1SV0A

Crystal structure of yan-sam/mae-sam complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
77
structure length
77
Chain Sequence
LPPSLPSDPRLWSREDVLVFLRFCVREFDLPKLDFDLFQMNGKRLCLLTRADFGHRCPGAGDVLHNVLQMLIIESHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Derepression by depolymerization; structural insights into the regulation of yan by mae.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
molecule keywords Ets DNA-binding protein pokkuri
total genus 26
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1sv0A00
2Y9TA 2ESEA 5JU5A 1OW5A 4PZOA 5KNIA 2FE9A 1B4FA 1DXSA 1X9XA 5F3XB 4PZNA 3KKAC 2F3NA 3KKAA 2E8NA 2EANA 2YTUA 2QKQA 3SEIA 1B0XA 3BQ7A 2KIVA 1PK3A 2EAPA 1X66A 1LKYB 2DKXA 3BS5B 2QARB 2DKZA 1PK1A 3TACB 1JI7A 1Z1VA 2DL0A 1UCVA 2Y9UA 2K60A 4NL9C 2K4PA 2KE7A 3BS7A 2B6GA 5L1MA 2QB0A 4RQMA 4MHVA 1WWVA 1SV0C 2D8CA 2ES6A 3HILA 3K1RB 2LMRA 2QARA 4NJ8A 1COKA 2KMDA 2EAMA 1X40A 2QB0B 2L5YA 2E8MA 1UQVA 3H8MA 2KG5A 1SXDA 2KSOA 2GLEA 2E8OA 1SV0A 1LKYA 3TADC 3TADA 1PK1B 4IS7A 1SGGA 5JRTA 1V85A 2LPEA 1SXEA 1SV4A 3SENA 3IDWA 2E8PA 1KW4A 3BS5A 5JTIA 4NL9A 2F44A 2D3DA 5J8YC 2EAOA 2F8KA 1RG6A 2KSOB 1OXJA 1F0MA 1V38A 2JV3A 5J8YA 2QB1A 1WWUA 4RQNA
chains in the Genus database with same CATH superfamily
2W03A 4J9NA 2N1RA 4F91B 4RQ1A 2GOLA 1J97A 1Z19A 3RB0A 4IR9A 1YT3A 1S97A 3ZD8A 7ICJA 5D4BA 2WF7A 2MRLA 4EZ6A 2DFLA 3ED5A 4EYIB 1HEKA 4RQ5A 4M47A 5DLFA 3AN1A 2YMMA 3WKAA 4RUCA 4OJ6A 4B9VA 4RUAA 3GDXA 4RPXA 1QLNA 4WJ3B 1PVPA 2MAXA 1N2XA 5J2CA 4I2FA 4I2HA 2DPIA 1ZD2P 2WB1F 2KE7A 2A1AA 2RRDA 3HT3A 5J0SA 4EBEA 1RQNA 2HDOA 2K4EA 3PV8A 3M9OB 3IG5A 1NZPA 3AEVA 4DL7A 3AU6A 4CCHA 4XA5A 9ICUA 2KHVA 4O3SA 4PL2A 3K75D 4O3OA 2ZIXA 4FS1A 1HIWA 1Z3EB 3GIJA 1MQ2A 3ETRA 3PMLA 5B5EU 2WF9A 2HOFA 1L6NA 