1SV0A

Crystal structure of yan-sam/mae-sam complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
77
structure length
77
Chain Sequence
LPPSLPSDPRLWSREDVLVFLRFCVREFDLPKLDFDLFQMNGKRLCLLTRADFGHRCPGAGDVLHNVLQMLIIESHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ets DNA-binding protein pokkuri
publication title Derepression by depolymerization; structural insights into the regulation of yan by mae.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 26
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1sv0A00
2D3DA 1PK1A 3BS5B 4IS7A 2F3NA 1UCVA 2ES6A 2KSOA 3BS5A 5J8YC 4NL9A 3SENA 4RQMA 2QARB 4RQNA 2EANA 2QARA 1SGGA 3SEIA 4MHVA 1OW5A 3K1RB 3BS7A 3HILA 4PZNA 1JI7A 2F44A 4NJ8A 1X66A 2E8OA 3TADC 1WWUA 2YTUA 1SXEA 1COKA 2L5YA 2E8PA 1LKYB 2ESEA 2E8NA 2KMDA 2DKXA 5JTIA 4PZOA 2QKQA 1LKYA 2KIVA 1SV4A 1RG6A 5KNIA 2D8CA 2LPEA 5JRTA 2KG5A 3BQ7A 5J8YA 2B6GA 2DL0A 1DXSA 2JV3A 3KKAC 1SV0C 2EAMA 3TACB 2EAPA 1PK1B 2Y9TA 3TADA 1F0MA 2QB0B 1WWVA 5L1MA 2FE9A 2EAOA 3IDWA 2KE7A 1SXDA 5F3XB 2QB0A 5JU5A 1OXJA 2K60A 2F8KA 1X40A 4NL9C 2DKZA 1B0XA 1V85A 1UQVA 1Z1VA 2QB1A 1V38A 2Y9UA 3H8MA 3KKAA 1SV0A 2LMRA 2GLEA 1X9XA 1KW4A 2K4PA 2E8MA 1PK3A 1B4FA 2KSOB
chains in the Genus database with same CATH superfamily
4GFJA 5C0YA 1J2MA 2OYYA 4Y2XA 1A6SA 3HW8A 4QW9A 1V9PA 4JV1A 4ECXA 4CF4A 4K4HA 3GZFA 1S0MA 3KHGA 2XC9A 3WKBA 5HR7A 3PSPA 2KJ9A 1TAMA 8ICWA 2ZJAA 4QWDA 2YMPA 4ECZA 3M8RA 2VJ4A 3T5KA 3L5KA 4KN4A 3RJKA 1TK0A 4C8OA 5EE0A 3TAPA 2R8HA 4ED3A 4BX9C 4JV2A 4P0PA 5ALFA 1N61A 4EENA 5ALYA 5KT5A 1ZOLA 3C28A 1NKEA 4B9LA 2ZIWB 1ZQZA 2P35A 2AJQA 5J2FA 2XCPA 4RU9A 2DUYA 2K4IA 5DG8A 3WKCA 2V4QA 2OM6A 4DWIA 5KG5A 2LPEA 2YMLA 2ODGA 4DQQA 1ZQTA 1L8OA 2G0AA 3NRWA 3QUBA 3TACB 2EAPA 7ICPA 5BPCA 4DEZA 1RYUA 2BCUA 5F3XB 4DSLA 1ZD4A 4MF8A 8ICIA 4BXOB 3OPXA 5L1LA 3TKAA 1IV8A 1Z1VA 4F72A 2DFLA 2R8JA 4QW8A 1BPBA 2E8MA 3RB4A 2FDRA 1QCKA 3BS5B 4E0DA 2JGAA 4ELTA 2ZTDA 5DBBA 2BCSA 5CA7A 2HOQA 3QUCA 4EBCA 7ICUA 1UA0A 1TK8A 8ICMA 3AU2A 2G5HB 4O5CA 4C8NA 2JHDA 5ALKA 2KJ8A 3GU3A 7ICRA 3UMBA 3H0LB 2O6KA 4IQTA 4YVZA 4PH5A 3C29A 4PZNA 3FC4A 5CJ7A 4DF8A 2IA6A 1UT8A 3M7DA 4M9GA 4PJ0U 2IHMA 2DQNB 1Z3EB 1XSNA 4P2HA 3F2BA 4C4TA 1TV9A 1ZQGA 5GTIU 3F5AA 1QQ7A 4KX5A 1ZQRA 4YG2A 5F9NA 4QZ8A 3GQCA 2R8IA 4BDPA 4PZOA 1ZQBA 1N62A 3NVZA 2W9MA 4ECVA 4M04A 3RH5A 2NV3A 5KFZA 2KG5A 5EWFA 5ALPA 2JR5A 3AQEA 4QWEA 3PVXA 4MFFA 7ICJA 2F76X 2PXIA 1TAUA 2XGPA 1ZQIA 4MFAA 3OSNA 1SXDA 3EPIA 2W43A 4DF4A 5KG1A 3Q8PB 1NI3A 2MUTB 9ICSA 4QZEA 1L5UA 1ZQVA 3D2NA 2Y1JA 4I2CA 4DQSA 5J0OA 4DLGA 1TVAA 4JWNA 4QZFA 5KFLA 3CNHA 1NK5A 1RPLA 1X9XA 5AKLA 1QSYA 4DFDA 5DQGA 4QWAA 2KV2A 1DK3A 2EZZA 2UVVA 2ALZA 2F77X 5KG0A 5L9XA 4GXKA 1NKBA 8ICKA 5J29A 2KIWA 3LK9A 4YD1A 3B9JA 2QARB 3RB3A 5IIKA 4EZ9A 1U4BA 3VC8A 2M0NA 3CP8A 1SGGA 3PSFA 4CGZA 5DQHA 2ASJA 5KFKA 2N1RA 4J9MA 3QEAZ 4OCZA 2R8GA 5HNKA 8ICSA 2BPGA 2JEGA 8ICQA 3PZPA 2YY6A 3PY8A 1BPZA 2K89A 3M9NB 1ZQSA 2RP5A 4NLBA 2YTUA 2J6UA 1SXEA 3S6JA 2G09A 3TFRA 2FPLA 4YN4A 4B9VA 1MN8A 5KG7A 1ZQFA 4O3OA 5J2DA 5KT3A 3T3FA 1SKRA 5JTIA 2OEHA 5KFEA 3ISCA 2B6GA 3RJGA 5KFNA 2KD1A 4R64A 1TK5A 1CUKA 5ALMA 1P7DA 4US8A 4RNOA 1D8BA 4ED6A 4KLGA 5KG3A 3JPOA 2F8KA 5EWGA 5HP4A 1T8EA 2HVIA 4TUSA 4RQ5A 3PMNA 4PL1A 5TZVA 2FMPA 4Y2JA 2C22A 4OJOA 2KHVA 3QU5A 3FM9A 4RZRA 3IG5A 1UCVA 1J97A 5AM1A 9ICLA 5DG9A 1J2NA 1WYGA 4DL6A 3QUTA 8ICRA 2HHUA 4XA5A 3TQ1A 4IQUA 3V6KA 9ICPA 2WF6A 4BWMA 3SV3A 4JMUA 5IIOA 5AM2A 4MHVA 2ZUDA 3BS7A 5DDYA 8ICGA 3QXGA 4YXMA 5KT6A 1LV5A 4MEYA 5J2JA 4C8MA 2FLLA 3H8SA 2F1IA 4ECSA 4M9HA 2AGQA 1X9WA 4O0IA 4Y2VA 2F1JA 4GXIA 4G9BA 2I1QA 5KFJA 4O3SA 5AK3A 4YR0A 3RBDA 2I5HA 4I2BA 3HKZF 2RDJA 5TISU 8ICBA 1EXNA 5ALSA 3PMLA 3KZIU 5EE3A 3LVWA 2KOBA 4DFMA 3PNCA 2ZJ5A 4OJ5A 2XCAA 2IOFA 2EAOA 4Y2QA 1QLNA 4IQVA 2G06A 1L8LA 5ALGA 4JK1A 4M0AA 4BJQA 4O3QA 3PSIA 4R66A 1L3TA 3H40A 4PGYA 5HHHA 4QZGA 1VJ5A 1LVHA 3GDXA 2LHTA 2CN1A 3OHBA 8ICNA 4YQWA 4I2EA 1AROP 3QU2A 3RF9A 3L3FX 8ICVA 3Q8QB 3PW7A 3HPOA 4PPXA 5ALLA 1KFSA 5KFTA 5ALHA 2LBOA 3AL0B 2OCEA 2W54A 3SMVA 1KFDA 7ICVA 