1SUQA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r185545
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE
total genus 134
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1suqA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1suqA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1suqA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1suqA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1suqA05
4R8UB 2XCPA 3NDKA 2YKNB 5DQHA 2JEJA 4DL7A 4F4KA 3UR0A 3BGRB 3RWUA 3K5LA 4IKAA 4OGCA 2PYJA 3ZT3A 3RRGA 3O3GA 4AHUA 1XC9A 4ED8A 4OKEA 1RBVA 4I2QA 2FVPA 4CGGA 1RYSA 1KFDA 4F4WA 1RTIA 4EBDA 4FM1A 4Q0BB 2FVCA 4FM2A 2W42A 3BDPA 3KK3B 1S0MA 4M3UA 5KI6A 2GIQA 1RT2A 4H54A 3RMAA 3D0PA 5F8JA 4TLRA 5I3UB 2FVQA 4NZ0A 1ASVA 4QAGA 2IGIA 4DMNA 4Q43A 2HNYB 5KT5A 3OYDA 4CF8A 4CJPA 3FQLA 2OZMA 3LWMA 1HMVA 4IKFA 4J9KA 3L3VA 3G6XA 3AVLA 3V1OA 5DQGA 3AO1A 4AHCA 4CHOA 1D5AA 5D3GB 4M42A 5F8IA 3NL0A 4BE1A 1RT7A 1T3NA 4NYFA 2F8TA 4I2QB 4LSLA 5F9NA 5KG5A 4KHUA 4DL5A 2QKKA 1YT3A 1FXXA 1NJYA 3LP0B 3AO2A 3NGZA 4KHWA 4K4ZA 1RDBA 3V4IA 2HVHA 2AU0A 4WFYA 3CJ0A 2YNGA 1T05B 3BQ1A 1C1CB 3M8PB 4F4ZA 5DMRA 3QERA 2YKMA 3GQCA 2XY8A 4WE1A 4M3TA 1Y97A 4ZHRA 3MR5A 3F73A 2D0BA 2D0CA 4BWJA 4CECA 4ECWA 4J9RA 4MQ3A 1TK8A 5L1KA 1WLJA 4LSNB 3BQ0A 1KFSA 3AVIA 3NF6A 4JV1A 2ASDA 3V1RA 4JUZA 1XR5A 4CJTA 4KFBA 2F96A 4O3SA 4KHSA 4NLVA 4KBIA 1RT4B 1N4LA 5L1LA 1YVFA 3VQ4A 4ECUA 4ZPBA 4EYHB 3AVCA 3NH1A 1JLAA 1JIHA 3DRPA 3M9NB 4RW9B 1BISA 3WNEA 4FZXC 2R8IA 4RW7A 3TQ1A 2HNZA 5KFUA 1S1WB 4H4MB 1J5OA 1FKPA 1GOBA 1ZBUA 2A1SA 1WSHA 3NH0A 2D7SA 2R8KA 1X1PA 1QQCA 1TAUA 2ZD1B 3MR6A 3TAQA 3GILA 3VN5A 3NFAA 1NK0A 2JLEA 1HYZA 4ELTA 4B9NA 4MK9A 1WSEA 1UA1A 4IG0B 4CJKA 3DRPB 3FDSA 4YR2A 2X6SA 4M3XA 4CJVA 3KLHB 4JS4A 4DG1A 5C24B 4M45A 4O44B 3ISND 3C6UA 4AHSA 3OYLA 4KFBB 3S3OA 3DLGA 2P51A 1HQUB 3LAKA 4O3PA 1RBTA 1WSJA 4OPJA 1TK5A 2KZMA 4FJGA 3ZT1A 1IH7A 3RAQA 1ITGA 3PY8A 1HQEA 4B9UA 4QOZB 1S0OA 2DFFA 2ZKUA 4FJ8A 3U3GA 4ZPDA 5DG7A 2HHXA 4H4OB 4FW2A 1TV6A 2ILZA 1TK0A 4KRFA 3H4DA 4O3NA 1C0UA 4EBCA 5FRMA 3MR2A 3H98A 4N5SA 3L8BA 3OYJA 2V0NA 2HVIA 5KFHA 1DTTA 3ALYA 4IRKA 4EZ9A 4DSEA 1D8YA 4M3WA 1RA7A 4OJRA 3SQ4A 1KVBA 3AA4A 3OYAA 1X9WA 2C2EA 2WTFA 1UA0A 2ITGA 4FJLA 1EP4A 2WONA 5K14B 4F8RA 3QGHA 2HNYA 4NCAA 2JEIA 3RB0A 4KO0B 5KFAA 1U4BA 4RNNA 4EO8A 2HNDA 4EEYA 4KHRA 2OPRA 3OYHA 4B9MA 2W9BB 3E51A 4H4OA 2IC3B 4CEZA 2BGGA 3VQCA 1U09A 5JUMA 4FJ5A 4J9SA 4IBNA 2HHUA 4IDKA 1ASUA 4PA1A 4ID5B 4QWEA 5KFDA 1J53A 4FLTA 4Z4EA 3H5SA 3OYEA 4IG3A 4B9TA 4ZVHA 2GC8A 2FVRA 1K1SA 3OYBA 1HYVA 3DLGB 2VWJA 3KLEA 4ZP8A 5KG1A 4TYBA 3Q8SB 4ECVA 3OSNA 3ZSVA 1JL1A 4H4MA 1J5OB 2AGOA 3KLFB 1FKOB 1HNVA 2BE2A 4QWBA 3M8SA 4RW7B 4TQRA 4J9OA 4FK0A 1WNSA 1SH3A 4X2BA 2C28A 5JS1A 3H5UA 2W7OA 2IM3A 1A5XA 2ZD1A 5KFTA 4KI4A 2D41A 1U47A 4I9QA 4DL2A 3D45A 3BR9A 1K1QA 3FFIA 3QINA 4URQU 4ZTFA 5KFCA 4IFVB 2BQRA 3MEGB 1DLOB 2J6UA 5EUHA 4DQRA 1NK9A 3B6OA 1CZBA 4ZHRB 1BIUA 5JXSA 4W5OA 2IS3A 1HYSB 1C0TA 2R2TA 4Z4IA 3VQ9A 3NE6A 2AWZA 1EETA 2Z1JA 4FJKA 4TY8B 4B3OB 4FM0A 4KAZA 4CK3A 5CZ2A 3TABA 1L3TA 4JRQA 4B9SA 3SUOA 3DOKA 3RBEA 3ZSXA 4CJ5A 2UUWA 4KO0A 4FK4A 5KTQA 3ASMA 2R7YA 2WOMA 3SPZA 4RW8A 5J2MB 3OJSA 2P5GA 4M41A 3BSAA 4YQWA 1HNIB 4KREA 1T05A 1S49A 2FC0A 3RB3A 4Z4HA 4I7FB 4HUGA 3L2WA 4DSIA 1RT1A 3OHAA 2V4RA 1RDDA 4KHMA 1SH0A 3QIPA 2FJWA 1HNIA 5J2MA 2I5JB 2BQ3A 1KLMB 3I0SB 1RILA 3RRHA 3AA3A 3AVJA 3K5NA 1D0EA 4NLPA 1S97A 2ALZA 5KRTA 5KFWA 3G86A 1KLMA 1ASWA 1RT2B 1VSHA 4WYLA 1RT6B 4QW9A 1TAQA 3AVFA 4NLQA 2IDOA 5CYMB 4QWCA 3SI6A 4CGJA 1LWFA 3RMBA 3SV3A 2X74A 4N76A 2ASLA 4DL3A 4RW8B 3F9KA 1WAJA 1QS4A 4AH9A 3AVKA 3IGVA 2EC0A 4DFKA 4IFVA 3K59A 4AHVA 3IS9A 5C5JA 4CGHA 3PO4A 4TN2A 3Q8QB 3DLEB 3DM2B 3ITHA 4AHTA 4DQPA 5J2PB 5EWEA 3OYKA 4J9LA 4K4VA 4K8XA 1UWBB 3V9ZA 5DG9A 3IN5A 3RTVA 3BGRA 3PVXA 3LWLA 4KTQA 3FFIB 1JLGB 4M94A 4ED7A 3ZSWA 3CWJA 1C1BB 4J9MA 4N41A 4R5PB 5DGAA 5F8GA 4CHNA 3RAXA 3E01A 4O3QA 3I8DA 1HRHA 5FDLB 4R5PA 1LWCB 3QO9B 3ZT2A 1T8EA 2JGUA 2XO7A 2IC3A 2BDPA 3MFIA 3CIZA 1BGXT 3TAEA 1N5YA 3KHHA 4RNMA 3LPTA 2VG5A 4HHTA 2UVVA 2KTQA 4Q45A 4C8MA 1L5UA 2WK4A 2YNIB 2QK9A 3AVHA 4CF1A 3HPHA 4GW6A 3V6JA 5KG7A 3SZ2A 3RR7A 2RDIA 4NCBA 3TVKA 3V4IB 4CEAA 1IKYA 4DTRA 4JV0A 4EZ6A 3MECB 1TVRA 4E1MA 3QEWA 4CJ4A 4IFYA 4NLSA 4OLBA 4RNOA 1N6QA 5KFQA 2G8VA 5F9LA 4QWDA 1RDAA 1RT6A 5J2NA 1HMVB 3SPYA 2HHVA 2KFZA 3CFRA 4J2AA 5HLFB 1JLBA 1SL2A 1B9DA 1D9DA 3KIOA 1EX4A 3QIPB 2DPIA 1C0UB 4R0EA 1LWFB 1HARA 2FBYA 4E7LA 2E9RX 3HHKA 5C24A 1VSEA 4O4GA 1RT3B 2RKIB 1JXLA 2QXFA 4BWMA 2WOMB 4WFZA 4N56A 3I5BA 4CJSA 4E89A 1YTAA 4B3OA 4O55A 2CKWA 2P1JA 4FJ7A 4J2DA 1OS5A 4FLVA 4W5QA 4NRUA 4PUOA 4KHQA 4FLZA 3L2QA 3SV4A 2RDJA 4B8AB 2J6TA 3KLHA 2XY7A 3UQSA 4RW9A 5HROB 3IRXB 4C8OA 1RTDB 2DPJA 1TP7A 4YR0A 5DGBA 1S5JA 5F8MA 3DLBA 4TY8A 1BQNB 2HB5A 4AHRA 3LAMA 3N6NA 3OHBA 5KFJA 3OL8A 4Z4CA 2QE5A 3MEEB 3HPGA 3NAIA 5DK5A 4OLAA 1IKWA 3QLHB 4B9LA 1RTHA 2WCXA 3P1GA 1L3UA 3V6DA 1U49A 1DLOA 4QPXA 3UPFA 3KMSA 3CFPA 3DRRB 2BE2B 1C1CA 2GIRA 4ZVFA 2Z1HA 1RT4A 