4JWNA 2YMLA 3KHGA 1JMSA 5KFLA 4NXZA 4TQSA 2JZBB 4Y2QA 1S9FA 2MSNA 2KZZA 4QNLA 1BPZA 1SGGA 4QZGA 1V85A 4C0ZA 3GFKB 2HVHA 5F9NA 9ICFA 1KN5A 1N60A 3RAQA 1BPEA 1V9PA 2JH7A 1ZXIA 3HW8A 2HHVA 4RQ0A 2G0AA 4TQRA 1ZYQA 4I2DA 2FPKA 4CE6A 3I76A 2YB4A 2W9CA 2WTFA 3IHQB 1XWLA 7ICGA 3LK9A 4KTQA 9ICTA 3L5KA 3C1ZA 5KFMA 1B43A 4R65A 1ECWA 2K8CB 4Z6CA 2FE9A 2KZMA 4PGYA 2KZ3A 5F3XB 2HHXA 3RH4A 2W9MA 3SAFA 3RH6A 3H7IA 2EANA 4JV2A 1Z1BA 5CJ7A 5GTHU 4I2EA 4F5OA 5KFYA 3THVA 2K8AA 2PFPA 5KFDA 4DSKA 5KFNA 4ECXA 3KHLA 3Q8LA 4YCXA 2OCEA 1X9SA 3C5FA 4QWCA 2AHOB 1AROP 1IIPA 1SL2A 3C2KA 3PO5A 4YQWA 1SB3C 4Y2JA 4ECZA 1KFTA 4NLCA 1RYUA 3UXOA 3T5KA 2XCAA 4J9SA 1ZQMA 2IOFA 3E2EA 2LBOA 2AXTU 3PX6A 1BNOA 4F2RA 4DQQA 2JEGA 7ICSA 5DBBA 3PY8A 2JGAA 5HMMA 4YP3A 4EEKA 4J9PA 4ED3A 1KBUA 3TADC 4C80A 1NK4A 3Q8QB 1TE2A 3ETLA 4Y2RA 3JPOA 4F50A 8ICZA 5AKLA 5HR7A 3T3FA 3GQCA 4MF8A 4DFPA 3SENA 2FDRA 3TQ1A 2AU0A 3UQ0A 1S5LU 9ICKA 3NTUA 5JUMA 5JTIA 5J2IA 3QNMA 4C7YA 3M7DA 1KKXA 4IRCA 1BPYA 3IG8A 5ALEA 1OXJA 1Q8KA 8ICBA 7ICUA 5J2BA 5ALOA 3G6XA 1KDHA 4KLJA 4EENA 5J2HA 3QZ7A 4Y2YA 5KL8B 5AM1A 5ALFA 5ALYA 5ALRA 3EWAA 1L3UA 3M8SA 1N5XA 1ZQVA 3V6HA 3BQ7A 4DOAA 4G3IA 5KFVA 4BXOB 5G5HA 1D9FA 5ALQA 1DRGA 9ICSA 4DS4A 5AI8A 5AK5A 4QZDA 1ZQGA 4J9KA 4F4KA 4C4RA 3HWTA 4JV0A 1RZTA 5AKEA 2FI1A 1U47A 1JIHA 4B9NA 1XSLA 5AKYA 4FBUA 4PHAA 3HILA 1LV5A 1Q3UA 2R8IA 4ED2A 4BX9C 2A1JB 4M04A 8ICTA 2HMXA 2J6UA 1FFUA 4DOBA 3KZXA 1IV8A 5J2DA 2EZZA 3UMBA 2O6KA 3H8MA 5AHXA 3SMVA 4DWIA 2A19A 2E8OA 5AKIA 2W54A 4DQIA 1YZ7A 2WF5A 4IS7A 9ICXA 1K1SA 4P0PB 1SV4A 2FPMA 4JB3A 4C8MA 3SI8A 1XS9D 2ISOA 4LZGA 3D2SA 1KLNA 1XU4A 3SD7A 9ICRA 9ICCA 3FAHA 1ZJNA 5FP0A 4ACOA 3UMCA 1D8BA 4I28A 1U45A 4KLQA 2ISPA 2XY7A 2KP7A 4EX7A 1S10A 3QE9Y 5ALSA 4USAA 4AYBC 4DS5A 4RNOA 4Q8EA 4YMMA 1NNLA 