3Q8RB 2ZIUB 3F5EA 1SKWA 4UBBA 1KL9A 4GIBA 2IMWP 3PV8A 3U26A 4IRKA 4F2SA 4DO9A 5CB1A 3ICXA 3SV4A 1CRXA 5AKKA 2G08A 2ZIVA 2W11A 5B66U 1FFUA 2F1HA 2JRZA 5EE9A 2B21A 2F8LA 3NUQA 5EE1A 3NVYA 1KQQA 4ECUA 5J0WA 3BZCA 4LZGA 2HHSA 1WCNA 3UPQA 2L5YA 2BDUA 5CRXA 1ZQJA 1L6NA 4C8LA 3A0HU 2BQ3A 4YMNA 3UQ2A 1Z4OA 4UB6U 3JPRA 1MSWD 1FIQA 4Z6DA 4EX7A 2CXYA 3PR4A 4Q8EA 4DL2A 4O3NA 5JRTA 3Q8MA 5J8YA 1Z00A 5KFCA 4O3PA 2HHWA 1C7YA 7ICNA 5DKWA 5AI8A 3SAGA 1XWLA 1CEZA 1NJZA 4RQ2A 2LI6A 2WB1C 1ZD2P 3MC1A 5D46A 3V6HA 3GIKA 1UQVA 2ZG6A 3Q8SB 2W8LA 5D4BA 3SQIA 3MR3A 4J03A 4M6WA 7ICKA 1RXWA 1GO3F 5ALZA 2FI1A 2PMZF 3H0RB 3VCBA 1U47A 1XNSA 2KK0A 4IS7A 4GXJA 5AI0A 5J0QA 1MQ2A 5DQIA 2MRLA 3NGDA 2J6SA 1HJPA 4UASA 4IR9A 1H38A 4R8UA 4YD2A 2VANA 3C1ZA 3D2QA 5IILA 2AGOA 1ZQAA 4QNLA 9ICHA 5D49A 3G6VA 3THVA 4RQ7A 2QLTA 1UA1A 1DK2A 1X6IA 4O3MA 4I28A 5J0TA 4FS2A 2F44A 1ZJNA 4UB1A 1Q3VA 3V6JA 2JH1A 4KN7A 4F5OA 2V4RA 3ED5A 2GH1A 5AM0A 3ZDDA 9ICWA 1COKA 4F92B 3GV8B 1D8YA 1XU4A 4P4OA 3KFUF 4F5QA 2A1AA 3QX7A 3CRXA 3C5FA 3K1ZA 5G5GA 2LM4A 2E1EA 5CHGA 3QU7A 5KFSA 3PO4A 1SV0C 3MBYA 4UATA 2HHVA 3OJUA 4TQRA 4KLDA 8ICUA 5IIJA 2KE7A 4P4MA 2MAXA 4QZBA 3HJEA 5KFRA 4NY8A 4J9KA 2K8CB 4NXZA 2HOFA 1NOMA 1B0XA 2ZUCA 2PFPA 3RH6A 4C4RA 4Y2RA 2WF5A 2GO7A 3RBEA 1NK8A 1NK9A 1XSPA 1RYRA 1L3SA 1N56A 4M9JA 2BCRA 3UXOA 3JPNA 1IG6A 5CEHA 2Q4TA 4DOBA 2K4PA 4ECWA 1XO1A 2HHTA 4DOCA 4B9NA 5DB7A 2D3DA 1SIJA 2F3NA 8ICTA 4US9A 1ZQMA 1Q46A 3SENA 3QU9A 4RQMA 2HBLA 4QIWF 5C5JA 4RNNA 7ICHA 1RQNA 4PL2A 2XY7A 2BKEA 8ICOA 4AYBC 1IIPA 3EPGA 5L1IA 5DGAA 2DGZA 1RYSA 4M9NA 4C0ZA 1T94A 2VA8A 4RUCA 1ZYQA 4B9UA 2HI0A 1ZQLA 4NM2A 5DDMA 1L3UA 4Q45A 5KG4A 3GV7B 3KHRA 1D9DA 4OJPA 5AKGA 5KT4A 9ICAA 8ICYA 4QZIA 2PFQA 3MR6A 2QKQA 1JXLA 1SV4A 3FYHA 4F71A 3RR8A 1KTQA 3BZKA 2D8CA 2H3VA 3Q8LA 3E2EA 3AM9A 5ALQA 4TUQA 1F0MA 2ZJ8A 1RQLA 5L1MA 4J9NA 3SR6A 4DFPA 4NLGA 2W04A 1VDVA 3I28A 5AM4A 4UAWA 5KG2A 4QZ9A 2BPFA 1ZQNA 2LKYA 5AIBA 4B6JA 3IN5A 4BXOA 2QB1A 4DSFA 2AQ4A 2AU0A 1SV0A 3O0FA 1K1QA 4ELVA 5DBAA 4I2GA 8ICAA 7ICSA 3AUOA 3WU2U 3BQ2A 2AGPA 2WHEA 2XVTA 4C4SA 1YT3A 2LYBA 3OTQA 5ALIA 2NO4A 2KHQA 4EX6A 3PO5A 3A0BU 3BS5A 1NZBA 4CRXA 2ISPA 1NJWA 1KDHA 1S97A 4DS5A 4FS1A 5ALEA 2EANA 1ZJMA 1SWWA 4F8RA 3OGUA 2HSZA 1WUDA 3DDHA 5KFDA 3WKEA 4BUGA 4QWBA 2JXJA 9ICNA 2H3IA 5AKIA 3GV5B 2ASLA 3IM1A 2FJ6A 4M9LA 1M6YA 4Y2UA 1WCLA 3AMZA 9ICIA 3ISBA 7ICGA 1WWUA 3AEVA 2KICA 5KFXA 1S10A 4I2IA 1LKYB 3T5HA 2WF9A 2FMQA 9ICVA 1MQ3A 5HHIA 2F2AB 2KIVA 3RJHA 1RG6A 3I1YA 4RQ3A 1JALA 3NASA 4EBEA 2BQRA 2XICA 2W3RA 2Y0SF 2FE9A 3IDWA 4O9MA 1SL0A 4KLIA 2K8BB 1SZHA 3V72A 4XUSA 4UB4A 5J2CA 3UXNA 2DKZA 3ETLA 3ZDBA 2R18A 4UB2A 2ZXHA 5HR6A 1ZQXA 2W9AA 1A76A 3H0MB 4J9PA 2HBMA 3WK4A 2ZUBA 2KKPA 2KNJA 4IL6U 2MSNA 4Q8FA 1NK0A 2PI4A 3OSPA 4XQ8A 4NV0A 5L1JA 9ICUA 2OWOA 4MF2A 5KL1B 3BQTA 3H4DA 4KLOA 3WK9A 2LYHA 3PSTA 3C1YA 4R63A 4ZOHC 3MGVA 9ICGA 2YMQA 4FFDA 2QARA 2VIXA 2BDPA 3T5JA 3LVVA 5AKYA 3SAHA 5AM3A 1JUDA 3CYMA 4RT2A 9ICJA 2BHNA 4OJLA 4NJ8A 2J6TA 1B22A 2M9NA 4O5EA 4J9LA 3SYZA 4YXJA 3M9MB 2UVUA 2E8PA 9ICTA 4KLTA 5KG6A 5DB8A 4CDGA 3UMCA 3NVWA 3ZDCA 2KVCA 3RB6A 1DRGA 5AKJA 2W9BB 3NRZA 1S0OA 2BGWA 4Y2SA 2OH2A 2NRWA 3KHHA 1U48A 4FBTA 1TFRA 1D9FA 4F4KA 1C20A 3ZD8A 5J0RA 4IRCA 2JV3A 3KKAC 1N2XA 2NO5A 2HHXA 5FP0A 4DSIA 1YZ6A 5J0UA 7ICEA 1T3NA 5AKZA 3RRGA 3C2LA 2ATLA 1L7OA 2XGQA 1X42A 2HMXA 2BR0A 5AK5A 5ALJA 3WK8A 3QZ7A 2BCQA 3GFKB 4CF3A 3N7SC 9ICMA 2JZBB 1XC9A 5ALDA 2ZIVB 1PUZA 3KBBA 3F53A 4F3OA 2ZXIA 4I2FA 1COOA 2KSOB 4UAZA 4PHEA 2IOFK 1QQ6A 5CR0A 3KZXA 2KJ5A 5AK6A 5AI5A 4CF5A 5KT2A 3IP4B 3K1RB 3RR7A 3EWAA 1Z19A 1KN5A 2MA1A 1Z00B 3SI8A 2YN4A 1F44A 3E0FA 5G5HA 2XY5A 1QTMA 5AK4A 4PHAA 3HKZC 4ELUA 3ZDAA 4UB3A 4UBCA 4KLMA 2ESEA 3K75D 4USAA 3N7PD 5JUMA 4K4GA 5IIMA 4DSJA 2P6UA 4IRDA 1JIHA 2E3TA 5ALXA 2W9CA 4P0QB 4MFCA 2DL0A 1DXSA 3MFIA 2EAMA 3F2DA 2QB0B 4YCXA 2VJ5A 4UARA 1KRPA 2E1FA 1NK6A 1NK7A 4R8UB 2JEIA 5AI9A 4TQSA 1DGJA 3LWLA 2ZIXA 1FO4A 4RQ0A 4FO6A 1ZD5A 3MR2A 1FEZA 4A8EA 5H2FU 1NZPA 2BZFA 3KKAA 4UAVA 4QWCA 1S9FA 4R65A 4BGDA 1RZTA 1L7NA 2RHFA 