4IRCA 5KRSA 3OS1A 4CK2A 4CIFA 3MEEA 4FZYA 2IBKA 2O5DA 1LWEA 2IAJA 2B5JA 4LSNA 1VRTB 5JS2A 2R8GA 3DMJA 4XPEA 4HVJA 4DSFA 1TL3A 4ID5A 5SZTA 4BE0A 3AVGA 1HNVB 1FKOA 5EWFA 5L9XA 4O4GB 4NRTA 4DTXA 4KB0A 4OVLA 3OYFA 2HNDB 1Z25A 4CGDA 5DLFA 1CXUA 3U3YA 3V9XA 5EDWA 1VSFA 3SYZA 2X6NA 5KFRA 3NGYA 4ZP7A 5KG0A 2R2SA 4GVMA 4FJIA 2JEFA 1XHXA 4M3RA 3SJJA 5KFLA 2RKIA 4YR3A 3M8QB 4DF8A 4IR9A 4Q0BA 1O1WA 4CIEA 5C42A 1X9SA 2Y1JA 2IJNA 3P83D 4KI6A 2E6MA 3DYAA 5KT4A 3GIIA 3V1QA 4YMEA 3HK2A 2XI2A 4K50A 5F8HA 4FK2A 2IM1A 4QW8A 3RB4A 4F2RA 2KFNA 4Q5VA 2VG7A 3QZ8A 3PR4A 4FLXA 4ELVA 3MTKA 4QCLA 4CJWA 3DI6B 2D5RA 4XPCA 5F8NA 1S4FA 4KSEB 1HQEB 4FW1A 4F3OA 4URGA 1HQUA 1R0AA 3G6VA 5KFFA 2JC1A 4M3YA 5T7BA 4FYDA 4BE2A 5KG3A 3KD1E 4CHPA 3M8QA 4IH6A 3KLIA 1L3VA 4GC6A 4PY5A 4LH5A 3CDUA 3TR8A 2XY6A 1MMLA 1S48A 3LP1A 3DMJB 4CHZA 4ID1A 3ZSOA 1GOAA 4ECYA 3TAGA 3I0RB 1WSIA 5J2QB 1XI1A 1KHWA 1XR6A 4ZP6A 4CJEA 3OYNA 4JV2A 2OPPA 2R2UA 1UWBA 2F8SA 4BDYA 4DEZA 1QSYA 4K4TA 2GBZA 3QGGA 2HHQA 3HVWA 3NF7A 3AO3A 1NK4A 3ZSYA 4GC7A 2D3UA 3DLEA 3DM2A 4O3OA 1NKEA 3BQ2A 3MEDB 3Q8PB 1RBRA 4NLUA 4OKKA 4DTUA 1HPZB 3QZ7A 4ECQA 2IA6A 2GUIA 4EBEA 4IR1A 1IM4A 3PW0A 2OPQB 3OYMA 2R8HA 3T5JA 3HKWA 4Z0UA 3NAHA 4RUCA 4UQGA 3IRXA 3AV9A 5E41A 4B9VA 1A5VA 3MFHA 3T5KA 3JYTB 5C25A 4FJJA 4YNQA 1I39A 4CF2A 3KJVA 2DTUA 1QSLA 1DTQA 5CYMA 3MR3A 4G1QB 3KOAA 4PQUB 4B8CA 4ED6A 5HP1A 3LP0A 1BQNA 3PX0A 2GV9A 3DRSA 4ZP9A 2R8JA 3CJ2A 2F8EX 3DLKA 3T1AA 3HM9A 4KTZA 1EXQA 4KB7A 4WE1B 1Z4UA 1VSDA 1SUQA 4ED1A 4RW6A 3CJ5A 3DDKA 4ELUA 3SFUA 4AILC 4I7FA 3ZCMA 3OS2A 5KFKA 3OS0A 3CM6A 3PX4A 3LALA 1B9FA 4CJQA 4MK8A 4KHYA 4NLTA 2AQ4A 1SUQB 4LSLB 1JLEB 4TXSA 3KKRA 1S1VA 3HT3A 1S1UB 4F2SA 3VQBA 5C42B 5I3UA 3M9OB 3SQ2A 1RA6A 1KRPA 2JEGA 2B4JA 1LAVA 3TI0A 2DFEA 4FJHA 2OYQA 4FJXA 3C95A 1FK9B 2HHWA 3RR8A 1Z26A 3AVNA 1S1TA 1JL2A 1TVRB 1BQMB 2ZE2A 2FJVA 2C22A 3PHEA 3EZ5A 3DLKB 3WNHA 1IKYB 3PUFA 4CCHA 4ZTJA 2IM2A 1QAIA 4WYWA 1NNDA 3O4QA 1I3AA 3QNNA 4FJNA 2B6AA 1CSJA 2YKNA 1JLCB 4ICLB 3MXMA 3GV8B 3IGNA 1WNEA 1C0TB 3KJVB 2LSNA 1T94A 2RF2B 1TL1B 4CK1A 4MFBB 3LANA 4DL4A 3S9HA 1LAWA 5HBMA 1A5WA 3KK1A 1BI4A 4DSLA 3T3FA 3H08A 4DLGA 4DFPA 4RNFA 3TAFA 5KFYA 1T03B 4ECZA 1S9EB 3IAYA 2ETJA 3TAMA 5J1EB 2QV6A 2EHGA 3SCXA 3BJYA 3CQ8A 1ZYQA 3KTQA 4IQXA 4QWAA 1S10A 4ZMMA 3V81A 3CDWA 4F4YA 1JLFA 3DOLA 4U7CA 2FJXA 2KZZA 3OLAA 4KKOA 1U45A 3QETA 1REVA 3OYCA 1GOCA 3TAMB 1S0NA 4E3SA 1C6VA 3ICLA 1JXEA 1SKWA 4KV8A 1RTJB 3LP3A 2PZSA 1ZTWA 1RDCA 4W5TA 3ISNC 3QO9A 5HROA 3VQ8A 3SQ0A 2UVUA 5KFIA 3OLBA 4IG3B 2IOCA 3T19A 3PR5B 1TGOA 4RU9A 1EP4B 2WONB 3SNNA 1Q8IA 1BCMA 1C1BA 3QEPA 3NKYA 1VSLA 2HMIA 4O5BA 3I5CA 1N48A 3AVBA 4MH8A 1W0HA 3EZUA 5DQIA 1VK0A 3FRZA 3PW4A 2Z1GA 4DU4A 4E19A 2HWHA 2W9CB 2OZSA 4ECTA 4JLHA 3K58A 2V9WA 4LD0A 3NBPA 4PWDA 3NF9A 2G8KA 5J2PA 2BR0A 4ECSA 4HCCA 2XHBA 4CEFA 3L2VA 1S9FA 4M95A 4CJ3A 5KFOA 3GV7B 2VG7B 2YNHB 4L8RB 1TKXA 1UOCA 1S6PB 4ED3A 3H59A 4FVMA 3OL9A 1S1XB 4J9NA 2VA3A 1D1UA 1VSMA 4FLYA 4TSXA 5J2NB 3SFGA 3UIQA 2UVWA 3SQ1A 4Y3CA 4URSA 4K4SA 3HXMA 4KAIA 4CFDA 1IKXA 4CEQA 1U48A 4CE9A 4NLDA 4B08A 2AGPA 3NGDA 5KFMA 3T5HA 1BCOA 3CJ3A 4IG0A 5KFBA 2W9CA 1NOYA 3DOKB 2FLLA 4LY7A 4E7HA 2RN2A 3OYGA 3LP2A 1WSGA 1L3SA 3K2PA 2I5JA 2HHSA 3KHLA 4Y2AA 4TYAA 3L3UA 3H5YA 1LW0B 1RT1B 1JLQA 3OVNA 1S6QA 4NYZA 4PQUA 1VRUA 3G10A 3ZSZA 2EX3A 1F21A 1FKPB 2B43A 4O3RA 4DG1B 4O0IA 3ULDA 3OSPA 2HNZB 1NK5A 3G6YA 3HPOA 1YTUA 4IH7A 1SV5B 4Z4FA 5KFXA 4ED0A 3K5MA 3MEGA 3N6MA 1KCFA 2YHBA 1N5YB 4Q44A 1HPZA 5HRRA 1LWEB 4J9PA 1KTQA 5DLGA 4I9LA 4CEOA 3AVAA 4E7IA 1SH2A 3GYNA 3DLRA 3MEDA 3RBDA 2YV0X 4HUFA 1HYSA 1RT5B 1TL1A 4LQ9A 3VQDA 1TKDA 3M8RA 4DU3A 4MKBA 3FSIA 5KGWA 1QTMA 4DQQA 2G8HA 4CJLA 2AGQA 3NCIA 4ICLA 1U04A 1SL0A 3GIKA 3M8PA 3SUQA 1S9EA 2OPPB 4KB1A 3HJFA 3QLHA 3WNFA 3D28A 3QIDA 3QGIA 5KT6A 2D0AA 3QIOA 2PY5A 3QESA 1VSKA 1NKCA 1QE1A 1BHLA 4C8LA 3KLGA 2FVSA 1IO2A 2XCAA 4KE5A 2D3ZA 4MFBA 2YNFA 4Q8FA 4CERA 1RT7B 4BDPA 4FLWA 4RG8A 1EKEA 4CGFA 3DI6A 1FK9A 2XWYA 5I42A 1RCHA 2Z1IA 5KG6A 4KPYA 1XHZA 2ASJA 1NHUA 1LW2B 4WXOA 3D5MA 1VSJA 5KG4A 3KLVA 2KQ2A 2OPRB 1WSFA 1S1VB 3A2FA 3VQ7A 3DYAB 1RYRA 2VA2A 4CHYA 2UUTA 1NK6A 1GX5A 2ATLA 1JLBB 5K14A 1BIZA 3Q8RB 2ZQBA 2UVRA 1NK7A 3GV5B 2YNHA 3VQSA 4Y2CA 1LW2A 3V6KA 3V9SA 2JC0A 3UDLA 1WAFA 2DFHA 3KK2B 4IOBA 1N6QB 5KT7A 2P5OA 1RBSA 4I2PA 3U6FA 2FBVA 3I0SA 2YNFB 1QAJA 4FCYA 1S9GA 5KFGA 3CJ4A 2AX1A 1KLNA 4HTUA 1KHVA 3CO9A 3G0ZA 1DTQB 4C8KA 4O4RA 4WFXA 3H5XA 4J2EA 2G8FA 5C25B 3KK3A 2HMIB 4ECRA 1QSSA 4F4XA 3H4BA 3RB6A 3QEVA 3RMCA 1RTIB 1N56A 4TY9A 1VRTA 3DRSB 1KSPA 3VQEA 2YNIA 2YHAA 4DTMA 1NOZA 2W9AA 2B5JB 4CGIA 1C1AA 1KVAA 2CJQA 5HRNA 4K4WA 4K4XA 3TWHA 2BANA 3C6UB 2E9TA 4FBUA 3GIMA 2WRMA 5KT2A 3JYTA 4R8UA 3AA2A 4RW4B 1C2PA 5KFPA 2VG6B 2KW4A 5FDLA 4Q8EA 4ECXA 4DTPA 1JLFB 3DOLB 2IJFA 1RT5A 4FBTA 4J2BA 3KD5E 3HVTA 1Q9XA 4CFCA 1S6QB 3NAEA 4CF9A 1IKVA 3M9MB 2IM0A 4H8KA 1ZBLA 2WB4A 4K4UA 4W5NA 2XGQA 3ZSRA 5KGXA 1NKBA 3CG7A 4HKQA 2XY5A 1B92A 4KTWA 4DQSA 4O44A 4NCGB 1UAXA 2ILYA 3RMDA 4JS5A 3KK1B 3BSOA 1BI4B 2VG6A 4WXWA 