3KIOA 3JXOA 4DV5F 1WSRA 1KAYA 1HNWF 2HS0A 5L38A 4J2DA 3UE2A 2W4PA 3OL9A 3DU6A 1HI0P 4OYBA 4PRFA 3P8BB 3TRGA 1HD1A 1U4BA 2I7PA 3AGRA 4PG7A 2AKWB 4KKOA 2RU3A 4DLEA 1QD1A 2PMZD 2FTRA 3UCGA 4OYMA 4DSLA 1J5OB 3X3UA 5JVGL 4PUOA 3BF4A 1R0AB 1IBKK 1TVRB 3KLIA 3MMCA 4J90A 2G2YA 2QT7A 4RWTA 2VKRA 3T6JA 5B0AA 1GTHA 2C22A 2NYHA 1N6QA 3I31A 2J6TA 1YVNA 1RAJA 3DLEB 3DRSB 5KFVA 1VQPN 3FSXA 2WCXA 3MEGB 1C0UA 4DSEA 1HLWA 5GAGU 3UD3P 1U2CA 1F6TA 3N4QA 4JYAF 2JC0A 3U1MA 4TVAB 1VRUB 4BR9A 2GMHA 2FY8A 1U0HB 3DLRA 2JX2A 1FFGB 1RWPB 4RPFA 1HNZK 4BBYA 1Q8IA 2Z8QA 2RQKA 5LL6Z 4IR9A 1H7WA 2HLTA 3M6UA 2KLAA 2LKZA 1PYSB 2MSTA 2HG4A 3RUBL 3TPQA 3OBWA 3VN5A 4ZPAA 4KO0A 3ICLA 4DCHA 2PFDA 3M30B 5J1PA 1B9FA 5JLHA 4M5GA 1E4FT 1FW6A 2OKQA 3RB0A 4KJIA 2HBMA 3O44A 2WVCA 3I6PA 1IKYA 2DTUA 2EFPA 3BPSP 2FY1A 1K9MO 3E51A 5KI6A 4B3RK 4C8YA 3VEOA 4ZHRA 4KR0B 3M8RA 5L8RC 4TLQA 1PJ5A 1UJ6A 4WP9A 3OVSA 5CY4A 4KHWA 2XWXA 2J9DE 5JUMA 2AV5A 1RWKB 3JAMU 3B6OA 5F0XA 1VSMA 3JTPA 4DTPA 3UCUP 4FLYA 1Z26A 2MHEA 4LQ9A 3EM1A 4NCAA 4MO5A 4RX6A 1WC1A 2AT1B 4NA3A 3PX6A 2PGCA 3UKUB 1NG9A 1A9NB 4MH8A 2RUSA 4NLXA 2GWJA 2QV6A 1FDAA 4ZP6A 1RISA 1PKUA 1R8CA 3P83D 3CCWA 2HBKA 4Y2CA 1FX4A 5AQIA 4IRDA 1KWMA 4XEIA 1QHAA 3MR3A 4FO0A 3AVLA 1YTYA 3D3BJ 5ETOA 3J80Y 3G8TA 3UFCX 3AXKA 5GMKa 4UTGA 2CQ3A 2ABYA 2GJFA 3KD5E 2M70A 1KVKA 4FWLA 5EX5A 4NLRA 3EGVA 3L7OA 4KH6A 4LF5J 2W4CA 1FWPA 1HRHA 2MY8A 2P9UB 2ZH7A 3D9BA 4B17A 3B6BA 3FC9A 4PA1A 4GV6A 2F8HA 1Q79A 4LD0A 4F0HA 3HK2A 2GV9A 3IS9B 2QWRA 5T7BA 4O4GA 4ZITA 2OP5A 4JHDA 4H0OA 5FLXU 3BGRB 5D4OA 1FRJA 4Y3CA 1YBTA 1RGVA 2EBGA 3EUNA 4CF8A 3QJLA 3PFEA 4W90B 3MPUB 1O13A 2UVUA 5BRHA 1ZH5A 3JAMO 1GQEA 1ZZFA 2BUPA 2BANB 3SSRA 2DPJA 3MM5B 4FWMA 3IDHA 4EFAC 4H5TA 1WORA 4WFNQ 3OL7A 3UWTA 3QFPA 3KYLA 1XNRF 2G8KA 3HKZD 3GONA 4B3TF 4RUHA 4QU7A 1NH8A 3FEXB 1HYVA 2E5HA 2KFZA 1NGGA 1S1XB 5LMUJ 2FC0A 3DXKA 1TL4A 3ZC4A 3CC7S 2KJWA 2I0XA 2PI4A 2HBJA 5BRFA 1QZ5A 4PQUB 3NFAA 