1PK1A 4ED0A 4M47A 1NJYA 2ES6A 3TANA 1B43A 2A1JA 4DLEA 4ACOA 5KFYA 1XSLA 2WAQF 2KTQA 1JRPA 8ICPA 1Z4NA 1L7PA 1UHUA 2V9WA 3N7RC 4P4PA 1ZQDA 3HT3A 3HRDD 3RTVA 4LZDA 1BPEA 2PFNA 4P0PB 3L4PA 4NLKA 7ICFA 4FBUA 1U45A 2P6RA 5AI6A 2LM1A 3ORYA 3TADC 4F4WA 1ZQQA 4RQ4A 4MEXA 2FMSA 2A19A 1N48A 4O5KA 5AKHA 2BQUA 3HWTA 2UVWA 2KMDA 5J2BA 1JXEA 1VLBA 9ICXA 3UQ0A 4PHPA 4RUAA 2W3SA 1CI4A 2W7OA 4DFKA 3UM9A 4UAYA 3HX0A 3RRHA 3ZD9A 5KTQA 5AKEA 4FZNA 2KZMA 1U9LA 2CRXA 1XS9D 3CW2C 2UVRA 2PI5A 3ZDEA 4GC7A 4NL9C 3TI0A 3F2CA 2HHQA 1S8OA 4JUZA 3RJIA 8ICZA 5J0YA 2PMZC 1ZQ1C 4BWJA 4KITB 4TURA 1PK3A 2BPCA 4KLJA 5J2HA 9ICKA 3Q8KA 4IC9A 4AYBF 5KAIU 2JEJA 4QZHA 9ICEA 4ECYA 5DB9A 4UB5A 3PW5A 2RLTA 3MABA 3JPPA 2DF4B 2HW3A 3WKAA 3AU6A 4F5RA 4KMOB 2EZYA 1OUQA 1KLNA 4Y2YA 3QUQA 3HILA 2EDUA 2FLNA 4Y2PA 1RXVA 3M8SA 2EQYA 5BOLA 4ED2A 1BNOA 4AP9A 3NVVA 1JN3A 4ED7A 1ZQUA 3C23A 2RDIA 5A0LA 4UW9A 3IRUA 3H8JA 5KFGA 4PHDA 5L1KA 5ALNA 4ECRA 2E8NA 3BQ0A 8ICXA 5B5EU 4DSEA 4EEYA 4C7ZA 3ETRA 5IINA 2OXOA 3PW4A 5KNIA 1KKXA 2KKVA 1ZQOA 4KLEA 1URJA 3MDCA 2NRZA 3DV9A 2ASDA 3HP6A 2Y9TA 3TADA 4I29A 3IV6A 5KT7A 4EELA 1S0VA 4I2JA 5ALOA 2ZIWA 3QE9Y 1S76D 3MFHA 4KLUA 5EOZA 3R9KA 3QYPA 4QZCA 5KFVA 1L7MA 1X6JA 3PW0A 4F4XA 4J9SA 2JMGA 2Y9UA 5GTHU 5AI4A 4Q43A 1SZPA 2I6XA 2YMMA 5J2IA 2GOLA 1BPYA 1ZETA 1B4FA 3QEBZ 1DGSA 3J81j 2IBKA 4DSKA 1NK4A 4OO1J 1ZRMA 7ICMA 4QIWC 1NNLA 3WKDA 4GLXA 4KLLA 2AXTU 2KVSA 1S0NA 2XO7A 4NL9A 4J9RA 2LYAA 4QZAA 3B0XA 3JPTA 4J9OA 3TARA 1O08A 2YB4A 2H3ZA 7ICQA 3GIIA 4NLZA 2C2RA 4UQGA 3ONNA 1YZ7A 2A3VA 1OW5A 2JEFA 4U7CA 3AN1A 3GILA 5AM5A 4JWMA 5KFMA 4DL5A 4OJ6A 5KFPA 4F4ZA 5AIAA 4QJFB 3UMGA 4DQPA 1WG8A 4KLFA 1SWVA 2DBYA 3NTUA 1S5LU 2G5IB 1X66A 4DL3A 3G6YA 7ICOA 1BGXT 3EYZA 3PX4A 2WFAA 3EUB2 1MC8A 5ALTA 4B9MA 4KX3A 3FDSA 4ECQA 1IXRA 3SZ2A 8ICJA 1SL2A 1ZQWA 1T3QA 1HUOA 9ICQA 1UT5A 2FPKA 3MGIA 5HMMA 1Q3UA 5DLFA 1SB3C 3JPQA 1MA7A 1TE2A 7ICLA 1N5WA 4F50A 1PVQA 2KN7A 4GC6A 4C80A 1X9MA 3GIJA 2B0CA 2W55A 9ICFA 4X5VA 3G6XA 1KSPA 2K60A 2WF7A 1A77A 5DG7A 2AH5A 3MGHA 1KFTA 3RAQA 3BDPA 5KFQA 2PFOA 5KFHA 2HBKA 4NWIA 5CP2A 1V38A 4F5PA 4F91B 1S77D 1AQ6A 4DCCA 1T4GA 3H8MA 1ECWA 2GLEA 3AQFA 3K4GA 4Q44A 2I9GA 4IQWA 4HAIA 3T5LA 5J2EA 4JB3A 4OD0A 2AHOB 3BQ1A 3IHQB 2PKEA 5ALVA 1BPXA 8ICEA 3NS1A 5J0SA 1A0PA 4RQ1A 5EWEA 1FFVA 3KHLA 2XIDA 2Z7JA 5KFFA 5J0XA 5J2GA 4Z6CA 2MUTA 5DLGA 2HCFA 4RQNA 4TUPA 1F5SA 2P66A 1PZNA 3MDAA 3RAXA 5AHXA 2VA2A 3SEIA 2FPMA 9ICOA 4XRHA 3M6ZA 5HMLA 2WF8A 4ZH4A 1JI7A 4YFKA 4Z6EA 3BJYA 4DQIA 1KBUA 5KFOA 5F9LA 4IR1A 7ICIA 1TKDA 4FZMA 5KFIA 2AQ0A 3T79A 4F5NA 3ALRA 3PW2A 1HEKA 5KFUA 1RDFA 1N5XA 1T7PA 2Q0ZX 2IOHA 2NRTA 2NRVA 1O03A 1L3VA 1LKYA 1N60A 4O3RA 2JH7A 2Y0SC 5ALRA 4FZLA 3M9OB 2CPRA 3KOOA 2K4EA 4YMMA 4KLQA 3JPSA 1ZXIA 5CWRA 2XY6A 5DGBA 1NJXA 4I27A 2YB1A 3OHAA 4F2RA 4RQ8A 2MU2A 3FAHA 5KFAA 2FLPA 1JMSA 2W8KA 4EBDA 1K5OA 1ZQCA 4LVSA 1X40A 2ISOA 5KFBA 2DPJA 4UB8U 1QSSA 1Y88A 3IG8A 4C7YA 1HUZA 4PGXA 4F93B 2G07A 3C2KA 1V97A 3V7LA 4RT3A 3ISDA 4B9SA 3ZI4A 2H3FA 3B0YA 3RJFA 4UAUA 3DEEA 2Y1IA 1U49A 4HYKA 5AICA 5E79U 4EEKA 2NRXA 1IM4A 5J8YC 4ED1A 1TAQA 1PVRA 3M6KA 1ZQPA 4QZDA 4RNMA 3QNMA 4DS4A 2KP7A 3LDAA 2W03A 4I2AA 2HVHA 2GWSA 2W9CB 4I2DA 2ZTCA 2HBJA 9ICRA 7ICTA 3N97B 1ED1A 2RQ5A 2DWQA 3H8WA 1ZD3A 4YR3A 3TAQA 1N63A 1RM6C 4YR2A 2BCVA 3V7JA 3N28A 3RFAA 1SL1A 4B9TA 8ICCA 4KMUA 3D2SA 2DKXA 2ZIXB 2H5XA 1ZQKA 2DPIA 1PVPA 1ZQYA 1ZRNA 4LJXA 5ALWA 5KAFU 4M2YA 3KTQA 3BQ7A 2W9BA 2OHFA 1XO0A 4RPYA 1ZQEA 3LYSA 8ICFA 1PK1B 4WJ3B 5J2AA 4K4IA 2A1JB 3N4MB 3OJSA 2XI9A 3V7KA 4CCHA 4C8KA 4KLHA 3C5GA 3SAFA 2KFZA 4J9QA 4ECTA 1X2IA 4M6WB 4Z6FA 1KEJA 1V85A 2C2EA 2YX8A 9ICCA 5IIIA 3PX0A 2WB1F 4ICAA 5K4LA 1QSLA 9ICBA 1KW4A 3PR5B 2K8AA 4NLCA 1JX4A 8ICHA 2JZBA 3H7IA 3RH4A 4FE3A 3UXPA 2IHNA 3E58A 3PX6A 2KSOA 2W7PA 4EYIB 4G3IA 5BOMA 2VA3A 4RPZA 4I2HA 1NKCA 3LWMA 2EH9A 4YP3A 4Y2TA 2D6FC 4YMOA 4DL7A 3TFSA 4ED8A 4KTQA 3I76A 1D8LA 1JROA 4NLNA 1UPHA 3GIMA 4EZ6A 5J2KA 2HOIA 2EZXA 3RJJA 1K1SA 4RQ6A 4KLSA 3WK5A 2KZZA 5T14A 2ZTEA 1BPDA 1HIWA 2C2DA 3RB0A 4CNQA 4CE6A 2E5SA 3WK6A 5DBCA 4EYHB 3KD3A 2E8OA 5ALUA 1ZQHA 1Z1BA 3M1YA 1QQ5A 1Q8KA 4PGQA 2ZIUA 3EW9A 5J0PA 4DOAA 2R8KA 2K4HA 4JV0A 2WTFA 1X9SA 2HDOA 3RJEA 1BNPA 3QZ8A 2VKQA 3H4BA 5KL8B 2KEYA 1LB2B 4DFJA 3WK7A 1SKSA 2NYVA 2H3QA 2KFNA 4P0QA 4NM1A 2C28A 4U6PA 1WWVA 4DQRA 2YQEA 1DOQA 1QH9A 3D6JA 2QB0A 5JU5A 1OXJA 3C21A 2RRDA 3SD7A 8ICLA 5AKXA 5KFWA 5DB6A 1BVSA 3EZ5A 4F4YA 3QU4A 2KZ3A 2LMRA 3MR5A 4DL4A 3C2MA 4RPXA 2WAQC