1LWCA 5KFEA 4NLGA 3VQ5A 2OPSA 3BSNA 2E9ZA 2HHTA 1LV5A 3E01B 2E6LA 4NCGA 1VRUB 1IKWB 2VWKA 1GX6A 1JLQB 4EYIB 2FLNA 3IS9B 3OL7A 2PYLA 1JLCA 1QHTA 2OA8A 4ZVEA 4N47A 3GIJA 5KFVA 2FLPA 3NHGA 4ZPAA 3HP6A 1CZ9A 2O4GA 3IG1A 1NK8A 1W25A 4NLWA 4CJFA 1SKSA 4RW4A 1JLAB 1BQMA 4DSJA 3CM5A 2YKMB 3MF5A 3NF8A 4DTOA 3KHRA 3AO4A 1K6YA 1S1TB 2W9BA 4EP4A 3C94A 2YNGB 1IG9A 4DTNA 5DG8A 4DU1A 1ZBIA 1R0AB 1TQLA 3ZT0A 1S9GB 3SUPA 1S1XA 5HLFA 2J6SA 5HRPA 4HCBA 1NJWA 2BRKA 5FROA 1S1UA 2W8LA 5D3GA 1SKRA 4DS4A 3LDSA 2BQUA 3TAPA 3H40A 3C6TB 3MAQA 3NH2A 2E4LA 4JRPA 4XO0A 3MECA 4RW6B 2AX0A 4DTSA 2WHOA 3O3FA 5KFNA 2C2RA 4NLYA 3H2LA 4E7JA 4CHQA 4F3TA 5KG2A 4TQSA 4KV8B 3DLHA 4I2PB 2XGPA 3KK2A 4OL8A 2XRIA 4Y34A 3HVRA 3VQAA 5HP1B 4KKOB 4CESA 3ZSQA 1TKZB 4IFYB 2BRLA 1J9AA 3PW7A 4MIBA 1JXBA 3NMAA 3HYFA 3P5JA 4OKJA 2IAJB 3KLGB 3CYMA 5J1EA 1J54A 1QE1B 2G8WA 4BACA 2HW3A 1Q9YA 2W8KA 4E0DA 4FLUA 4Z4GA 1T03A 5HRSA 1CXQA 2IMWP 3THVA 3CDEA 1WN7A 3KNAA 1CLQA 5I42B 3OYIA 3VQQA 4MKAA 1RTHB 3V6HA 1ZETA 3O4NA 4Y1CA 3WNGA 3V81B 3FQKA 4YFUA 2RF2A 4ED2A 4DF4A 3ZT4A 2Q3SA 4LH4A 1D9FA 3EPIA 4FZZA 1BL3A 4O0JA 1RBUA 3VA3A 1KVCA 2G8UA 4WZMA 4E7KA 4K8ZA 4HYKA 3S3NA 3KLEB 4ZVGA 4U6PA 3TARA 5J2QA 2AJQA 1SV5A 5HBMB 3I0RA 1TKTB 4YP3A 3CFOA 3PV8A 2ZE2B 2QKBA 2C2DA 3LZJA 4J9QA 4C8NA 3L2RA 1NJZA 3AA5X 3ITHB 1JKHA 2FBXA 4OPKA 1X9MA 4DWIA 1ZBFA 3LP1B 4FS2A 1LW0A 2B6AB 4DFJA 3T5LA 2HWIA 3JSMB 3VA0A 3KLIB 2A1RA 4CJRA 4IRDA 4NLXA 3BSCA 1JLGA 3LZIA 3KHGA 1ZBHA 5KT3A 3SI8A 1SL1A 5FRNA 4XIUA 4NLRA 4DQIA 2HAIA 3CVKA 3PJXA 3PJWA 3EPGA 5SWMA 4ZPCA 3N6LA 1TKZA 4DLEA 2O4IA 3B6PA 1MU2A 1HJRA 4PUOB 3C6TA 4KHNA 4W5RA 3PO5A 1C0MA 1XWLA 1RNHA 5CZ1A 4K4YA 3LP2B 2X78A 4CEDA 1W9HA 2DY4A 3PX6A 3I5AA 1S6PA 3HL8A 3MXIA 1JLEA 1NHVA 1QUVA 1I6JA 1G15A 1YVUA 1RT3A 3HO1A 4CF0A 1IKXB 4RNHA 4FJMA 4IH5A 4DL6A 3PW5A 1TV6B 2RPIA 3HVAA 3HSTB 2R2RA 4CFAA 4MIAA 1DTTB 4EP5A 1XR7A 4LQ3A 5KFZA 2I1RA 3OL6A 2XC9A 3IG1B 4DFMA 4FS1A 1TKXB 2W7PA 2XI3A 3MXJA 5F8LA 2V4QA 3SUNA 2FBTA 5CY4A 4G1QA 2OH2A 4DS5A 4CIGA 1MU2B 3VQ6A 4CEBA 5L1JA 3QEXA 4RZRA 5L1IA 3NBPB 4PWDB 5T14A 4FXDA 4NLOA 2OPSB 3QYYA 1TL3B 2VG5B 2OPQA 1RTJA 4CJUA 2NUBA 3AO5A 4CEEA 3TANA 3K5OA 1ZTTA 4FJ9A 3HP9A 1JX4A 3S3MA 1RDRA 5KFSA 4NYNA 3QNOA 1EETB 4G3IA 1NJXA 4Y1DA 4RUAA 2Y1IA 4DTJA 1T7PA 4CFBA 5CYQA 3BREA 3PZPA 3KKSA 4BDZA 3LPUA 3DRRA 1VSIA 4HUEA 5EWGA 4M3ZA 3KMQA 1TKTA 3V6DB 4OGEA 3V9WA 4WZQA 3KLFA 3V9UA 4MK7A 3O3HA 3NGIA 2BANB 3PW2A 3OJUA 1RAJA 3L2UA 3JSMA 3OY9A 1REVB 2G8IA 1IKVB 4GMJB 3EYZA 3AVMA 1JKHB 3HVTB 3EY1A 1S1WA 5CYQB 4DSKA 4EO6A 3QEIA 3VQPA 2ATQA 3K57A 4IDKB 4E1NA 1RTDA 5EU7A 4F50A
chains in the Genus database with same CATH superfamily
4R8UB 2YKNB 2ZH5A 3LDOA 2JEJA 4HH0A 5E33A 3RWUA 4ZCKA 3CJ1A 3K5LA 3ZT3A 3BKTA 1UEKA 2L48A 2WAQD 4NMLA 5LMUF 4I2QA 1T44A 4CGGA 3R6LB 3W9IA 4F4WA 1RTIA 4LBIA 4EBDA 1QQNA 2FVCA 4OX9K 1MN7A 3CW2C 1S0MA 5GAGI 4H54A 5BRDA 3HD2A 4UF4A 2ZZMA 4R0JA 2R7SA 4NZ0A 3MPYA 2N4DA 4DMNA 4HLBA 3FBBA 3TZYA 2JWNA 3M1VA 2DRBA 3LTOA 2P9KA 2QWLA 2HNYB 3H1QA 4DX6A 2IVNA 2OZMA 3JQKA 1T9YA 1IJFB 3L3VA 1NPPA 3K9KA 4JKCA 4L3NA 4X65J 3V1OA 4ANDA 1HKBA 1JNZB 2YTCA 4CHOA 5D3GB 2V2ZA 4K0KK 2WBMA 3C8YA 2ADCA 1T3NA 3C15A 4G65A 3TU5A 2KHDA 3ULEA 2XQCA 2QKKA 4HACA 1RDBA 3V4IA 4IXCA 5J1PA 1CPZA 4KHPK 3CJ0A 1U02A 1NPKA 2DEJA 4F4ZA 1VQ4N 2QA4G 4P2SA 3GQCA 4M3TA 4ZHRA 3LDLA 5JVGQ 2D0BA 3BDEA 3G8SA 4DR5K 4ECWA 1HI0P 1TK8A 5L1KA 4OI3A 1SQGA 5D15A 4LSNB 2ZHAA 3AVIA 5K5MA 2P9LA 3W65A 4BRLA 3J81j 1RDWX 1R31A 1RUSA 1MMDA 2GJIA 4C0BA 1SC1B 4KHSA 1SQFA 3JTPA 5AQGA 1RT4B 3N79A 4Q7AA 3MAAA 4ZPBA 3NH1A 3AVCA 1JLAA 4NL5A 1BISA 2R8IA 4RW7A 2HNZA 4LF7J 1Y3JA 5JLHA 4IO1A 1GOBA 4H0PA 2F8HA 1Q7YO 4JN4A 2A1SA 2D7SA 4NA2A 2LQ5A 3VF0B 3DGPB 4C3LA 2NRZA 1Q1KA 4ZS6A 3S01A 4GV3A 4V19X 3TAQA 1BY9A 3MM9A 3WXLA 3VN5A 2DD8S 4JKBA 1NSKL 3RBXA 3CQXA 1UMJA 2W2NP 2CRLA 4ELTA 2O8FB 4MK9A 1U1LA 4IG0B 3MGJA 4AXJA 3DRPB 2X6SA 4M3XA 2V51B 3NGRA 4DG1A 2JRSA 2QWPA 4M45A 1VLYA 4WIIA 3CPWM 1IQZA 3NNAA 5AQVA 3AJ2A 3S3OA 3LAKA 4UY8T 1X0PA 3SMZA 4FJGA 2MJUA 3RAQA 1ITGA 2GFFA 4B9UA 2UP1A 1AXQA 2DFFA 1CS4A 1WG4A 3I87A 1WC5A 4FW2A 1Q4RA 2CPYA 2ILZA 1TK0A 3FR0A 1MLAA 4O3NA 3CPEA 3CSKA 1ILYA 3GTYX 4ZITA 2V67A 3M6GA 1G1XA 4K59A 2QI2A 4V1Ak 2GGPB 5KFHA 3UVJB 3UKUB 1BLUA 5HOOA 2CJ9A 3P3DA 5IS2A 3PRBA 1K0TA 5L8RC 2IRUA 2XO6A 2M9KA 1TUWA 1NGCA 2VPWB 3CC2S 1DURA 2ITGA 1EP4A 2WONA 4A57A 1RWVB 3US5A 5E5NA 1P9YA 2DEIA 3NGKA 4KO0B 3OFEA 1Q86O 4EEYA 4KHRA 2OPRA 3PFOA 3R1LA 1K44A 1HHSA 2J7KA 3VQCA 1U09A 3D1QA 2ZFHA 5C0YA 2DXDA 4QWEA 4OMFG 5KFDA 4CLWA 1U24A 2RS2A 4Z4EA 2VFSA 3H5SA 3OYEA 1YI2N 4DR6F 4FKXA 1B0PA 4X64J 2F7VA 3Q8SB 1HD1A 1S7IA 2VOOA 1IBLK 2E2PA 2BKNA 1HNVA 3M8SA 4RW7B 4AL5A 1TL5A 4H4KC 1KOHA 3SQGB 4U7UK 4AM6A 1WNSA 4X2BA 4ZOSA 4LR9A 3LW5C 5KFTA 1BU6O 3R2DJ 4UT4A 5KPZA 3EZOA 2EWHA 3MEGB 2J6UA 2KYXA 5MLCV 1CVJA 2BJ3A 1BIUA 3NCQA 1S5ZA 1HYSB 2EBGA 2OANA 2WBNA 4FM0A 4PG8A 3IRWP 5KOXA 3TABA 3RBEA 4ZLNA 4FK4A 5IWAK 3ASMA 2WOMA 3BSAA 3S6EA 2HWTA 3QICA 2QJ3A 1WEZA 3G87A 5DDOC 1NZAA 3G8TA 1U1RA 