2V0NA 2R7WA 4X66K 5GAHU 3H2VE 2IMWP 4BC3A 3G71S 1J53A 4DPOA 1U02A 1VRTA 4KT0C 1UCNA 1RT5A 3LDPA 4IEIA 1J5EK 3CJKB 2Z58B 4H8KA 4PL7A 2G13A 3K7RA 4FJJA 2ACYA 4FWOA 4PWDA 3RW7A 7FD1A 3LUYA 4FYVB 2JWNA 3SI8A 1DJ0A 3PO4A 3LQVA 2UXBK 3ATUA 4H4OB 1A5XA 3HXMA 3DN9A 5ETMA 3KLGA 4LF2A 3W2VB 4IDKB 5FLXO 3CSKA 1HW9A 2QA1A 3R8EA 2NPIA 1MMNA 2MQPA 2F8TA 1T05A 1JJ2M 4N77A 1F3VA 3LGNA 5CAAA 3N0VA 3OYNA 2X3GA 2W9CB 3NBPB 3SUNA 3GJQB 1VQOS 4P71A 3CJBA 2CNOB 4O0IA 2DGVA 4ISEA 1CQNA 4LRFA 1FEHA 2XC9A 3WX4A 3D6FB 3DOKB 2VZ9A 2V8PA 2WW8A 3WZ0A 2ZC4A 1RP5A 4BWJA 2A42A 4LRDA 4ZLPA 2I5JB 4NLTA 1YGYA 2YQ0A 3R2CJ 1J5OA 3DRYA 4MKVA 1VYAA 1R0AA 2IYIA 4J91A 2HW3A 1RFQA 1HMVB 3DXMB 1B64A 2P9EA 1GAOA 4ZJOA 3G4SS 2ROGA 2CGLA 2BBEA 1VQYA 2KVQE 3R5GA 4ZS6A 3DLEA 3DRSA 1H72C 2HVDA 3T1HF 4B9MA 4H5WA 4ZVEA 3MEGA 1RWNB 3F9MA 2D69A 4LH4A 4CO4A 2UUAK 1WG1A 1WC0A 4AT1B 1ZTWA 1KVJA 1VRUA 2HBYB 5KFGA 4G1QA 1U0HA 2RF2A 1VQ7N 4KHYA 3UN2A 4ILLA 3CC4N 3TVYA 5AQSA 3CCLN 2VB6A 4OI4A 2J0SD 1LQ9A 2IDLA 4I2QA 3WBZA 4CH1A 4P52A 2A3ZA 3HI0A 4JN4A 3B82A 1S9EB 3CCES 3D0GE 5IM0B 1TL1B 5B0CA 4QBUA 2AJFE 1W2BM 2ASJA 2QC3A 2BJ8A 4BDYA 2O3DA 4EFHA 3PM9A 5CA5A 3M30A 1SC6A 4I68A 3S7RA 4I67A 1MWMA 3TX0A 4BCAA 2ZH4A 2X6NA 2C2MB 2XCPA 2KM8C 3OSNA 4Z94A 3C94A 1K44A 2HQIA 3O80A 3HZ6A 4W4MA 4HTUA 3BSOA 2ATLA 2H54B 2CXEA 3DU5A 2KG1A 2WUSA 1ZAVA 1TQLA 2FZCB 3VAJA 2PE8A 4DQ8A 2RT3A 2H5IB 5F2RA 4IRKA 1YJNN 2ZUAA 3V2UC 4USJC 3K2PA 5EWGA 4OVLA 5J2NB 5JXSA 1RWXB 5A6PA 2E6LA 1QAJA 2LDIA 1S0NA 1DTTA 3EVOA 2KDOA 1L3SA 2IM1A 3CJ3A 1QSLA 2P8IA 1WHYA 4IOAQ 2FF3B 2QL9B 2LA4A 2ZJRQ 4H0VB 1BOTO 4IYQA 3QJPA 3MZIA 3FZKA 2EK1A 1S5JA 2B9WA 2B51A 3THXB 3F44A 2CQCA 1QTMA 2RQCA 4C98A 2Q6BA 1U1LA 4JAXA 4KTWA 2HEKA 3ZO7A 1VAZA 3QT6A 2ZWPA 4NA1A 4RBVA 2DO4A 3HFKA 4ILJA 3NVKA 2BW7A 2R8GA 2CWXA 3OYFA 2P9UA 5AQLA 3CJ1A 4ECTA 1PJ7A 5B0BA 2IVOA 2MEWA 4RW8B 3VEVA 2BQ3A 3NCRA 2B4JA 4ED0A 3M8QB 3PFOA 2F96A 4I64A 1GMUA 3IS9A 1S22A 5AQRA 2WK4A 2V94A 3MR7A 1NH7A 1RWVB 3OT9A 3W8GA 1K73O 3BGRA 4EBCA 3FCHA 3DHXA 4AL5A 2YHYA 3I9ZA 3V1RA 4BGBA 3AAWB 1YJ7A 2XMTA 2BANA 1ACMB 1VK8A 3VQ7A 3MM5A 4J37A 4BR4A 3VETA 4B1UB 3PIPL 4JI6J 2O4GA 2JWLA 3FK4A 5BPMA 4FYYB 1U2VB 4OQJA 2HHXA 1EB0A 1WWHA 4DR5K 4GW6A 3H2UB 1RKIA 4J9UE 3WXKA 1NHVA 5F0UA 1S1XA 3FRZA 1S6UA 2BE7D 2ZNYA 4G1IA 4M3TA 3CXCM 2VD3A 3H5YA 3L4IA 4X4NA 4B3OB 1OSDA 4JOUA 2VG5B 1KQSR 3TAPA 2EXUA 4H4KA 2N4DA 2B0GA 3Q2TC 2FBTA 3PSFA 5HO4A 3A13A 2BKOA 3TAQA 5IZHA 1IBKF 4WKRA 3NCQA 3DRXA 2KRBA 2KT2A 5AQHA 2XMMA 2ZH1A 4IR1A 3I55N 3TZXA 4P6QA 2CPYA 3L95X 2M5YA 4LF4K 4NCGB 3UDLA 4AHSA 4KI6A 5LM7E 1V3ZA 1RBUA 3H42A 4YDUA 5C2GA 3S01A 2GFFA 5AQNA 4FK4A 1JLBB 4U7CA 1GXLA 1UFKA 2XBPA 2NRWA 4H4OA 5ETRA 3OW2R 1BY9A 1NJIT 4BC4A 1TV6B 3CF5Q 2LQBA 3W2VA 5HMWA 1N88A 4E1NA 2IM0A 2GTDA 4DV7F 4F25A 4IFYA 4YQWA 1HNZF 4TY9A 4F67A 4AM6A 1VC5A 2ZHBA 2PY5A 1N33K 2W9CA 3M9NB 3NBPA 4ALZA 3QEPA 2HFVA 1G2EA 2W24A 3C16A 3UVJB 2QFJA 4BRLA 1EP4B 3CQXA 4OYZA 1HR0K 3NGTA 2WB1D 3HPOA 2MQQA 4JV2A 3VF4A 3EY1A 1YHQN 3DOKA 2J0XA 1Q7YT 2DYAA 3GV7B 2DIVA 4OZ5A 1GEHA 1ZBIA 2AYBA 3MR5A 3H08A 3HSZA 1QVGM 5HANA 5KT6A 2F9WA 1UETA 4DV1F 3ZNJ1 3NCPA 1N52B 1FDBA 2NYIA 2A6OA 1TUUA 1NMNA 3TUPA 2CFXA 3F56A 4M45A 1OS5A 4OLBA 3CDWA 2D0AA 2IRUA 3P96A 4JD2A 1W9HA 3D6TB 4ED4A 2PI5A 2VIHA 1I94F 4M7XA 2OLWA 1QUVA 4CP5A 3J7ZO 5CZVA 3GJTB 4KTQA 2JLGA 1Q16B 4CD1A 3MX2A 5LL6d 5BN9A 3OV7A 2BRKA 5EXWA 5CR4A 2DO0A 1NGFA 3SAFA 5J2QB 4AH9A 1GX5A 3AA4A 1LWEB 3HYFA 2V4JA 3KLVA 1OPZA 1SQKA 1VQMN 2W2NP 1LXJA 1WSVA 4HDGA 2HHWA 3P49B 1ZM3A 1S9EA 3O1WA 2Z2MA 5IM0A 1ZZNA 2QX0A 1TL1A 1XHZA 1Y97A 3MN6A 2IMOA 2AA4A 4O8UA 5J2PB 3AOCA 3MMVA 1NOYA 4FZXC 2A40A 4L72B 5HJYA 3KWGA 4DV4J 1X9WA 1NUEA 1A5WA 2VFTA 1V6HA 1AUSL 5F8HA 5AFUA 2VJVA 1GFWB 2O8EB 2K7KA 3KD1E 4O0JA 2XB2D 2POKA 2IBKA 3MFIA 3BSAA 3E66A 3CD6N 2YQ1A 2UXCJ 2D3O1 4C0OC 4ZN3A 1KQKA 3MWBA 2G0IA 3UR3C 3NGYA 4DPYA 2P9LB 5IWAJ 2B43A 3UN5A 3QETA