chains in the Genus database with same CATH topology
2D3DA 1PK1A 3BS5B 4IS7A 2F3NA 1UCVA 2ES6A 2KSOA 3BS5A 5J8YC 4NL9A 3SENA 4RQMA 2QARB 4RQNA 2EANA 2QARA 1SGGA 3SEIA 4MHVA 1OW5A 3K1RB 3BS7A 3HILA 4PZNA 1JI7A 2F44A 4NJ8A 1X66A 2E8OA 3TADC 1WWUA 2YTUA 1SXEA 1COKA 2L5YA 2E8PA 1LKYB 2ESEA 2E8NA 2KMDA 2DKXA 5JTIA 4PZOA 2QKQA 1LKYA 2KIVA 1SV4A 1RG6A 5KNIA 2D8CA 2LPEA 5JRTA 2KG5A 3BQ7A 5J8YA 2B6GA 2DL0A 1DXSA 2JV3A 3KKAC 1SV0C 2EAMA 3TACB 2EAPA 1PK1B 2Y9TA 3TADA 1F0MA 2QB0B 1WWVA 5L1MA 2FE9A 2EAOA 3IDWA 2KE7A 1SXDA 5F3XB 2QB0A 5JU5A 1OXJA 2K60A 2F8KA 1X40A 4NL9C 2DKZA 1B0XA 1V85A 1UQVA 1Z1VA 2QB1A 1V38A 2Y9UA 3H8MA 3KKAA 1SV0A 2LMRA 2GLEA 1X9XA 1KW4A 2K4PA 2E8MA 1PK3A 1B4FA 2KSOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D3D A;  1PK1 A;  3BS5 B;  4IS7 A;  2F3N A;  1UCV A;  2ES6 A;  2KSO A;  3BS5 A;  5J8Y C;  4NL9 A;  3SEN A;  4RQM A;  2QAR B;  4RQN A;  2EAN A;  2QAR A;  1SGG A;  3SEI A;  4MHV A;  1OW5 A;  3K1R B;  3BS7 A;  3HIL A;  4PZN A;  1JI7 A;  2F44 A;  4NJ8 A;  1X66 A;  2E8O A;  3TAD C;  1WWU A;  2YTU A;  1SXE A;  1COK A;  2L5Y A;  2E8P A;  1LKY B;  2ESE A;  2E8N A;  2KMD A;  2DKX A;  5JTI A;  4PZO A;  2QKQ A;  1LKY A;  2KIV A;  1SV4 A;  1RG6 A;  5KNI A;  2D8C A;  2LPE A;  5JRT A;  2KG5 A;  3BQ7 A;  5J8Y A;  2B6G A;  2DL0 A;  1DXS A;  2JV3 A;  3KKA C;  1SV0 C;  2EAM A;  3TAC B;  2EAP A;  1PK1 B;  2Y9T A;  3TAD A;  1F0M A;  2QB0 B;  1WWV A;  5L1M A;  2FE9 A;  2EAO A;  3IDW A;  2KE7 A;  1SXD A;  5F3X B;  2QB0 A;  5JU5 A;  1OXJ A;  2K60 A;  2F8K A;  1X40 A;  4NL9 C;  2DKZ A;  1B0X A;  1V85 A;  1UQV A;  1Z1V A;  2QB1 A;  1V38 A;  2Y9U A;  3H8M A;  3KKA A;  1SV0 A;  2LMR A;  2GLE A;  1X9X A;  1KW4 A;  2K4P A;  2E8M A;  1PK3 A;  1B4F A;  2KSO B; 
#chains in the Genus database with same CATH topology
 4GFJ A;  5C0Y A;  1J2M A;  2OYY A;  4Y2X A;  1A6S A;  3HW8 A;  4QW9 A;  1V9P A;  4JV1 A;  4ECX A;  4CF4 A;  4K4H A;  3GZF A;  1S0M A;  3KHG A;  2XC9 A;  3WKB A;  5HR7 A;  3PSP A;  2KJ9 A;  1TAM A;  8ICW A;  2ZJA A;  4QWD A;  2YMP A;  4ECZ A;  3M8R A;  2VJ4 A;  3T5K A;  3L5K A;  4KN4 A;  3RJK A;  1TK0 A;  4C8O A;  5EE0 A;  3TAP A;  2R8H A;  4ED3 A;  4BX9 C;  4JV2 A;  4P0P A;  5ALF A;  1N61 A;  4EEN A;  5ALY A;  5KT5 A;  1ZOL A;  3C28 A;  1NKE A;  4B9L A;  2ZIW B;  1ZQZ A;  2P35 A;  2AJQ A;  5J2F A;  2XCP A;  4RU9 A;  2DUY A;  2K4I A;  5DG8 A;  3WKC A;  2V4Q A;  2OM6 A;  4DWI A;  5KG5 A;  2LPE A;  2YML A;  2ODG A;  4DQQ A;  1ZQT A;  1L8O A;  2G0A A;  3NRW A;  3QUB A;  3TAC B;  2EAP A;  7ICP A;  5BPC A;  4DEZ A;  1RYU A;  2BCU A;  5F3X B;  4DSL A;  1ZD4 A;  4MF8 A;  8ICI A;  4BXO B;  3OPX A;  5L1L A;  3TKA A;  1IV8 A;  1Z1V A;  4F72 A;  2DFL A;  2R8J A;  4QW8 A;  1BPB A;  2E8M A;  3RB4 A;  2FDR A;  1QCK A;  3BS5 B;  4E0D A;  2JGA A;  4ELT A;  2ZTD A;  5DBB A;  2BCS A;  5CA7 A;  2HOQ A;  3QUC A;  4EBC A;  7ICU A;  1UA0 A;  1TK8 A;  8ICM A;  3AU2 A;  2G5H B;  4O5C A;  4C8N A;  2JHD A;  5ALK A;  2KJ8 A;  3GU3 A;  7ICR A;  3UMB A;  3H0L B;  2O6K A;  4IQT A;  4YVZ A;  4PH5 A;  3C29 A;  4PZN A;  3FC4 A;  5CJ7 A;  4DF8 A;  2IA6 A;  1UT8 A;  3M7D A;  4M9G A;  4PJ0 U;  2IHM A;  2DQN B;  1Z3E B;  1XSN A;  4P2H A;  3F2B A;  4C4T A;  1TV9 A;  1ZQG A;  5GTI U;  3F5A A;  1QQ7 A;  4KX5 A;  1ZQR A;  4YG2 A;  5F9N A;  4QZ8 A;  3GQC A;  2R8I A;  4BDP A;  4PZO A;  1ZQB A;  1N62 A;  3NVZ A;  2W9M A;  4ECV A;  4M04 A;  3RH5 A;  2NV3 A;  5KFZ A;  2KG5 A;  5EWF A;  5ALP A;  2JR5 A;  3AQE A;  4QWE A;  3PVX A;  4MFF A;  7ICJ A;  2F76 X;  2PXI A;  1TAU A;  2XGP A;  1ZQI A;  4MFA A;  3OSN A;  1SXD A;  3EPI A;  2W43 A;  4DF4 A;  5KG1 A;  3Q8P B;  