3ZTSA 4WK3A 3L2WA 3ENHA 5IQ6A 4JP8A 3M2RB 2O1PA 3D2EB 1KLMB 1V3RA 3A5NC 1RILA 2P6TA 3RVCA 3RRHA 4DUZF 3CT9A 1VQNN 1S97A 1EARA 3TTFA 2HLTA 3G86A 1KLMA 4KY3A 4LRAA 1X5SA 2FJBB 1VQYA 1TAQA 3AVFA 1B4SA 2GHVC 3PHTA 2IDOA 4LFBF 2QFJA 5CYMB 2VCPA 1Q5YA 4CGJA 2ZVSA 3SV3A 2H3GX 1Y10A 2B4PA 4DR2J 1QS4A 2K7JA 5BYSA 2EC0A 3EE3A 1YK9A 4DBQA 1QLNA 4RBTA 4BRQA 5E3AA 1PJ7A 4ZKAA 3IS9A 5C5JA 3DM2B 3ITHA 3C3LA 5B0AA 2ASPA 5J2PB 4DHVA 3OYKA 2V5HG 2FD2A 4ILGB 3UWTA 1TZ0A 2XLJA 3LWLA 3G71N 2QWMA 3DOMB 3ZSWA 3W1YC 5M1QA 1HQ2A 2QSFA 3QMLA 1N54B 4J9MA 1H2VZ 5F8GA 1VLOA 1HPMA 1JK9B 1BOTO 1HRHA 3OBIA 1HHQA 1HBUA 4FNHA 3EE8A 3VEYA 4LF8J 5GMKa 3ZZRA 3BKUA 2GELA 1YJWN 2WVFA 1C0GA 2AZ1A 2DGSA 1CC8A 2DNGA 1KQSM 4LFAJ 5M2RA 4HHTA 3A5OC 2J9EA 4EFAC 5CA5A 3EN9A 1N5TA 3VZIA 3C7NB 3I96A 1I94K 2H51B 4ITSA 1NGFA 2PFDA 3AOCA 2P9CA 4CF1A 4JD2B 1X7VA 2ZH1A 1VQ9N 2AW0A 2Q0RA 4NYOA 1IKYA 2M7SA 2JWKA 2Q6CA 3QEWA 1FJ7A 2IIHA 4OLBA 4RNOA 1N6QA 5M1FA 2CZ4A 2OI2A 2G8VA 2Y9HA 4LVNP 2AYBA 4WQ5A 5J2NA 3SLCA 4YS2A 1HMVB 4ZCLA 3TP2A 5AZIB 2E5IA 3CJRA 1RAFB 1QZ5A 4WF9Q 1RISA 1SL2A 1WHVA 3CQYA 5K20B 3QIPB 1NU4A 4WFAQ 3NS7B 1R59O 2FBYA 2GV1A 2VPZB 2Z2YB 4O4GA 2E5HA 1RT3B 1DZ5A 1T9XA 4CO3A 2YCHA 2QXFA 3O2IA 4K0KF 2WOMB 3HI0A 1JXVA 1KS2A 3O08A 1K47A 4FWNA 2N82B 5B0EA 2XZTB 4O55A 4FJ7A 2QM1A 4KGZB 3E8OA 3NWGA 4PXCA 5GADU 4PUOA 4KC5A 3GJQB 1S7HA 3WBZA 5CR4A 2QWRA 3TTCA 2DY9A 3T1YJ 3UQSA 1X5OA 5HROB 3EWGA 1RTDB 2DPJA 3WEEB 3G82A 4ENOA 3EMTA 4DV5J 1HLWA 1WF1A 2HB5A 4AHRA 3IM8A 4LFCJ 2ZJRL 1FJEB 4Z4CA 2QE5A 2KI2A 4CNYA 2KH9A 2P5VA 5K8MA 3QLHB 4JI3J 1NGAA 4MDBA 3M6VA 2HLUA 3CCRN 1U49A 3VEOA 3UPFA 3KMSA 3DRRB 2HHHJ 1RT4A 4IRCA 5KRSA 3AARA 2MLXA 4GVBA 2DR7A 2JHEA 2IBKA 1WOSA 3VVTA 3D6RA 1FRXA 2IAJA 4LBPA 4LSNA 4USTA 2V2VA 1NGHA 2R8GA 1VBXA 4JK8A 2RAQA 5D0EA 3Q89A 4BE0A 1UP1A 2O8DA 1HNVB 5LM7E 3MD1A 2D4WA 5L9XA 3H2UB 3GFHA 4KB0A 2PMWA 3QGPA 2M52A 3DHXA 1FO1A 4DX7A 3U3YA 1VSFA 3FZHA 2Q1NA 5AJ3J 2Z57B 2CG8A 2R2SA 4FJIA 1M90T 3J8AA 9RUBA 3ULHA 4USUA 1KAYA 1IBKK 3M8QB 3VAFA 4BC5A 5C42A 3P83D 4KI6A 3BYRA 2E6MA 3NY0A 2BUPA 1ZAWA 3ID8A 3V1QA 2XI2A 4K50A 5F8HA 8AT1B 3RB4A 2B9WA 4RJVA 4JI6K 2IJRA 5AFUA 2N3OA 5EX0A 1HNWF 4FN5A 1EQ0A 3DI6B 3TW0A 2E1AA 2GNKA 5F8NA 3R97A 3VGKA 3CB4A 2B9YA 4DUZJ 1HQEB 4F3OA 4BVOA 4GY2B 2ALYB 3TZWA 2JC1A 2OIHA 3H3OB 2PT0A 4YHHK 4QIFA 3PSIA 5KG3A 5M2UA 2V52B 5E2QA 1BUPA 3S7RA 3HZGA 3FMBA 1EQMA 1SKUB 2XY6A 1MMLA 4W4MA 5TKYA 3LF0A 3ZETA 4PZVA 4X4RA 2HSEB 1F0XA 1S3XA 1GLEG 3W8GA 3W9HA 4DU8A 2RIJA 4B1UB 2IRYA 2NUHA 2FSNA 5J2QB 1N8RT 2X51A 2XHCA 4Z7CA 3R27A 4CJEA 1DJ0A 2OPPA 1YJUA 2VB6A 3ZFVA 4BDYA 4DEZA 2ZJPL 4K4TA 2GBZA 2HHQA 4MO5A 3NF7A 5K8NA 3AO3A 5GINA 3ZSYA 2Q2RA 4GC7A 2ZDPA 3DM2A 2QLWA 2HVZA 2MZTA 2E44A 4ILLA 2KFYA 4ECQA 2O8EB 2GUIA 3HHNB 2FJDB 4JI5J 4DV6K 4G6VB 4DX5A 3WEEA 2X1GA 1KC8T 1NO8A 4Y2MA 3MFHA 1LCUA 1Q8KA 5C25A 5HQ8A 1I39A 3KJVA 5CYMA 3MMAA 4PQUB 3KVGA 3PYFA 5A8WA 2YX1A 4F3QA 4EI2A 3C16B 4YY3K 5CABA 2MKHA 2GV9A 3HTVA 4BC4A 2LEPA 4ZP9A 2R8JA 4ZIVA 3DLKA 2QMUB 3T1AA 3UKRA 1EXQA 3LDPA 2CG4A 1CG2A 3VAJA 4RW6A 3RSEB 4ELUA 2PEBA 3ZCMA 3OS2A 2H5IB 2XSJA 4L72B 3A8IA 3LALA 4CJQA 1JLEB 1GXUA 4TXSA 1D3WA 5DDQC 1S1VA 3HT3A 2E7XA 1S1UB 3VQBA 5AQJA 3HKZD 2B4JA 5ETRA 5IWAJ 3O3LA 1XUPO 2DFEA 3CCLN 4FJHA 3IXQA 2FHJA 2MKCA 4YN3B 3AVNA 4CZJA 2ZE2A 2MGZA 5T7LA 4K2JA 4OZ0A 3MUMP 1IKYB 4ZTJA 4AUKA 3C16A 1NNDA 4MYTA 5IQQA 2YKNA 2C3OA 2L08A 3H20A 3GV8B 5B8HA 3IGNA 4OJGA 1WNEA 3CJKB 4A8MP 3KJVB 2LSNA 2GZOA 1R8PA 4MFBB 3LANA 3PRDA 4DL4A 1LAWA 1BI4A 4HWIA 3Q7CA 4H5VA 2HBYB 2ZOGA 5KFYA 3ZTOA 4ECZA 1S9EB 1R8CA 3IAYA 3G6EN 2ETJA 4LFCF 1A6LA 2HAFA 3CD0A 3SCXA 1ZYQA 3IBWA 3CQ8A 4HHHA 3I32A 1FT8A 3CDWA 3DXBA 1MWKA 5B0BA 4FF3A 1U45A 3ZTPA 3KWMA 2NXCA 1YRXA 3OYCA 1GOCA 2EK1A 5M2PA 1C6VA 2QC3A 1U1KA 2FLOA 2XMTA 1JXEA 1SKWA 4B3MK 1NGIA 3ISNC 5K9FA 1VQ8S 3VQ8A 2KM8C 3SQ0A 3T19A 1TGOA 2NPIA 1EP4B 2WONB 3A13A 3SNNA 2RDDA 4DZ6A 3WIVA 3OPKA 3QEPA 4OYBA 2J9CA 1N48A 5L39A 4LF4F 2KXHA 3GSDA 1J6ZA 1TMMA 2Z1GA 4E19A 1RP5A 2HWHA 3SK3A 2W9CB 2OZSA 2RMLA 4CO0A 4CT8A 3K58A 4BRPA 2G8KA 5J2PA 4ECSA 4JYAF 2GO8A 2P9UB 4PKIA 5GAHP 1TELA 3AHPA 3L2VA 2C2MB 5KFOA 4M5LA 2VG7B 2YNHB 2VL1A 1G2EA 4FVMA 1VQ6S 1WDDA 2HK3A 3NOGA 3D2FB 3SFGA 2UVWA 3THYA 2MY7A 2QL7B 2HMPA 8ATCB 3M2RA 2E8AA 4XK8C 2F63A 1Y9OA 1IKXA 3D3CJ 2RUGA 2YX4A 4CEQA 3K8VA 3KXDA 4M5DB 3NGDA 4OI2A 1CS4B 3M8ZA 3BBFA 3SDEA 3DKDA 4OZ2A 1Q53A 2IFXA 3CJ3A 3UN3A 4LY7A 2KVQE 4OX8A 4ZA1A 5F2RA 2D74B 1LFWA 1NMDA 3SAGA 3H5YA 1LW0B 1RT1B 2LA4A 5F1XA 3GDQA 2R4FA 3ZSZA 3VF4A 2AEJA 3UNGC 4LF8F 2HNZB 2LLZA 4X4VA 3NRBA 4GO7X 1AFJA 3MEGA 1KCFA 3MX5A 5DRKA 4CRJA 2VPXB 2JDJA 4Q44A 7FDRA 3KG4A 4I9LA 5DLGA 3AVAA 4KH5A 3D2WA 4DX8H 1IWAA 2CDRB 4ALZA 2B56A 1TL1A 1RHUB 2P9EA 1TKDA 3M8RA 1XNQF 4ICLA 1U04A 4QIVA 3SUQA 2OPPB 3QLHA 3WNFA 4BC3A 5EHHA 5DS7A 2VQEF 3QIOA 4MT1A 4CLKA 3PFEA 2BV3A 1Q8BA 1NKCA 3AD8C 1R8HA 4H5NA 1IO2A 4KE5A 4JNEA 3Q86A 1Y7PA 2P9IB 1RT7B 5C15A 1YF5L 1EKEA 3ZZOA 1FK9A 2DGUA 5THWA 4BR2A 1QM9A 2JFKA 4BLGA 1XHZA 2EBEA 1NHUA 3BR8A 3DXMA 3MM7B 