4P0PA 2KEYA 1KTQA 3RR7A 2Y0SC 4F93B 2BCVA 1NJWA 1NJYA 2E1EA 2KIVA 2W3SA 3ZD9A 4FZMA 3TI0A 2YQEA 1TVAA 1SIJA 1S8OA 3LVVA 4M9GA 8ICOA 3L4PA 2ZIXB 3V7KA 5J0PA 3GILA 1URJA 3PR4A 5DGAA 2NRXA 5CR0A 2ZXHA 4P0QB 5KFHA 1UPHA 3CW2C 2R8JA 1CI4A 2JZBA 2Y0SF 2ZXIA 4CF4A 3JPPA 4TUQA 1IXRA 1KL9A 5AM0A 4YG2A 4ELTA 4IQTA 1JXEA 3GV7B 2PFQA 2VANA 4GFJA 4U7CA 5TZVA 5AM4A 2W9CB 4LZDA 3TADA 4RNNA 2DF4B 3EPGA 4M9LA 3QX7A 3RJKA 4I2JA 2BDPA 3KBBA 3LVWA 8ICWA 2F44A 2ZIVA 4P4OA 4UB6U 3NVYA 2NO4A 2Y1IA 1HJPA 3EZ5A 3PSIA 1ZETA 4M9JA 4BUGA 1U9LA 2H5XA 2W7OA 1NKEA 4IQWA 2HHQA 9ICHA 3O0FA 3D2NA 3RJJA 5AM3A 5J2KA 3N28A 1KFDA 2J6SA 5AI6A 3F2DA 2EDUA 8ICMA 1ZQZA 1ZOLA 1O08A 5KNIA 4UW9A 2G08A 2PXIA 3V6JA 3H4DA 1ZQTA 3C21A 3PW7A 3MABA 3PW0A 4I29A 4KLHA 7ICVA 1TAMA 5J0XA 1X66A 2KD1A 3PMNA 2MUTB 4F4ZA 2W04A 4NY8A 3PO4A 3ICXA 2LHTA 4CGZA 3F2BA 5J2AA 2RDIA 4NL9C 2P6UA 4YD2A 5HP4A 4ED7A 3H4BA 4DF8A 5KG0A 4UARA 3A0HU 1U48A 3N7RC 1MQ3A 4P4PA 4PJ0U 1N61A 5KFXA 5ALVA 5AI0A 2FJ6A 1SWVA 4FE3A 1MC8A 3CP8A 1XC9A 1L8LA 4M9NA 1UQVA 1SXDA 4DO9A 5J0TA 1C7YA 2XY5A 2JRZA 4ECYA 9ICNA 1X9MA 2BR0A 1ZQBA 4P2HA 1KSPA 9ICAA 4QWAA 5D49A 1ZQHA 3BS5A 3WK6A 4UQGA 4AYBF 4QZ9A 5HHIA 4YR2A 1LB2B 5CA7A 3OGUA 5CRXA 4BJQA 4GXKA 3H0RB 2QB1A 4YMOA 1A6SA 4QZIA 1BPDA 3WU2U 2JR5A 3RJFA 4RPZA 3QYPA 5KL1B 5KFFA 7ICFA 4UB3A 4B6JA 2PFOA 4QW8A 7ICPA 3S6JA 3MFHA 3OHBA 2ZIWA 4RNMA 1Z4OA 2KOBA 4ECRA 1PK3A 2NRVA 1TK5A 4JV1A 5KT2A 2BPFA 3TACB 4EZ9A 1GO3F 1M6YA 1Z1VA 1SL1A 2AJQA 4M9HA 4QWDA 5KG5A 4DSIA 1WG8A 1ED1A 2DQNB 9ICGA 4YMNA 3VC8A 5L1JA 4RQ2A 3M9NB 4O9MA 4CNQA 2K4PA 2W43A 2BQ3A 1OUQA 1Y88A 1VDVA 2AQ4A 3C29A 3B0YA 4M6WA 4RQMA 5KFKA 2DWQA 9ICMA 1C20A 2OHFA 2ZJAA 4PH5A 4UBBA 3CRXA 4QZ8A 3IN5A 1X40A 8ICGA 2E8MA 2HHTA 2KG5A 5BOLA 2CPRA 5J0OA 1SZHA 1BPBA 2XICA 5C5JA 