1NI3 A;  2MUT B;  9ICS A;  4QZE A;  1L5U A;  1ZQV A;  3D2N A;  2Y1J A;  4I2C A;  4DQS A;  5J0O A;  4DLG A;  1TVA A;  4JWN A;  4QZF A;  5KFL A;  3CNH A;  1NK5 A;  1RPL A;  1X9X A;  5AKL A;  1QSY A;  4DFD A;  5DQG A;  4QWA A;  2KV2 A;  1DK3 A;  2EZZ A;  2UVV A;  2ALZ A;  2F77 X;  5KG0 A;  5L9X A;  4GXK A;  1NKB A;  8ICK A;  5J29 A;  2KIW A;  3LK9 A;  4YD1 A;  3B9J A;  2QAR B;  3RB3 A;  5IIK A;  4EZ9 A;  1U4B A;  3VC8 A;  2M0N A;  3CP8 A;  1SGG A;  3PSF A;  4CGZ A;  5DQH A;  2ASJ A;  5KFK A;  2N1R A;  4J9M A;  3QEA Z;  4OCZ A;  2R8G A;  5HNK A;  8ICS A;  2BPG A;  2JEG A;  8ICQ A;  3PZP A;  2YY6 A;  3PY8 A;  1BPZ A;  2K89 A;  3M9N B;  1ZQS A;  2RP5 A;  4NLB A;  2YTU A;  2J6U A;  1SXE A;  3S6J A;  2G09 A;  3TFR A;  2FPL A;  4YN4 A;  4B9V A;  1MN8 A;  5KG7 A;  1ZQF A;  4O3O A;  5J2D A;  5KT3 A;  3T3F A;  1SKR A;  5JTI A;  2OEH A;  5KFE A;  3ISC A;  2B6G A;  3RJG A;  5KFN A;  2KD1 A;  4R64 A;  1TK5 A;  1CUK A;  5ALM A;  1P7D A;  4US8 A;  4RNO A;  1D8B A;  4ED6 A;  4KLG A;  5KG3 A;  3JPO A;  2F8K A;  5EWG A;  5HP4 A;  1T8E A;  2HVI A;  4TUS A;  4RQ5 A;  3PMN A;  4PL1 A;  5TZV A;  2FMP A;  4Y2J A;  2C22 A;  4OJO A;  2KHV A;  3QU5 A;  3FM9 A;  4RZR A;  3IG5 A;  1UCV A;  1J97 A;  5AM1 A;  9ICL A;  5DG9 A;  1J2N A;  1WYG A;  4DL6 A;  3QUT A;  8ICR A;  2HHU A;  4XA5 A;  3TQ1 A;  4IQU A;  3V6K A;  9ICP A;  2WF6 A;  4BWM A;  3SV3 A;  4JMU A;  5IIO A;  5AM2 A;  4MHV A;  2ZUD A;  3BS7 A;  5DDY A;  8ICG A;  3QXG A;  4YXM A;  5KT6 A;  1LV5 A;  4MEY A;  5J2J A;  4C8M A;  2FLL A;  3H8S A;  2F1I A;  4ECS A;  4M9H A;  2AGQ A;  1X9W A;  4O0I A;  4Y2V A;  2F1J A;  4GXI A;  4G9B A;  2I1Q A;  5KFJ A;  4O3S A;  5AK3 A;  4YR0 A;  3RBD A;  2I5H A;  4I2B A;  3HKZ F;  2RDJ A;  5TIS U;  8ICB A;  1EXN A;  5ALS A;  3PML A;  3KZI U;  5EE3 A;  3LVW A;  2KOB A;  4DFM A;  3PNC A;  2ZJ5 A;  4OJ5 A;  2XCA A;  2IOF A;  2EAO A;  4Y2Q A;  1QLN A;  4IQV A;  2G06 A;  1L8L A;  5ALG A;  4JK1 A;  4M0A A;  4BJQ A;  4O3Q A;  3PSI A;  4R66 A;  1L3T A;  3H40 A;  4PGY A;  5HHH A;  4QZG A;  1VJ5 A;  1LVH A;  3GDX A;  2LHT A;  2CN1 A;  3OHB A;  8ICN A;  4YQW A;  4I2E A;  1ARO P;  3QU2 A;  3RF9 A;  3L3F X;  8ICV A;  3Q8Q B;  3PW7 A;  3HPO A;  4PPX A;  5ALL A;  1KFS A;  5KFT A;  5ALH A;  2LBO A;  3AL0 B;  2OCE A;  2W54 A;  3SMV A;  1KFD A;  7ICV A;  3Q8R B;  2ZIU B;  3F5E A;  1SKW A;  4UBB A;  1KL9 A;  4GIB A;  2IMW P;  3PV8 A;  3U26 A;  4IRK A;  4F2S A;  4DO9 A;  5CB1 A;  3ICX A;  3SV4 A;  1CRX A;  5AKK A;  2G08 A;  2ZIV A;  2W11 A;  5B66 U;  1FFU A;  2F1H A;  2JRZ A;  5EE9 A;  2B21 A;  2F8L A;  3NUQ A;  5EE1 A;  3NVY A;  1KQQ A;  4ECU A;  5J0W A;  3BZC A;  4LZG A;  2HHS A;  1WCN A;  3UPQ A;  2L5Y A;  2BDU A;  5CRX A;  1ZQJ A;  1L6N A;  4C8L A;  3A0H U;  2BQ3 A;  4YMN A;  3UQ2 A;  1Z4O A;  4UB6 U;  3JPR A;  1MSW D;  1FIQ A;  4Z6D A;  4EX7 A;  2CXY A;  3PR4 A;  4Q8E A;  4DL2 A;  4O3N A;  5JRT A;  3Q8M A;  5J8Y A;  1Z00 A;  5KFC A;  4O3P A;  2HHW A;  1C7Y A;  7ICN A;  5DKW A;  5AI8 A;  3SAG A;  1XWL A;  1CEZ A;  1NJZ A;  4RQ2 A;  2LI6 A;  2WB1 C;  1ZD2 P;  3MC1 A;  5D46 A;  3V6H A;  3GIK A;  1UQV A;  2ZG6 A;  3Q8S B;  2W8L A;  5D4B A;  3SQI A;  3MR3 A;  4J03 A;  4M6W A;  7ICK A;  1RXW A;  1GO3 F;  5ALZ A;  2FI1 A;  2PMZ F;  3H0R B;  3VCB A;  1U47 A;  1XNS A;  2KK0 A;  4IS7 A;  4GXJ A;  5AI0 A;  5J0Q A;  1MQ2 A;  5DQI A;  2MRL A;  3NGD A;  2J6S A;  1HJP A;  4UAS A;  4IR9 A;  1H38 A;  4R8U A;  4YD2 A;  2VAN A;  3C1Z A;  3D2Q A;  5IIL A;  2AGO A;  1ZQA A;  4QNL A;  9ICH A;  5D49 A;  3G6V A;  3THV A;  4RQ7 A;  2QLT A;  1UA1 A;  1DK2 A;  1X6I A;  4O3M A;  4I28 A;  5J0T A;  4FS2 A;  2F44 A;  1ZJN A;  4UB1 A;  1Q3V A;  3V6J A;  2JH1 A;  4KN7 A;  4F5O A;  2V4R A;  3ED5 A;  2GH1 A;  5AM0 A;  3ZDD A;  9ICW A;  1COK A;  4F92 B;  3GV8 B;  1D8Y A;  1XU4 A;  4P4O A;  3KFU F;  4F5Q A;  2A1A A;  3QX7 A;  3CRX A;  3C5F A;  3K1Z A;  5G5G A;  2LM4 A;  2E1E A;  5CHG A;  3QU7 A;  5KFS A;  3PO4 A;  1SV0 C;  3MBY A;  4UAT A;  2HHV A;  3OJU A;  4TQR A;  4KLD A;  8ICU A;  5IIJ A;  2KE7 A;  4P4M A;  2MAX A;  4QZB A;  3HJE A;  5KFR A;  4NY8 A;  4J9K A;  2K8C B;  4NXZ A;  2HOF A;  1NOM A;  1B0X A;  2ZUC A;  2PFP A;  3RH6 A;  4C4R A;  4Y2R A;  2WF5 A;  2GO7 A;  3RBE A;  1NK8 A;  1NK9 A;  1XSP A;  1RYR A;  1L3S A;  1N56 A;  4M9J A;  2BCR A;  3UXO A;  3JPN A;  1IG6 A;  5CEH A;  2Q4T A;  4DOB A;  2K4P A;  4ECW A;  1XO1 A;  2HHT A;  4DOC A;  4B9N A;  5DB7 A;  2D3D A;  1SIJ A;  2F3N A;  8ICT A;  4US9 A;  1ZQM A;  1Q46 A;  3SEN A;  3QU9 A;  4RQM A;  2HBL A;  4QIW F;  5C5J A;  4RNN A;  7ICH A;  1RQN A;  4PL2 A;  2XY7 A;  2BKE A;  8ICO A;  4AYB C;  1IIP A;  3EPG A;  5L1I A;  5DGA A;  2DGZ A;  1RYS A;  4M9N A;  4C0Z A;  1T94 A;  2VA8 A;  4RUC A;  1ZYQ A;  4B9U A;  2HI0 A;  1ZQL A;  4NM2 A;  5DDM A;  1L3U A;  4Q45 A;  5KG4 A;  3GV7 B;  3KHR A;  1D9D A;  4OJP A;  5AKG A;  5KT4 A;  9ICA A;  8ICY A;  4QZI A;  2PFQ A;  3MR6 A;  2QKQ A;  1JXL A;  1SV4 A;  3FYH A;  4F71 A;  3RR8 A;  1KTQ A;  3BZK A;  2D8C A;  2H3V A;  3Q8L A;  3E2E A;  3AM9 A;  5ALQ A;  4TUQ A;  1F0M A;  2ZJ8 A;  1RQL A;  5L1M A;  4J9N A;  3SR6 A;  4DFP A;  4NLG A;  2W04 A;  1VDV A;  3I28 A;  5AM4 A;  4UAW A;  5KG2 A;  4QZ9 A;  2BPF A;  1ZQN A;  2LKY A;  5AIB A;  4B6J A;  3IN5 A;  4BXO A;  2QB1 A;  4DSF A;  2AQ4 A;  2AU0 A;  1SV0 A;  3O0F A;  1K1Q A;  4ELV A;  5DBA A;  4I2G A;  8ICA A;  7ICS A;  3AUO A;  3WU2 U;  3BQ2 A;  2AGP A;  2WHE A;  2XVT A;  4C4S A;  1YT3 A;  2LYB A;  3OTQ A;  5ALI A;  2NO4 A;  2KHQ A;  4EX6 A;  3PO5 A;  3A0B U;  3BS5 A;  1NZB A;  4CRX A;  2ISP A;  1NJW A;  1KDH A;  1S97 A;  4DS5 A;  4FS1 A;  5ALE A;  2EAN A;  1ZJM A;  1SWW A;  4F8R A;  3OGU A;  2HSZ A;  1WUD A;  3DDH A;  5KFD A;  3WKE A;  4BUG A;  4QWB A;  2JXJ A;  9ICN A;  2H3I A;  5AKI A;  3GV5 B;  2ASL A;  3IM1 A;  2FJ6 A;  4M9L A;  1M6Y A;  4Y2U A;  1WCL A;  3AMZ A;  9ICI A;  3ISB A;  7ICG A;  1WWU A;  3AEV A;  2KIC A;  5KFX A;  1S10 A;  4I2I A;  1LKY B;  3T5H A;  2WF9 A;  2FMQ A;  9ICV A;  1MQ3 A;  5HHI A;  2F2A B;  2KIV A;  3RJH A;  1RG6 A;  3I1Y A;  4RQ3 A;  1JAL A;  3NAS A;  4EBE A;  2BQR A;  2XIC A;  2W3R A;  2Y0S F;  2FE9 A;  3IDW A;  4O9M A;  1SL0 A;  4KLI A;  2K8B B;  1SZH A;  3V72 A;  4XUS A;  4UB4 A;  5J2C A;  3UXN A;  2DKZ A;  3ETL A;  3ZDB A;  2R18 A;  4UB2 A;  2ZXH A;  5HR6 A;  1ZQX A;  2W9A A;  1A76 A;  3H0M B;  4J9P A;  2HBM A;  3WK4 A;  2ZUB A;  2KKP A;  2KNJ A;  4IL6 U;  2MSN A;  4Q8F A;  1NK0 A;  2PI4 A;  3OSP A;  4XQ8 A;  4NV0 A;  5L1J A;  9ICU A;  2OWO A;  4MF2 A;  5KL1 B;  3BQT A;  3H4D A;  4KLO A;  3WK9 A;  2LYH A;  3PST A;  3C1Y A;  4R63 A;  4ZOH C;  3MGV A;  9ICG A;  2YMQ A;  4FFD A;  2QAR A;  2VIX A;  2BDP A;  3T5J A;  3LVV A;  5AKY A;  3SAH A;  5AM3 A;  1JUD A;  3CYM A;  4RT2 A;  9ICJ A;  2BHN A;  4OJL A;  4NJ8 A;  2J6T A;  1B22 A;  2M9N A;  4O5E A;  4J9L A;  3SYZ A;  4YXJ A;  3M9M B;  2UVU A;  2E8P A;  9ICT A;  4KLT A;  5KG6 A;  5DB8 A;  4CDG A;  3UMC A;  3NVW A;  3ZDC A;  2KVC A;  3RB6 A;  1DRG A;  5AKJ A;  2W9B B;  3NRZ A;  1S0O A;  2BGW A;  4Y2S A;  2OH2 A;  2NRW A;  3KHH A;  1U48 A;  4FBT A;  1TFR A;  1D9F A;  4F4K A;  1C20 A;  3ZD8 A;  5J0R A;  4IRC A;  2JV3 A;  3KKA C;  1N2X A;  2NO5 A;  2HHX A;  5FP0 A;  4DSI A;  1YZ6 A;  5J0U A;  7ICE A;  1T3N A;  5AKZ A;  3RRG A;  3C2L A;  2ATL A;  1L7O A;  2XGQ A;  1X42 A;  2HMX A;  2BR0 A;  5AK5 A;  5ALJ A;  3WK8 A;  3QZ7 A;  2BCQ A;  3GFK B;  4CF3 A;  3N7S C;  9ICM A;  2JZB B;  1XC9 A;  5ALD A;  2ZIV B;  1PUZ A;  3KBB A;  3F53 A;  4F3O A;  2ZXI A;  4I2F A;  1COO A;  2KSO B;  4UAZ A;  4PHE A;  2IOF K;  1QQ6 A;  5CR0 A;  3KZX A;  2KJ5 A;  5AK6 A;  5AI5 A;  4CF5 A;  5KT2 A;  3IP4 B;  3K1R B;  3RR7 A;  3EWA A;  1Z19 A;  1KN5 A;  2MA1 A;  1Z00 B;  3SI8 A;  2YN4 A;  1F44 A;  3E0F A;  5G5H A;  2XY5 A;  1QTM A;  5AK4 A;  4PHA A;  3HKZ C;  4ELU A;  3ZDA A;  4UB3 A;  4UBC A;  4KLM A;  2ESE A;  3K75 D;  4USA A;  3N7P D;  5JUM A;  4K4G A;  5IIM A;  4DSJ A;  2P6U A;  4IRD A;  1JIH A;  2E3T A;  5ALX A;  2W9C A;  4P0Q B;  4MFC A;  2DL0 A;  1DXS A;  3MFI A;  2EAM A;  3F2D A;  2QB0 B;  