4WXOA 3D5MA 4PR6A 1VSJA 2EPIA 3ZYYX 3M1VB 3A2FA 3VQ7A 1GMUA 5ITHA 3QFPA 3QT8A 2L9WA 4WFNQ 2FGCA 2NQPA 1MNEA 3DRXA 2NXUA 1NXIA 3G9CA 3IAM9 2ZQBA 4WKRA 1NK7A 5HK4A 2YNHA 4Y2CA 1LW2A 2GVDB 3A8EA 2AJFE 1RWNB 3V9SA 3MCNA 2JC0A 1TMJA 2DFHA 1WSVA 3KKFA 3T7ZA 1RBSA 2DNKA 2YNFB 1QAJA 1F5AA 3ENQA 4BRCA 4E2FB 2JSXA 3CNQP 4DV0K 3O1LA 1S22A 3OR1A 4O4RA 1X4BA 2JJ4D 1BD6A 4PL7A 2F9JA 4C0HA 4ECRA 2RHKA 3VGSA 1N5QA 2JLFA 1VRTA 1V4SA 3BBBA 4CH7A 3VQEA 2YHAA 4DTMA 1KVAA 2ZHOA 3CCVN 2CJQA 5HRNA 4M7XA 4Y6IA 2BANA 3C6UB 3SIPB 4FBUA 2WRMA 3JYTA 4WF9L 1RHMB 4RW4B 2KDOA 3ZZPA 2KW4A 4Q8EA 3DOLB 2IJFA 2IYGA 2O8CB 4FBTA 2AEMA 4J2BA 2UUCF 3HVTA 2EI5A 2ITMA 1M5SA 3FGVA 4CF9A 5IT0A 2O3DA 4MLEA 1HL6A 4K4UA 3ZSRA 4HKQA 1FFGB 2YKQA 3NNHA 5IT9Y 1HWLA 1W7WA 2ILYA 1GMVA 1AW0A 1Y64A 3IAS9 1M5VC 1BI4B 5C10A 2CJBA 3VF6A 1VQPS 4JAXA 3M8WA 3E01B 4HEA9 5HO4A 2VWKA 2OLWA 3CJKA 3VETA 4EYIB 2PYLA 1JLCA 2OA8A 2FLPA 3BEXA 3D54A 1CZ9A 1EIYB 1MWMA 1HLUA 2O4GA 3IG1A 3DLJA 4NLWA 1WB9A 1SKSA 1YJTA 1IBMF 3UB5A 1J5EF 3HMJG 3CM5A 3AO4A 1K6YA 2W9BA 4OYAA 2MZSA 3C94A 3MK6A 3EE9A 1TUUA 5DG8A 2VYPA 2BTFA 3MCPA 2AV5A 1GLLO 2Z2LA 2CVIA 3SUPA 1XMOJ 2P6SA 3AY9A 3BPSP 5HRPA 1NJWA 3A5LC 1WEYA 1RHRB 3HHLD 2UUAJ 3TAPA 3F2KA 3C6TB 5F3TA 5RUBA 2E4LA 1S12A 1I1GA 2IVFB 4JRPA 3MECA 2KKZA 3JXUA 4TU9A 4DTSA 4FF2A 2K1RA 4NLYA 3F56A 1HNZF 2YH0A 4F3TA 1ULRA 4H0YB 4R79A 1EKRA 4OL8A 4Y34A 5KPTA 1F9EB 3ETMA 2W6KA 1NMNA 4JHDA 2E1YA 1RK8A 5HP1B 4KKOB 1TKZB 3AAWB 5F3ZA 4X4UA 3PW7A 2VASA 3NMAA 2HS4A 3P5JA 3KLGB 1YRUA 5LL6Z 1J54A 4YY3J 1Q9YA 4Z4GA 1T03A 1HBNB 1FEHA 5HRSA 3CF5L 2HRUA 1W97L 3ATUA 3TO8A 3PG9A 4MKAA 4DV4K 2NREA 1ZETA 3V81B 5LY3A 2A5XA 4B3TK 4ED2A 3AXKA 4LMZA 2CH5A 2NRHA 4ZJLA 3QRQA 1ROFA 4U67L 1U2VB 3CD6N 2YHYA 1RBUA 4O0JA 3VA3A 4K8ZA 4HYKA 2CIMA 1PKUA 1B7FA 1IUJA 4ZVGA 1KBRA 2P9NB 4GKKK 4YP3A 3CD5A 3CFOA 2CZVC 3J7AP 2UXCJ 4OPKA 3QBWA 3BKFA 1B70B 4P10A 4FO0A 2B6AB 1FHTA 4DFJA 2WVBA 3JSMB 3VA0A 2KO1A 2CGKA 1JLGA 3KHGA 5KT3A 2CJKA 5DZ6A 1PYOB 3J81U 3B4MA 3CF5Q 3PJXA 3PJWA 2DH9A 1U1NA 3JAMU 2ZVIA 5SWMA 1PIEA 3CCQN 2MQMA 3TUZC 4DLEA 2O4IA 2XBPA 4WKYA 3CMEN 4CZLA 1H2UX 4M63A 4W5RA 3WDOA 3GFXA 3PO5A 1XWLA 4K4YA 1HKAA 2ROPA 4K8RA 4CEDA 1W9HA 2E1CA 4QYZK 2KU7A 1I6JA 1G15A 2VQFK 1YVUA 3TZXA 1MROB 1WUAA 4LSZB 3FGUA 3A8JA 4DL6A 4O5FA 2FGOA 2RPIA 2HG4A 1YHQN 4HI2A 5AQXA 2FF3B 2WUSA 1ZH5A 3IC1A 1VQ9S 1EQYA 5KPRA 1G6BA 2HOEA 3UVJA 1H72C 2G2OA 5KFZA 2G9OA 2IVYA 4WWSA 4FS1A 1IBLJ 4A59A 1BUXA 1FCAA 4OIXA 2NR0A 3D2EA 2W7PA 3GFZA 5F8LA 1ACMB 2HFOA 2FHOB 4WFBL 4G1QA 1MU2B 3EL2A 1RXOB 1FJCA 5A2QY 2A42A 4CEBA 3QEXA 4RZRA 2OMLA 5L1IA 4PWDB 2EG1A 4DPYA 1KC8O 1MG7A 1TL3B 1EHWA 2VG5B 3F41A 1RTJA 2OP5A 1AFIA 1K8KB 2ZC4A 4ATNA 2CAJA 3EGVA 5KAKA 1U1OA 4RWXA 1BHNA 3SXLA 1QVFR 4RUAA 1S57A 4DTJA 1T7PA 4LFCK 5DETA 3ZZZA 1YUWA 4JK9A 3DRRA 1Q78A 5EWGA 4ETXA 4X64F 1IVZA 2BW2A 5AR0A 1HR0K 1SJFA 2F7TA 5LL6d 3OR2B 1X5PA 1RDUA 2CJYB 1H74A 1WELA 2XYHB 4QZVB 2E5LF 2UXBF 4HL9A 2M0GB 1JKHB 1UVJA 3EY1A 3G2XA 2EWSA 3VQPA 2I7PA 2M5YA 4B1XB 2P9SB 5EU7A 3F44A 1VQ5N 1SJRA 3NDKA 4P75A 2HQIA 3NS6A 5DQHA 4OYOA 1HNXJ 4DL7A 3UR0A 5CHIA 3BGRB 1HR0J 4IKAA 3UN5A 2PYJA 3L4IA 3O3GA 3M6XA 4ED8A 1RBVA 2FVPA 2XG8A 4CP5A 1RKIA 3WIUA 1RFQA 2WTUA 1FERA 1EWRA 3QBCA 3BDPA 2W42A 2CVEA 3KK3B 4I6MB 1R8BA 4PYDA 5ETQA 3IFRA 4M63C 2GQ2A 4ZJOA 2IGIA 4Q43A 1NB7A 4C98A 1S0VA 4FVUA 3RAMA 3C15B 5LXRA 2QFIA 1YIJS 3T9NA 4BREA 4AFFA 2FIUA 2Y1LB 4LF9J 1MW7A 3D1HA 3FQLA 3D67A 5M1NA 3LWMA 1HMVA 2R7OA 3AVLA 3QWUA 4WTOB 1QHAA 4GKKF 2EVZA 3TZZA 1KVJA 5F8IA 3NL0A 3UKUA 2P9KB 3GBTA 1V6HA 1CJUB 4DV0F 4KHUA 3U1MA 1YT3A 3M30A 3LP0B 5LJ3Y 3O8WA 4JI1F 4K4ZA 2ZOMA 3NWRA 3ILJA 4WFYA 2NS1B 1Q79A 1FTRA 3M8PB 1ZAVA 2XY8A 1Y97A 2D0CA 2VHGA 4CECA 2OMOA 1NGDA 4MQ3A 1WLJA 3BYPA 5IC4B 1QVGM 2DYAA 4JV1A 3O1WA 1XR5A 2F96A 4KBIA 2ZBPA 1IM6A 4FYXB 3MOZA 2FY1A 3W64A 3TSPA 5KQ8A 2XMAA 2ZWOA 3I55N 1RBLA 4CM0A 4X65K 3MM5A 1S4EA 5HVGA 3AOBA 1J5OA 5I3PA 1H1VA 1QZ6A 1ZBUA 1F5CA 4HH1A 3T1HK 5EX5A 4DV2K 1QQCA 1TAUA 1FNXH 3PTWA 1UZHA 4USVA 3MM8B 4P2MA 3GILA 1NK0A 4DV6J 4A8YA 3AAPA 1RB0A 3HM8A 4WTYA 1OH8A 1UA1A 1X60A 1WSEA 4CJKA 5BYRA 2OD6A 4YR2A 4CLZA 1LOUA 3FCVA 4CJVA 5C24B 2LKZA 3BO2A 3OTOF 4LFBK 2DNPA 3ISND 2DNQA 3O6WA 3DLGA 1RWKB 2P51A 2IHR1 2HQFA 4KGXB 4OPJA 1TK5A 1SS6A 4BQZA 4B3TJ 3ZT1A 1IH7A 3MCOA 1DQ9A 3TJ9A 4CDIA 1S0OA 1KAZA 2ZKUA 4FJ8A 1VQ4S 1HW8A 3U3GA 2ZH4A 5B09A 2MEWA 1HUXA 1TV6A 1N88A 1X4FA 2VDIA 2V6AA 1S72N 4EBCA 1W2BM 2N4CA 2ZBCA 3MR2A 3H98A 2MY8A 4U67Q 3O8MA 1OQ6A 4N5SA 3L8BA 4A61A 5AXLA 3TWZA 2HVIA 3B8HA 3C65A 4IRKA 3A3OB 4DSEA 1FKAF 3QATA 2K8GA 3AA4A 1X9WA 3CHWA 2YKOA 3CCLS 2VICA 1YJ7A 3VEWA 4WJBA 2EW9A 2HNYA 4NCAA 4BBYA 2JEIA 3RB0A 2QWOA 1LWXA 5KFAA 4U96A 2XYPB 4LF2A 3OYHA 2E2QA 2CNLB 5F0WA 2XNRA 1EO1A 4KH6A 2DPNA 2VKRA 4H4OA 2IC3B 4CEZA 4USJC 4BR0A 3OXLA 2LP4A 1ZXOA 2XLKA 2HHUA 4ID5B 4PA1A 1J53A 3GJSB 2XS5A 2KG1A 4B1WB 3SEOA 1WF0A 3AD9C 4IG3A 4CD3A 4B9TA 2NNWA 2UXCK 4ZVHA 1HYVA 3DLGB 1WDTA 2GWJA 4OV6A 3FZBA 3CMAS 4CI0B 2VWJA 1ELOA 5KG1A 3V5RA 2Q6BA 3OSNA 2CADA 2ZBQA 