1QQ5A 2IOHA 2ZIVB 2UVRA 5JRTA 4FZLA 4GXJA 4Y2UA 5IILA 3N7SC 5ALHA 1CRXA 4ECSA 5KG1A 2RP5A 1ZD3A 3QUQA 3GV8B 3UPQA 3EW9A 1J2MA 5AKXA 4ELUA 2QLTA 3RJEA 2DUYA 1NK0A 3QU9A 4DFJA 9ICJA 3OTQA 5DDMA 3MR3A 2ZUBA 7ICLA 1B22A 1L8OA 1XO1A 4Y2VA 4CRXA 4I27A 3D6JA 1JX4A 2LYHA 2EZYA 5DBCA 4GXIA 8ICCA 2UVVA 5AM5A 4F5RA 3GU3A 1WUDA 4QZFA 1S77D 4UB8U 4NLKA 3MDCA 5DQIA 2C2EA 4G9BA 4M0AA 3FDSA 5KT7A 3F5EA 4J9RA 2K4IA 4OO1J 5L1MA 4R63A 4O5EA 4MHVA 4AP9A 4DL5A 1WWVA 2ES6A 2WHEA 7ICNA 3MR5A 2YB1A 5IINA 3KTQA 3RTVA 1FO4A 4DLEA 1ZQDA 4PHPA 3NGDA 3ZDDA 4B9TA 2UVWA 3TANA 5KTQA 1VLBA 7ICEA 4KX3A 5F9LA 4F5NA 4J9OA 4M6WB 3U26A 4O3NA 1IM4A 5ALLA 3JPQA 2VIXA 2ATLA 2XVTA 3OJUA 5L1IA 4F92B 4Z6EA 4E0DA 4ICAA 2ODGA 5KFRA 1T94A 3IRUA 1RG6A 3TFSA 2FMSA 3RBDA 1V38A 1JROA 3JPSA 1JN3A 4K4GA 4RQNA 5AKHA 3Q8PB 4QZEA 2KTQA 4DFKA 4O3QA 1OW5A 2KFNA 3SV3A 4RQ6A 5ALZA 3RJHA 4O5CA 3L3FX 3V7LA 2FLLA 4O3MA 1L3TA 3KOOA 4DEZA 5KG6A 3PVXA 3HJEA 3TFRA 4DF4A 1KQQA 2KHQA 5KT5A 5EWFA 3EYZA 8ICIA 4US9A 1DOQA 1L7OA 1T4GA 1A76A 3T79A 3SZ2A 1ZRNA 4OJ5A 3ISCA 2E1FA 3BZCA 3NS1A 3WK5A 8ICKA 3BS7A 1ZQAA 4XQ8A 2E5SA 2D8CA 1WYGA 1HUOA 4I2BA 2G06A 3UXPA 3T5LA 2GH1A 2DPJA 2BHNA 3E0FA 2QB0B 3RR8A 4F71A 3B9JA 2KSOA 5ALUA 7ICKA 5AIBA 4P0QA 2HBJA 3C2MA 2BGWA 3SAGA 4MFFA 5ALGA 2KKVA 2LPEA 2HBLA 3I1YA 1CEZA 1Q46A 2K89A 8ICHA 2B21A 1BPXA 2KJ9A 4UAWA 1KW4A 1S0MA 3NRWA 3G6VA 3E58A 5KFUA 2ZTEA 1H38A 5IIOA 4Q44A 4QZAA 5EOZA 3UQ2A 3MBYA 3ZI4A 3HKZF 3M1YA 1ZQEA 4PHEA 5J8YA 1BGXT 3OSPA 4RQ4A 2R18A 2VJ5A 2LKYA 1SWWA 5KT6A 2KICA 1Z00A 5ALKA 3IV6A 2BZFA 4Z6DA 4LJXA 5AK4A 5KFZA 3M6KA 4UB4A 4UATA 4J9LA 1L3VA 4CF5A 4ECQA 3G6YA 4F8RA 1DK3A 3BS5B 3Q8MA 2NYVA 1Z00B 2DKZA 1PK1A 1ZQLA 4P4MA 2W9BA 2DL0A 1UCVA 4Y2SA 1NK7A 2B6GA 3EPIA 2KK0A 3PW4A 4UB5A 5AM2A 1SV0C 4J9MA 2H3VA 1ZD5A 