4YCX A;  2VJ5 A;  4UAR A;  1KRP A;  2E1F A;  1NK6 A;  1NK7 A;  4R8U B;  2JEI A;  5AI9 A;  4TQS A;  1DGJ A;  3LWL A;  2ZIX A;  1FO4 A;  4RQ0 A;  4FO6 A;  1ZD5 A;  3MR2 A;  1FEZ A;  4A8E A;  5H2F U;  1NZP A;  2BZF A;  3KKA A;  4UAV A;  4QWC A;  1S9F A;  4R65 A;  4BGD A;  1RZT A;  1L7N A;  2RHF A;  1PK1 A;  4ED0 A;  4M47 A;  1NJY A;  2ES6 A;  3TAN A;  1B43 A;  2A1J A;  4DLE A;  4ACO A;  5KFY A;  1XSL A;  2WAQ F;  2KTQ A;  1JRP A;  8ICP A;  1Z4N A;  1L7P A;  1UHU A;  2V9W A;  3N7R C;  4P4P A;  1ZQD A;  3HT3 A;  3HRD D;  3RTV A;  4LZD A;  1BPE A;  2PFN A;  4P0P B;  3L4P A;  4NLK A;  7ICF A;  4FBU A;  1U45 A;  2P6R A;  5AI6 A;  2LM1 A;  3ORY A;  3TAD C;  4F4W A;  1ZQQ A;  4RQ4 A;  4MEX A;  2FMS A;  2A19 A;  1N48 A;  4O5K A;  5AKH A;  2BQU A;  3HWT A;  2UVW A;  2KMD A;  5J2B A;  1JXE A;  1VLB A;  9ICX A;  3UQ0 A;  4PHP A;  4RUA A;  2W3S A;  1CI4 A;  2W7O A;  4DFK A;  3UM9 A;  4UAY A;  3HX0 A;  3RRH A;  3ZD9 A;  5KTQ A;  5AKE A;  4FZN A;  2KZM A;  1U9L A;  2CRX A;  1XS9 D;  3CW2 C;  2UVR A;  2PI5 A;  3ZDE A;  4GC7 A;  4NL9 C;  3TI0 A;  3F2C A;  2HHQ A;  1S8O A;  4JUZ A;  3RJI A;  8ICZ A;  5J0Y A;  2PMZ C;  1ZQ1 C;  4BWJ A;  4KIT B;  4TUR A;  1PK3 A;  2BPC A;  4KLJ A;  5J2H A;  9ICK A;  3Q8K A;  4IC9 A;  4AYB F;  5KAI U;  2JEJ A;  4QZH A;  9ICE A;  4ECY A;  5DB9 A;  4UB5 A;  3PW5 A;  2RLT A;  3MAB A;  3JPP A;  2DF4 B;  2HW3 A;  3WKA A;  3AU6 A;  4F5R A;  4KMO B;  2EZY A;  1OUQ A;  1KLN A;  4Y2Y A;  3QUQ A;  3HIL A;  2EDU A;  2FLN A;  4Y2P A;  1RXV A;  3M8S A;  2EQY A;  5BOL A;  4ED2 A;  1BNO A;  4AP9 A;  3NVV A;  1JN3 A;  4ED7 A;  1ZQU A;  3C23 A;  2RDI A;  5A0L A;  4UW9 A;  3IRU A;  3H8J A;  5KFG A;  4PHD A;  5L1K A;  5ALN A;  4ECR A;  2E8N A;  3BQ0 A;  8ICX A;  5B5E U;  4DSE A;  4EEY A;  4C7Z A;  3ETR A;  5IIN A;  2OXO A;  3PW4 A;  5KNI A;  1KKX A;  2KKV A;  1ZQO A;  4KLE A;  1URJ A;  3MDC A;  2NRZ A;  3DV9 A;  2ASD A;  3HP6 A;  2Y9T A;  3TAD A;  4I29 A;  3IV6 A;  5KT7 A;  4EEL A;  1S0V A;  4I2J A;  5ALO A;  2ZIW A;  3QE9 Y;  1S76 D;  3MFH A;  4KLU A;  5EOZ A;  3R9K A;  3QYP A;  4QZC A;  5KFV A;  1L7M A;  1X6J A;  3PW0 A;  4F4X A;  4J9S A;  2JMG A;  2Y9U A;  5GTH U;  5AI4 A;  4Q43 A;  1SZP A;  2I6X A;  2YMM A;  5J2I A;  2GOL A;  1BPY A;  1ZET A;  1B4F A;  3QEB Z;  1DGS A;  3J81 j;  2IBK A;  4DSK A;  1NK4 A;  4OO1 J;  1ZRM A;  7ICM A;  4QIW C;  1NNL A;  3WKD A;  4GLX A;  4KLL A;  2AXT U;  2KVS A;  1S0N A;  2XO7 A;  4NL9 A;  4J9R A;  2LYA A;  4QZA A;  3B0X A;  3JPT A;  4J9O A;  3TAR A;  1O08 A;  2YB4 A;  2H3Z A;  7ICQ A;  3GII A;  4NLZ A;  2C2R A;  4UQG A;  3ONN A;  1YZ7 A;  2A3V A;  1OW5 A;  2JEF A;  4U7C A;  3AN1 A;  3GIL A;  5AM5 A;  4JWM A;  5KFM A;  4DL5 A;  4OJ6 A;  5KFP A;  4F4Z A;  5AIA A;  4QJF B;  3UMG A;  4DQP A;  1WG8 A;  4KLF A;  1SWV A;  2DBY A;  3NTU A;  1S5L U;  2G5I B;  1X66 A;  4DL3 A;  3G6Y A;  7ICO A;  1BGX T;  3EYZ A;  3PX4 A;  2WFA A;  3EUB 2;  1MC8 A;  5ALT A;  4B9M A;  4KX3 A;  3FDS A;  4ECQ A;  1IXR A;  3SZ2 A;  8ICJ A;  1SL2 A;  1ZQW A;  1T3Q A;  1HUO A;  9ICQ A;  1UT5 A;  2FPK A;  3MGI A;  5HMM A;  1Q3U A;  5DLF A;  1SB3 C;  3JPQ A;  1MA7 A;  1TE2 A;  7ICL A;  1N5W A;  4F50 A;  1PVQ A;  2KN7 A;  4GC6 A;  4C80 A;  1X9M A;  3GIJ A;  2B0C A;  2W55 A;  9ICF A;  4X5V A;  3G6X A;  1KSP A;  2K60 A;  2WF7 A;  1A77 A;  5DG7 A;  2AH5 A;  3MGH A;  1KFT A;  3RAQ A;  3BDP A;  5KFQ A;  2PFO A;  5KFH A;  2HBK A;  4NWI A;  5CP2 A;  1V38 A;  4F5P A;  4F91 B;  1S77 D;  1AQ6 A;  4DCC A;  1T4G A;  3H8M A;  1ECW A;  2GLE A;  3AQF A;  3K4G A;  4Q44 A;  2I9G A;  4IQW A;  4HAI A;  3T5L A;  5J2E A;  4JB3 A;  4OD0 A;  2AHO B;  3BQ1 A;  3IHQ B;  2PKE A;  5ALV A;  1BPX A;  8ICE A;  3NS1 A;  5J0S A;  1A0P A;  4RQ1 A;  5EWE A;  1FFV A;  3KHL A;  2XID A;  2Z7J A;  5KFF A;  5J0X A;  5J2G A;  4Z6C A;  2MUT A;  5DLG A;  2HCF A;  4RQN A;  4TUP A;  1F5S A;  2P66 A;  1PZN A;  3MDA A;  3RAX A;  5AHX A;  2VA2 A;  3SEI A;  2FPM A;  9ICO A;  4XRH A;  3M6Z A;  5HML A;  2WF8 A;  4ZH4 A;  1JI7 A;  4YFK A;  4Z6E A;  3BJY