4H4MA 2AGOA 3KLFB 1FKOB 3D0IE 2BE2A 3GWCA 3A4TA 4JKFA 3NGTA 1HW9A 4J9OA 4UOFA 4DCJB 2BJEA 1C4AA 3I9V9 1T0TV 3M32A 2VDHA 1QAYA 1XMQF 5B0FA 5C2FA 4DL2A 5E3QA 3R7BB 1UW4A 5EY4A 2DNLA 3ZNJ1 1K1QA 5KFCA 1Q16B 5G4DA 3W3SA 2CJXB 1PBUA 4DQRA 2OFGX 1SBRA 5JVHQ 5JXSA 4W5OA 1VQ7S 2DIUA 1FESA 2MKSA 3OUYA 5H9EK 4FJKA 4Z37A 4B3OB 2L9DA 4F3MA 5CZ2A 1ITPA 2I6WA 3SUOA 4KO0A 2YWWA 3SPZA 2R7YA 1M5HA 1HNIB 3M3ZA 3FCHA 3H42A 5FPNA 3VOVA 3SBTA 1T05A 3RB3A 4Z4HA 2GJ2A 3MMVA 3B54A 3OHAA 2V4RA 1F2GA 2CPXA 2FJWA 4X84A 5J2MA 3GLJA 2NLWA 3AVJA 1WC4A 2KXNB 5HL7L 4R25A 5BR8J 4ES1A 1VSHA 4CYUB 4LF6J 3N0VA 4CW7B 4QW9A 1D8ZA 4TVAB 2NPFA 4Z7YA 4LF5K 1SJ4P 2CH6A 5U47A 4N76A 2X74A 3R1HA 4RW8B 3F9KA 3ZX0A 1X4CA 3JS9A 2OEKA 1RWWB 2IYIA 3K59A 4YOXA 1R7IA 2V8VA 4TN2A 3Q8QB 5B0DA 3DLEB 5AE2A 2E88A 2AJ1A 1Z1ZA 4DQPA 5EWEA 3ET6A 4MMOA 2RVJA 4LF6K 3ZTRA 1BWVA 4J9LA 4K4VA 4K8XA 1N0VC 1U25A 2BACA 3IN5A 5B0CA 5FIIA 1NH8A 3BGRA 3JTNA 3FFIB 1ATRA 3CETA 5HSPA 3CWJA 1X31C 4R5PB 1VDHA 4J7CA 3FNNA 2XLIA 3UDVA 1EAYC 3TNVA 4R5PA 1LWCB 4JI3K 1T8EA 4I4BA 2H4WB 2IC3A 2XO7A 2BDPA 3MFIA 2E5JA 4ZVSB 1KD1O 1GMWA 1N5YA 3WXMB 3PSFA 4RNMA 2VG5A 2C2NA 3TRGA 1APSA 4C8MA 2WC9A 1U6ZA 3AA9A 3C14A 3AVHA 1YZ7A 2PFFB 3GE9A 3HPHA 2LXFA 2E20A 2Z4PA 1M1HA 5A76A 3SZ2A 3RR7A 2PC6A 2RDIA 1K8KA 4YDUA 1BXNA 3TVKA 3MDQA 1KTVA 4DTRA 2XNQA 1IBKJ 4BRHA 4A2AA 3U02A 3WQUA 1OH5A 4B1ZA 3MECB 4P7TA 4CJ4A 4YHHF 3O44A 5AJ3K 4C3KA 3VGLA 1UVIA 2JH3A 3EDRB 1RT6A 1FW6A 2HHVA 4HDHA 2DGXA 3CFRA 2G1HA 4CJ7A 4J2AA 2CDQA 1GLFO 1WTBA 1RKJA 3KIOA 2DNRA 4RR5A 1EZZB 3IP0A 4K43A 3HJVA 2DPIA 4R0EA 1NUEA 2P9UA 1XTZA 4RO0A 2E9RX 2P9PA 4FPRA 5C24A 3FMWA 1VSEA 2RKIB 2FHJD 4F67A 2NRXA 4BWMA 1M1GA 2FJEB 4WFZA 1WHWA 4E89A 2O8BA 4B3OA 2AJ4A 2P1JA 5E26A 5CZXA 4J2DA 2GEMA 3TX0A 1NG9A 1WOPA 1TUYA 3DNCA 5LSOA 3AB2B 4B8AB 2J6TA 1FD8A 3KLHA 2H5JB 2UUBJ 4M5KA 2XY7A 4RW9A 4OX6A 2JNJA 3WQTA 1TP7A 3O9UA 5F8MA 3MM8A 5KOWA 1XN9A 4F0MA 1HR0F 3N6NA 1HNXF 3DDNA 5KFJA 2DISA 3OL8A 3VAGA 1XEZA 3HPGA 1IKWA 2MQPA 1K8AT 1A7GE 4USHA 2MLZA 2ZWHA 1YJWS 1RTHA 3P1GA 3V6DA 2GVZB 2D69A 2I0XA 2C3MA 3B6BA 2C2ZB 1DLOA 3VV2B 2E5LJ 2A18A 6AT1B 2VC1A 3ZLJA 4CIFA 3Q22A 2B7CB 3W61A 1VC0A 2W4PA 1VRTB 3CJAA 3BH6B 1UL3A 3DMJA 4XPEA 4ID5A 5ADXH 3W8PA 1Z2LA 4JK7A 1FKOA 5EWFA 2AYGA 3Q8YA 2CNOB 3PNIA 1VQ6N 1SZ2A 4NRTA 2KT3A 4OHZA 2U1AA 2VC0A 3CJ8A 3I56S 3A5MC 4CH1A 3P38A 5EDWA 3IM9A 3THTA 3TJ8A 3SYZA 1U1PA 4IOAQ 4P9SA 2O8BB 2ZH6A 3NGYA 3PJ9A 5KG0A 2DHAA 3SJJA 3I33A 3MOJB 1SAZA 1PJ6A 2ASMA 4YR3A 4JV5J 4Q0BA 2P9PB 2EXUA 3V4MA 3GONA 4TNOA 3NLCA 1IBLF 1X9SA 2Y1JA 1FWLA 2XB2D 3KG0A 3POTA 5KT4A 3HLUA 3HK2A 1U0SA 2IVMA 4FK2A 4ILHA 1HWIA 4Q5VA 3QZ8A 3PR4A 2MQOA 4YOUA 3W7BA 4CO2A 4ELVA 1YVNA 1OY6A 1S4FA 4KSEB 5HMXA 4URGA 1R3NA 4DR7K 4FYDA 4BE2A 3E9OA 3PYDA 3I31A 4X4NA 3TR8A 1S48A 2IIRA 4CHZA 1S72S 1YBUA 5ADZA 2QLFB 2M88A 4ERDA 2GO9A 4F36A 3FUYA 4GKJJ 1XR6A 3O80A 4DV2F 2V69A 2BXJA 2J9DA 1AZSA 1YITN 2R2UA 2DHSA 4ER8A 1QSYA 5GAHI 3KDNA 2VBWA 2HGNA 3HVWA 1FDDA 2RQKA 2PMZD 3MN9A 3VALA 2D3UA 3CC2N 3DLEA 1J27A 4O3OA 1BO5O 3MEDB 3Q8PB 1RBRA 2I2YA 2K3IA 1SQEA 4DDFA 4H0XB 1TYQA 3QFWA 4KQZA 4DTUA 1E3MA 3QZ7A 2IA6A 4DR3J 4IR1A 1QTNB 1WKLA 1SXLA 1VQMS 4PQAA 4Y2KA 1MDUB 3T5JA 3H0PA 1UW9A 1KVKA 4CO5A 3I4PA 3WZ0A 4UW2A 4RUCA 1G99A 3IRXA 3AV9A 4ED4A 2BOPA 2DVIA 3JYTB 4DUTA 4CF2A 4ISFA 1QSLA 1KR4A 1Q86T 3MR3A 4E1JA 3KOAA 2BJ8A 4B8CA 2ZC3A 1ZA1B 1VK3A 3LP0A 2ERRA 2V8HA 2W2MP 1IG8A 4CYUA 4OZ5A 2E1PA 1ZZNA 1QUPA 2XHWA 3PX0A 1WD6A 1OO0B 4HTJA 1FEEA 2Y3YA 3B8AX 1VQMN 3DRYA 1LEOA 1M5PC 4KTZA 5GVQA 4DV5K 4WE1B 1Z4UA 1SUQA 3MTJA 3CTRA 5L38A 1I5OB 4JI5K 2AT1B 5IT9O 1FXRA 4HTIA 3M30B 2MJNA 4NLTA 2AQ4A 3MHYA 3UDEA 5EX3A 4OLPA 3BN7A 1YHQS 4NA3A 3EDQB 5ETLA 1HNZK 5AQIA 3AY0A 5I3UA 2EKNA 3SQ2A 1FFWB 4X66J 2QA4N 4D3HA 3TI0A 2OYQA 1UFLA 3OTOJ 3C95A 1FK9B 1ZBSA 1QY7A 4JI2K 3OVAA 4KHPF 1JL2A 2FJVA 2F4VJ 4ZVUB 4FYVB 4LUBA 3CJSA 5A8RA 4FZVA 3D68A 2N7YA 3VHQA 1QQMA 2DNMA 2X3DA 5IT9U 2OO4A 4IUFA 4K25A 2ZBRA 3GG1A 2FJAB 2H3EB 3HF5A 1C0TB 3ILLA 1IBMJ 3DWLA 1TL1B 2RQMA 3JAMO 4BC2A 2CA9A 1F3VA 3VPZA 2P9NA 1A5WA 3S1TA 3ETOA 3E9LA 2HVDA 2J0QD 4GVBB 1RCXB 2Z2MA 4KPCA 4DLGA 4DFPA 2YWGA 4LT6A 4RNFA 3TAFA 4CQ1A 2MLYA 3TAMA 3P4IA 2HFVA 3KTQA 1VOMA 4IQXA 4QWAA 4ZMMA 3HOTA 4RTFD 2DGWA 2ZZNA 1UVLA 4UOCA 2FJXA 2KZZA 2UU9F 4CLUA 4KKOA 3D6TB 3QETA 4AM7A 1N36F 3TAMB 4E3SA 3OFFA 4P71A 3Q24A 3ICLA 4RWTA 4NI2B 3DXSX 1RTJB 3G82B 3LP3A 2PZSA 2GS8A 1BA0A 4X4SA 2UVUA 5KFIA 4JKGA 4JI2F 5H9FJ 2AEFA 3L4QA 4QIEA 3D3BJ 2L3MA 2BMBA 2LDIA 5D4LA 1Q8IA 4GKKJ 1BCMA 2HMIA 3GU0A 1VISA 1FVQA 1W0HA 4MH8A 5DZ7A 1VK0A 3PW4A 3B4DA 1H7XA 2ASOA 4JLHA 3J7YU 1UETA 1JCEA 5B7WA 3VEVA 2V9WA 1WKKA 4LD0A 3NBPA 5GAEP 1NGEA 4A2BA 4BG9A 4IQMA 4K5RA 2XHBA 2ZUAA 4B1YB 3A3PB 2HKEA 4CJ3A 2COLA 1VYAA 3H59A 3AAQA 5JVHL 2CPHA 2KHOA 2VA3A 7AT1B 4JI7F 3PKYA 4TSXA 5J2NB 3UIQA 3SQ1A 4FNIA 4DPXA 1XQSC 4QU7A 1WF2A 1WHXA 1PG5B 3TTDA 4K5SA 1U48A 1GFWB 1R89A 4NLDA 4B08A 1RLDA 5AQYA 4NLBA 1VMBA 2H54B 2JL9A 3R8YA 3T5HA 1BCOA 4N8NA 3DXKA 3IUCA 3CCWA 1NOYA 4DR7F 1QJHA 3MUTP 2OSQA 2F9DA 3K2PA 1HI1A 4Y2AA 1VQ8N 1R0BG 4TYAA 3N9UC 3OVNA 4O8KA 5EOYA 2A3ZA 3G10A 1FKPB 2B43A 3C7NA 3O9SA 4JKDA 3PKMA 3G6YA 2GVZA 5KFXA 4PPZA 1VC6A 1Y5IB 3FFKB 3GR1A 3VERA 3WT0A 3AODA 1YXQA 1HPZA 1WUUA 4E7IA 3E1YA 5ETPA 1NDCA 3DLRA 2HFNA 3CMQA 3ILOA 1T9TA 2CPJA 1ICEB 4PG7A 4JI1K 3GL1A 4F0KA 2LDYA 2Z8QA 3VQDA 3J7ZT 2ZZTA 4DU3A 2DGVA 1N32F 3FSIA 5KGWA 1SPBP 3NCIA 1SL0A 3W63A 4KB1A 3D28A 4C1NI 1ZAXA 4GVEA 3QESA 1OSDA 5IC6B 4C8LA 2CWXA 5J1NA 4FXVA 2CNNB 2D3ZA 2YNFA 4Q8FA 2UV8A 4BDPA 1V5VA 3Q0AA 4CGFA 8RUCA 3SQOP 2APOA 5I42A 4MTPA 5AQWA 2KT2A 1LW2B 3MCSA 2W4CA 4WPAA 5A6WA 4EWTA 4CLFA 2KQ2A 3KLVA 3QAEA 4C97A 4PHTX 5LT5A 1S1VB 5T7LB 2VGMA 2VA2A 3R5DA 1U6FA 1ZOTA 2K1RB 4AQYJ 2ATLA 4LF4K 4LJMA 2EFPA 4DUYF 1JLBB 2F9TA 1IQTA 3Q8RB 1NLVA 4LC9B 2LXIA 5CH7B 2MHNA 3DHWC 3UDLA 1WAFA 3KK2B 3IMXA 4CZMA 2Q0UA 3U6FA 2FBVA 4OI4A 4DV1K 3HDSA 4FCYA 3BO3A 5FPDA 2AX1A 3CO9A 3G0ZA 1KD1T 2W01A 1PC5A 2NRRA 1JB0C 1FJGF 2YJFA 4BC9A 2OKQA 4C8KA 3HFVA 2ROGA 3H5XA 2G8FA 4P74A 3HHDA 3L9ZA 4ZVTB 3O4WA 4BRKA 2MHEA 4F4XA 5H1SV 3H4BA 3RB6A 2YPZA 3CDAA 3DRSB 3LM9A 2BKOA 2YNIA 2W9AA 3ENBA 4QQBA 4DV1J 3VQTA 3N4QA 4NPOA 4LFAK 2OGUA 2QYCA 2E9TA 4AF1A 2Y0BB 3GIMA 3U4LA 5KT2A 5A0YA 1PAUB 3NGSA 4FPAA 4ECXA 1JLFB 1YGYA 1RT5A 2HQDA 1O0PA 1JCGA 3S41A 4CFCA 1M90O 1S6QB 5D0RA 4RL1A 2FDNA 2HSTA 4USIA 1OPZA 4M5HA 3M9MB 1XMOK 2XGQA 1O6XA 5KGXA 1NKBA 3CG7A 2XY5A 1B92A 4C9DA 1FDAA 4KTWA 2OD4A 3FJ2A 5C2GA 2JWLA 1UAXA 1NJIT 2O8CA 3MM5B 2HGMA 3RMDA 1LWCA 2DNZA 4NLGA 2OPSA 1WACA 2HHTA 5DJBA 2HHHF 2MQLA 3TSQA 1IKWB 1Y4ZB 2ZEJA 2FHMA 1P27B 1QHTA 4ZVEA 4N47A 1IWGA 4PG4A 3NHGA 1K9MO 3CMAN 4FXWA 4ZPAA 1YJ9S 2L9NA 3HP6A 1U1QA 5AQUA 1NK8A 3P8BB 1W25A 4CJFA 4AQYK 4I64A 4RW4A 4EHTA 4LF7K 2PO4A 3TJAA 4DSJA 3KHRA 1S1TB 4OYMA 3TPQA 4EP4A 3IA0A 3OR1B 2YNGB 4JI7J 1U2CA 5CHCB 3T1YF 5LMNK 1R0AB 3MZIA 3KNGA 2LQBA 1YDLA 4UOGA 3ZT0A 1N34K 2E7WA 3UCZP 2X3GA 5HLFA 3WUHA 5FROA 1VQKN 4DS4A 2VONA 4WFBQ 1D09B 2DXEA 3AXMA 4CI6A 2J8AA 4M5JA 1WC0A 3MAQA 2XMJA 2YX7A 4XO0A 1J5EJ 4F02A 3I9ZA 5GAGU 5E3CA 2MXYA 1N32K 2YWFA 4CHQA 3E9PA 2ACYA 2D3O1 3DLHA 2C3PA 2RRNA 3HFKA 4OX7A 1C4CA 2XRIA 3GG0A 3R6GB 3HVRA 2O67A 3Q23A 3PXGa 1WHYA 4NASA 3QBXA 2E29A 1J9AA 4GNIA 1WEXA 3QSYB 4MIBA 4WCEL 3U9ZA 1CBKA 3J81Y 1KOOA 4OKJA 5CQGA 3CCZA 5J1EA 1QE1B 2W8KA 4E0DA 1HX1A 1RHQB 4FPIA 4CLPA 2IMWP 4LIRA 2A6AA 1HBOB 1UFKA 5EGYA 2QL9B 1XC3A 1CLQA 3EICA 3OYIA 3VQQA 4LRBA 2VIHA 3AFGA 3HSCA 4BR5A 3R5JB 3FQKA 4DI6A 2W7AA 4JI5F 3TYTA 2HIQA 4QOTA 4DF4A 3ZT4A 2Q3SA 3U9DA 3CGIA 2DTJA 3CI5A 1BL3A 1F9FA 3LGMA 4WZMA 4EFHA 1XNRF 3S3NA 3KLEB 1NLKL 4QPTA 2ROEA 3K5PA 2AJQA 5HBMB 1MWQA 2AA4A 2MPUA 2ZE2B 2MGZB 3MAAB 4PXEA 2QA1A 1MWZA 3L2RA 3ITHB 2V7ZA 3T5LA 4YEAA 3KLIB 2BZ2A 5AE1A 4CJRA 4NLXA 3BSCA 1E4FT 4J9UE 1Q18A 2HPUA 1ZBHA 1UKUA 2XZDB 2H9ZA 4DQIA 4CZIA 1M0SA 3CVKA 5B0GA 3EPGA 4CZKA 4CZGA 3IKMA 1DEJA 4BRAA 2BJ9A 4PUOB 5CZ1A 1RNHA 2KYZA 3THWA 4X62K 2X78A 1XJWB 4I6WA 1NAQA 3L95X 2DY4A 4CBWA 1S6PA 1NHVA 3EJMA 5D78A 4C4WA 5EXWA 2G4BA 1RT3A 4IZ9A 3HO1A 3VAHA 4CF0A 4DR2F 1IKXB 4RNHA 4IH5A 1E6VA 3C6HA 2QYGA 1TV6B 3EXCX 1F60B 1KNZA 2R2RA 4CFAA 3BGFA 4W92B 4EIAA 1B0VA 2B4UA 1FJGK 3OL6A 2XC9A 2I8EA 2QEXS 3IG1B 1TL7A 3P6YC 4FVCA 4P2XA 2XI3A 3AQOA 3IR5B 3J7AN 1RQ0A 5CY4A 3GJTB 2RT3A 2CJAA 4DN0A 4CIGA 3AA8A 2C2OB 4OQJA 3UE2A 5L1JA 1XNQJ 3M4XA 4UZCA 5T14A 4WFNL 1H73A 2F4VK 3IDHA 4NLOA 2RS8A 4DR3F 4NA1A 1GLAG 2GMHA 5BPLA 2PDAA 3AO5A 3TANA 2MSTA 4BR4A 3FZLA 4I69A 3K5OA 2O8EA 1Q8LA 3HP9A 3S3MA 3GE1A 4NYNA 2MQQA 2DJWA 2IBOA 2QSWA 5IT4A 3CCVS 1F5BA 4B17A 1M5OC 3MMCB 2Z0GA 4BDZA 3LPUA 1U0HA 4B3SK 2MZRA 1TKTA 1FFSB 4OGEA 3V9WA 4WZQA 4C8YA 3V9UA 1REGX 3LM2A 2BANB 3OJUA 3JSMA 1H2TZ 4IJNA 1ZM9A 1IKVB 4RBVA 3EYZA 1HBUB 2VFTA 2AYEA 5CYQB 3M32B 3FBFA 2XZWA 1UJ5A 3C66A 4EO6A 2XTJP 3K57A 2ATQA 4DR1J 1FRHA 2XCPA 2YWKA 4F4KA 4V19S 1PYTA 2DIVA 1OY9A 1EJ7L 4CVNE 3RRGA 2Y8WA 4DV5F 1XC9A 3FCWA 1VI7A 3SBMA 4OKEA 4CZHA 1UFWA 1NDLA 1YAGA 1RYSA 5LSLA 4I0WA 3TA2A 3BN4A 1HI8A 4DUYK 4FM2A 4FPBA 3OBWA 2I38A 3W2WB 4M3UA 4JYAJ 1WC3A 2D9PA 4Y00A 4W90B 4QAGA 2A0FB 2PSZA 4JV5F 4WQ4A 5KT5A 4CF8A 2FHKA 1LKZA 2P8IA 2XMKA 2KLAA 2CXEA 2BKPA 3L4BC 4J9KA 5IM0B 4AHCA 2VQEK 3NNCA 1D5AA 3MPDA 4M42A 4DR4J 3MPWA 3RUBL 1RT7A 1FX4A 2F8TA 2RE2A 4LSLA 5F9NA 4YOEA 5KG5A 1T3OA 4ZPTR 3NGZA 1WWHA 4YOVA 2AU0A 2ZJQQ 2DHHA 2DY1A 3GJRB 2RHQB 3OT9A 2E1ZA 1SQKA 1GLBG 3MPUB 4J9RA 3C14B 3OVSA 2UZAA 1KFSA 2ZOFA 4WP3A 3NF6A 3LO3A 6FDRA 2ASDA 3MUVP 2LCWA 4JUZA 2DBBA 4O3SA 4NLVA 2H4YB 4NEYA 4AL6A 5AQKA 2MZ1A 5L1LA 2HF4A 3VF2A 3I6PA 4FOEA 4X4QA 3M9NB 4YB7A 3UD3P 1H98A 1CULA 3ISZA 5KFUA 1NSAA 2J8SA 4PXDA 5ETVA 3CJ7A 3UD5A 2MB0B 1WSHA 3NH0A 2BW7A 2YHWA 1X1PA 4H03B 4PXBA 2ZD1B 3DFEA 3MR6A 4QS9A 1I94F 2M2BA 2JLEA 1HYZA 2OCEA 4LBHA 4B9NA 4EU0A 2UV8G 3OXGA 1DRZA 4BCAA 5AZJA 2VPYB 4P2FA 3FDSA 3KWGA 1DAXA 1R8AA 2CGLA 2AP1A 4O44B 3X3UA 3MN7A 3C6UA 4KFBB 2MKKA 4ES2A 2LQ9A 1WSJA 2IDEA 1XK8A 3D2FA 4MLHA 3PY8A 1HQEA 1EB0A 4QOZB 5ETSA 5AQTA 1SJQA 3K17A 4ZPDA 2WZ1A 5DG7A 2HHXA 2FXUA 1GNKA 3H4DA 3BPDA 3CC4N 2QLXA 