A;  4DQI A;  1KBU A;  5KFO A;  5F9L A;  4IR1 A;  7ICI A;  1TKD A;  4FZM A;  5KFI A;  2AQ0 A;  3T79 A;  4F5N A;  3ALR A;  3PW2 A;  1HEK A;  5KFU A;  1RDF A;  1N5X A;  1T7P A;  2Q0Z X;  2IOH A;  2NRT A;  2NRV A;  1O03 A;  1L3V A;  1LKY A;  1N60 A;  4O3R A;  2JH7 A;  2Y0S C;  5ALR A;  4FZL A;  3M9O B;  2CPR A;  3KOO A;  2K4E A;  4YMM A;  4KLQ A;  3JPS A;  1ZXI A;  5CWR A;  2XY6 A;  5DGB A;  1NJX A;  4I27 A;  2YB1 A;  3OHA A;  4F2R A;  4RQ8 A;  2MU2 A;  3FAH A;  5KFA A;  2FLP A;  1JMS A;  2W8K A;  4EBD A;  1K5O A;  1ZQC A;  4LVS A;  1X40 A;  2ISO A;  5KFB A;  2DPJ A;  4UB8 U;  1QSS A;  1Y88 A;  3IG8 A;  4C7Y A;  1HUZ A;  4PGX A;  4F93 B;  2G07 A;  3C2K A;  1V97 A;  3V7L A;  4RT3 A;  3ISD A;  4B9S A;  3ZI4 A;  2H3F A;  3B0Y A;  3RJF A;  4UAU A;  3DEE A;  2Y1I A;  1U49 A;  4HYK A;  5AIC A;  5E79 U;  4EEK A;  2NRX A;  1IM4 A;  5J8Y C;  4ED1 A;  1TAQ A;  1PVR A;  3M6K A;  1ZQP A;  4QZD A;  4RNM A;  3QNM A;  4DS4 A;  2KP7 A;  3LDA A;  2W03 A;  4I2A A;  2HVH A;  2GWS A;  2W9C B;  4I2D A;  2ZTC A;  2HBJ A;  9ICR A;  7ICT A;  3N97 B;  1ED1 A;  2RQ5 A;  2DWQ A;  3H8W A;  1ZD3 A;  4YR3 A;  3TAQ A;  1N63 A;  1RM6 C;  4YR2 A;  2BCV A;  3V7J A;  3N28 A;  3RFA A;  1SL1 A;  4B9T A;  8ICC A;  4KMU A;  3D2S A;  2DKX A;  2ZIX B;  2H5X A;  1ZQK A;  2DPI A;  1PVP A;  1ZQY A;  1ZRN A;  4LJX A;  5ALW A;  5KAF U;  4M2Y A;  3KTQ A;  3BQ7 A;  2W9B A;  2OHF A;  1XO0 A;  4RPY A;  1ZQE A;  3LYS A;  8ICF A;  1PK1 B;  4WJ3 B;  5J2A A;  4K4I A;  2A1J B;  3N4M B;  3OJS A;  2XI9 A;  3V7K A;  4CCH A;  4C8K A;  4KLH A;  3C5G A;  3SAF A;  2KFZ A;  4J9Q A;  4ECT A;  1X2I A;  4M6W B;  4Z6F A;  1KEJ A;  1V85 A;  2C2E A;  2YX8 A;  9ICC A;  5III A;  3PX0 A;  2WB1 F;  4ICA A;  5K4L A;  1QSL A;  9ICB A;  1KW4 A;  3PR5 B;  2K8A A;  4NLC A;  1JX4 A;  8ICH A;  2JZB A;  3H7I A;  3RH4 A;  4FE3 A;  3UXP A;  2IHN A;  3E58 A;  3PX6 A;  2KSO A;  2W7P A;  4EYI B;  4G3I A;  5BOM A;  2VA3 A;  4RPZ A;  4I2H A;  1NKC A;  3LWM A;  2EH9 A;  4YP3 A;  4Y2T A;  2D6F C;  4YMO A;  4DL7 A;  3TFS A;  4ED8 A;  4KTQ A;  3I76 A;  1D8L A;  1JRO A;  4NLN A;  1UPH A;  3GIM A;  4EZ6 A;  5J2K A;  2HOI A;  2EZX A;  3RJJ A;  1K1S A;  4RQ6 A;  4KLS A;  3WK5 A;  2KZZ A;  5T14 A;  2ZTE A;  1BPD A;  1HIW A;  2C2D A;  3RB0 A;  4CNQ A;  4CE6 A;  2E5S A;  3WK6 A;  5DBC A;  4EYH B;  3KD3 A;  2E8O A;  5ALU A;  1ZQH A;  1Z1B A;  3M1Y A;  1QQ5 A;  1Q8K A;  4PGQ A;  2ZIU A;  3EW9 A;  5J0P A;  4DOA A;  2R8K A;  2K4H A;  4JV0 A;  2WTF A;  1X9S A;  2HDO A;  3RJE A;  1BNP A;  3QZ8 A;  2VKQ A;  3H4B A;  5KL8 B;  2KEY A;  1LB2 B;  4DFJ A;  3WK7 A;  1SKS A;  2NYV A;  2H3Q A;  2KFN A;  4P0Q A;  4NM1 A;  2C28 A;  4U6P A;  1WWV A;  4DQR A;  2YQE A;  1DOQ A;  1QH9 A;  3D6J A;  2QB0 A;  5JU5 A;  1OXJ A;  3C21 A;  2RRD A;  3SD7 A;  8ICL A;  5AKX A;  5KFW A;  5DB6 A;  1BVS A;  3EZ5 A;  4F4Y A;  3QU4 A;  2KZ3 A;  2LMR A;  3MR5 A;  4DL4 A;  3C2M A;  4RPX A;  2WAQ C; 
#chains in the Genus database with same CATH homology
 2D3D A;  1PK1 A;  3BS5 B;  4IS7 A;  2F3N A;  1UCV A;  2ES6 A;  2KSO A;  3BS5 A;  5J8Y C;  4NL9 A;  3SEN A;  4RQM A;  2QAR B;  4RQN A;  2EAN A;  2QAR A;  1SGG A;  3SEI A;  4MHV A;  1OW5 A;  3K1R B;  3BS7 A;  3HIL A;  4PZN A;  1JI7 A;  2F44 A;  4NJ8 A;  1X66 A;  2E8O A;  3TAD C;  1WWU A;  2YTU A;  1SXE A;  1COK A;  2L5Y A;  2E8P A;  1LKY B;  2ESE A;  2E8N A;  2KMD A;  2DKX A;  5JTI A;  4PZO A;  2QKQ A;  1LKY A;  2KIV A;  1SV4 A;  1RG6 A;  5KNI A;  2D8C A;  2LPE A;  5JRT A;  2KG5 A;  3BQ7 A;  5J8Y A;  2B6G A;  2DL0 A;  1DXS A;  2JV3 A;  3KKA C;  1SV0 C;  2EAM A;  3TAC B;  2EAP A;  1PK1 B;  2Y9T A;  3TAD A;  1F0M A;  2QB0 B;  1WWV A;  5L1M A;  2FE9 A;  2EAO A;  3IDW A;  2KE7 A;  1SXD A;  5F3X B;  2QB0 A;  5JU5 A;  1OXJ A;  2K60 A;  2F8K A;  1X40 A;  4NL9 C;  2DKZ A;  1B0X A;  1V85 A;  1UQV A;  1Z1V A;  2QB1 A;  1V38 A;  2Y9U A;  3H8M A;  3KKA A;  1SV0 A;  2LMR A;  2GLE A;  1X9X A;  1KW4 A;  2K4P A;  2E8M A;  1PK3 A;  1B4F A;  2KSO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...