3H3NO 3C0BA 1E4GT 4BR9A 3NS5A 5HVFA 5CXTA 4GKJK 5TKWA 5AE3A 3CCUS 3OYJA 4ZIWA 5GIOA 3PIPQ 3SMPA 4PRFA 3ALYA 1D4XA 2AIRB 4X64K 3KUGA 5BRFA 4M3WA 1RA7A 3N01A 2QA4S 1NNEA 3R5CA 2WTFA 3PYEA 1UA0A 3EO3A 3F9MA 2M70A 5BYQA 4UZBA 4F8RA 3J7ZO 1MROA 3R8EA 2UUBK 4RBUA 1U4BA 2AZ3A 3HHLB 4X4PA 3L7OA 1NM1A 1X4AA 5AQHA 4B9MA 3EEQA 3E51A 2BGGA 3TEHB 5JUMA 3HSDA 4FJ5A 2IMOA 2V4JB 3NEKA 1IBMK 1ASUA 4ANCA 5IV4A 1CJKA 2FVRA 1K1SA 1X5TA 3JTOA 4TYBA 4ECVA 1T95A 3ZSVA 1JL1A 1Z2ZA 4QWBA 2YBVA 2CQDA 3ZNUA 4M5IA 4TQRA 4FK0A 1SH3A 1RZMA 2C28A 1XMQK 1SIWB 3BZQA 2FSJA 3H5UA 2W7OA 2IM3A 3DU6A 2ZD1A 2HHHK 4DR6K 4KI4A 5HJYA 5HJXA 1Q0NA 3QINA 2A10A 3Q2SC 1KAXA 4ZTFA 4IFVB 2BQRA 1VQNS 3N5FA 1H7WA 1NK9A 2CQCA 1CZBA 1RBOB 1OVYA 3GFYA 4ZHRB 4ZVPB 3BGLA 2ZH3A 5CYJA 2WSCC 1A9NB 4I6YA 2DGQA 1PC4A 1HNWJ 4U9RA 3QWPA 1UPPA 1UCNA 4S0MA 2NSCA 3NE6A 1FWPA 1EETA 1VHXA 2Z1JA 5LJVA 4TY8B 1WORA 1BWEA 4KAZA 1NBWA 1L3TA 4JRQA 2W24A 4B9SA 3DOKA 3ZSXA 4CJ5A 2A6OA 2B51A 4L74A 3OJSA 2P5GA 4M41A 2H65B 4C11A 3CXCR 5AFUH 4KREA 2XSJB 1X4GA 2P2CB 4LIWA 2V2KA 4CH0S 1RGIA 3NCPA 4L3QA 3EM1A 1RT1A 3N28A 1RDDA 4KHMA 1SH0A 3QIPA 1RBAA 3UKRB 3GIRA 2NSBA 3JAMY 3K5NA 3AA3A 2Y8YA 1D0EA 4NLPA 5KRTA 5KFWA 3RU0A 4BQLA 5A6PA 2R7XA 3RSEA 3RMBA 2M4MA 2KRBA 5BPNA 5AQMA 3S8SA 2EFGA 1O8BA 1YSJA 2ZH2A 1F6TA 2CQPA 3IGVA 4IFVA 1NU0A 1W2IA 2C3YA 4AHVA 3MMJA 1K9MT 4XEIA 3AQPA 4TU7A 3PO4A 3EXYA 1IR0A 2F65A 2ATCB 4G1PA 1G4CA 1ZA2B 4YB1P 1TUVA 4A4JA 1VBYA 2G13A 4JI0K 5IXUA 3V9ZA 3RYLA 4JI3F 4LF5J 4NO7A 3RTVA 2ABYA 4JI2J 2J7UA 4KTQA 1JLGB 4M94A 4OJ3A 4YB6A 4BGBA 3GYGA 2DNYA 3LH2S 3TSUA 2NUUG 1SVDA 5M1PA 4N41A 3PIOQ 3MI7X 5DGAA 3RAXA 1XMBA 3E01A 3I8DA 4JI8F 4NXNK 1QAXA 2PI4A 2B9XA 4DR2K 1ZBTA 3QO9B 2PBDA 3ZT2A 3MDFA 1PGZA 2JGUA 1U7LA 3CIZA 1BGXT 3TAEA 1JJ2M 4IOCQ 2OTLN 4M8LA 1FDBA 2RJZA 3MD3A 2YXLA 3KHHA 1KQSR 1UVNA 2HEKA 3A8YA 4IOXA 3LPTA 2HBLA 2UVVA 1N5VA 2FYXA 3OV7A 4Q45A 3HZEA 4N77A 1L5UA 2WK4A 2QK9A 3ZETB 2RUSA 5H9EJ 2ZNYA 3W5XA 3V6JA 5KG7A 2O66A 1NSPA 4C1NK 4LF8K 1HNWK 2POKA 1YJVA 1RADB 4YDDB 4EUVA 4B3RJ 1KXPA 2PI5A 4WFAL 3AD7C 3BGOP 4KIAA 2N3LA 4JV0A 5EN1A 1S76D 1WG1A 4J37A 2GHPA 2ZKTA 1TVRA 3MCAB 5E3PA 4G9ZA 1UEUA 4WIQA 5F9LA 4QWDA 3MN5A 4KHPJ 4YDUC 3ZXWA 4G1IA 2KFZA 5HLFB 3BF3A 3LPYA 1B9DA 4GV6A 5LMNF 4H0OA 1D9DA 1EX4A 4NYPA 5D4OA 1FD2A 3P5TL 4ZLJA 1HARA 4E7LA 3RW7A 4GRSA 4ILJA 3ZX3A 2RH3A 4OPAA 1FRKA 1JXLA 1LFPA 3GR0A 2GVDA 3U1LA 3J7Z5 4H4KA 3ONQA 2YH1A 1R6YA 2WB1D 3Q2TC 2XULA 2CKWA 5H1SQ 1GK8A 1OS5A 4W5QA 1VHFA 3VGUA 2BBEA 4KHQA 4FLZA 2CNKB 4DCOB 3L2QA 3WQPA 2J0WA 2RRAA 3HT0A 4A8KA 4C8OA 2VD3A 5LMUJ 5DGBA 4DCPB 3DLBA 1VJWA 4TY8A 2MQ8A 4J9VA 5C7PA 3MEEB 2HQGA 2WVDA 4BG8A 1X4EA 2R9LA 2WCXA 1L3UA 4DB3A 1DQAA 2VQFF 4TKTA 2EFVA 3CFPA 5HANA 5DDPC 2GTDA 3OS1A 3R2CJ 3MEEA 2W2PP 4A8QA 2A41A 4FZYA 4A8FA 4YOYA 2HBZB 4OI1A 3QT6A 2QGFB 1K73O 4IYQA 3OTDA 2PFUA 3HULA 5HMYA 2R3VA 2PMHA 4JI8J 5JS2A 3A8KA 4HVJA 1OJ4A 1TL3A 2E2OA 1YJNS 1OYEA 3AVGA 1OYDA 2XMMA 3VWSA 4DV3K 3L09A 3EGNA 1VQLN 4O4GB 4YUDA 1DQ8A 3QSIA 1Z25A 4CGDA 5DLFA 2K7KA 1YIJN 3V9XA 1UVMA 2H5EA 3MWBA 1S99A 2X6NA 5AXMA 1LXNA 4ZP7A 4DPUA 3B82A 4GVMA 2JEFA 2QO3A 4X4OA 2D3OR 1XHXA 5F0XA 3R5AA 2NRTA 4GVLA 2MDAA 1NZ8A 3DCAA 2FTRA 4DF8A 4IR9A 1WG5A 1R6VA 4AE5A 2RNEA 1O1WA 3HHLA 3K0JA 2IJNA 2DR8A 4Y28C 5FJ4A 3DYAA 2VFUA 1NPRA 3GIIA 2BM0A 4YMEA 2IM1A 4QW8A 4F2RA 2VJUA 5AZIA 1FNMA 1X4DA 2J5AA 1YTYA 1RAHB 2VG7A 4FWOA 4FLXA 1WOOA 1WC6A 2H1YA 1SB6A 3MTKA 4M5NA 4QCLA 3NMUA 3OFGA 1FXLA 4XPCA 4ZPVR 2ADBA 5CE3A 3O9QA 3JSYA 4U8VA 4FW1A 3GP9A 1S79A 1R0AA 4M3YA 5FD1A 2UXDK 2XMWA 4CHPA 3M8QA 3HSJA 1L3VA 4GC6A 4PY5A 4LH5A 1U0HB 2UXBJ 4JI0J 2CQ0A 4NZ6A 5KQDA 4ECYA 3GSIA 1M1KT 3MN6A 3TAGA 3I0RB 3GMGA 1XI1A 2AP6A 4MDAA 3HX9A 4JV2A 2NLXA 2VBYA 4I6AA 3H8YA 4PWUA 5AZJB 3QGGA 3FBEA 1OKJA 1NK4A 3E2EA 1PO6A 2H48B 3M1FA 3Q8UA 1NKEA 1O13A 4NLUA 3CJCA 4OKKA 2LFVA 1IM4A 5BN8A 2HYIB 4LF9K 1P1TA 1QQOA 3OYMA 2VBXA 5M1OA 3HKWA 2B4VA 3NAHA 2V8GA 4UQGA 5E41A 2R7WA 1A5VA 3VGMA 4FJJA 4YNQA 4J90A 3QRPA 1GEHA 5CZVA 4ED6A 4DN9A 5HP1A 4JHDB 1YQHA 3U1NA 3A1YG 4NXMK 5IFMA 1B99A 2EK6A 2VV5A 2ZUGA 3DRSA 2KKHA 1NB2A 2QG9B 3HM9A 4CTAB 3KZBA 3HHEA 3W2VB 4KB7A 4KGMA 2IVOA 2OEMA 3J80U 1GXLA 3CJ5A 1MA9B 3EGZA 2HRTA 2BH1A 1Q82O 4RKUC 5KFKA 3OS0A 3PX4A 1N34F 4IO9L 3NXZA 4MK8A 4KHYA 4LSLB 3KKRA 2DGTA 5GMDA 1G7CB 4F2SA 1BWFO 3WXIA 4ZN1A 1PJ5A 4UOHA 4IDHA 1RA6A 1KRPA 2J0SD 1LAVA 2ZM6F 2QWNA 4KRWA 1P9QC 1Y0HA 1NGJA 3FZFA 4AT1B 4KH4A 2HHWA 1ESVA 1RTZA 1Z26A 4KYZA 4U7BA 4C11B 3SBGA 1TVRB 1BQMB 2C22A 3PHEA 3EZ5A 4DPOA 3DLKB 3GCXP 4NI2A 3PUFA 1AA1B 1QAIA 4HVZA 5GAEI 3O4QA 5E0OA 3I8BA 2J7WA 4OX9F 1CSJA 1GH8A 4A5BA 1JLCB 2UXCF 1K0VA 3R9LA 2PAVA 3RW6A 3EX7B 4AD6A 2VQFJ 3TA1A 1G3OA 5HBMA 1D9AA 2A3JA 3KK1A 1YJ9N 1MMNA 3T3FA 3UCUP 2UU9K 4BRFA 3FEXB 2E7VA 4WYBA 2FY8A 4B3MJ 1XIQA 3RJMB 2XSFA 3C19A 3CCJS 2EEYA 5J1EB 2QV6A 2EHGA 4QYZJ 4F7VA 4OPHA 3CCQS 3NMRA 2IVPA 5L9NA 1VIXA 3U7JA 4F4YA 3DOLA 2A6MA 3SQGA 1I94J 3OLAA 2V4JA 1AYEA 1B7YB 1P8ZA 3H6EA 1S0NA 5D77A 3DDIA 3DJCA 4ZCIA 1V5IB 4YOTA 1ZTWA 2HRYA 3QO9A