2NO5A 3K1RB 5AK6A 2MUTA 1TFRA 5L1KA 4ED0A 2NRTA 2EAMA 1S76D 5DBAA 2DBYA 2BPGA 1QH9A 5IIIA 1PVRA 2LM1A 5A0LA 4O5KA 2OWOA 4C8KA 4GLXA 2GLEA 1SV0A 5J0RA 4OCZA 5ALTA 4JUZA 4EYHB 2HHUA 3WKDA 3PSPA 8ICRA 2E3TA 9ICLA 4EX6A 7ICIA 2CXYA 1MA7A 1K5OA 4RQ8A 5KFEA 2LYAA 4YXJA 2F8KA 5EE0A 3T5JA 2VA8A 3WKCA 2KSOB 3SYZA 3BQ0A 4UBCA 1D9DA 1RDFA 2BCRA 3GIMA 4KLSA 2G5IB 4PGQA 3RB3A 1ZJMA 1RPLA 2A1JA 2WF8A 4RZRA 1SL0A 1NK6A 4UB2A 3RJIA 4PZOA 5KFJA 1L7MA 2R8GA 1DXSA 4RT2A 2EQYA 2PFNA 3M8RA 2H3QA 2WFAA 5AI4A 5J2GA 4KLTA 2W8KA 3IP4B 4NLNA 1KFSA 4UAUA 3PR5B 5J2FA 2H3ZA 4KMUA 2ZUDA 4ZOHC 4QJFB 4KLFA 3KHRA 4U6PA 5ALPA 4ELVA 5J2EA 2IHMA 4EEYA 2D6FC 2W8LA 5E79U 4DCCA 8ICJA 2G5HB 2CRXA 5T14A 4RU9A 2ZG6A 4TURA 2QB0A 3BQTA 4F5PA 3M6ZA 4KLGA 7ICMA 1CUKA 4DOCA 1Z4NA 2RLTA 1QQ7A 3NVZA 3Q8SB 1COKA 3H0MB 2KMDA 5KFGA 3RB6A 3OPXA 3KD3A 4RT3A 1U4BA 1VJ5A 1N56A 3BZKA 1TAQA 3PSFA 4JWMA 2XI9A 1ZQSA 1PUZA 2XIDA 3KFUF 1F5SA 8ICVA 4B9LA 5DG9A 4IL6U 3SAHA 3KHHA 5IIMA 1RXVA 3IM1A 5B66U 4C8OA 4YR0A 2W9AA 4BWJA 3BQ1A 9ICEA 5EE3A 2EAOA 4PGXA 4ECWA 8ICNA 3QEBZ 5J2JA 9ICQA 1ZQCA 3UMGA 1ZQKA 3SQIA 1X9WA 4NM1A 1N62A 2NRZA 3QZ8A 1NJXA 4EBDA 2C22A 8ICYA 5KFAA 9ICWA 2AH5A 4UAVA 2RHFA 5HR6A 2F3NA 2E8NA 4FO6A 2IOFK 2UVUA 1X2IA 2W11A 3SEIA 2IHNA 5AI5A 2WAQF 5DB7A 3FC4A 2F8LA 5DG7A 4HYKA 8ICUA 3CYMA 2JMGA 4ZH4A 3MDAA 1HUZA 4YD1A 2XCPA 4QZBA 3BJYA 1SKWA 5KFQA 7ICQA 2BDUA 4C8NA 2Z7JA 3JPTA 3PNCA 1FFVA 2BPCA 4ED6A 5HMLA 4R8UB 4NLGA 5DB6A 2WAQC 2HVIA 4A8EA 1SKSA 3N97B 4ED8A 5L1LA 1NI3A 3RF9A 4FBTA 4HAIA 5D46A 2K4HA 4EBCA 4X5VA 4KN4A 1L5UA 4UAZA 2C2RA 8ICSA 1NKBA 5DG8A 2G09A 3PX4A 4MEYA 2ZTDA 2HBMA 5HHHA 4KLMA 4QWEA 7ICOA 1ZQQA 3DEEA 1QQ6A 4NLBA 5KFTA 1X42A 4MFCA 3V72A 3PZPA 4KLOA 2VA3A 4QIWC 2HSZA 4IR1A 3QU2A 4UB1A 4NWIA 3AQEA 4I2GA 3PX0A 5AICA 1BNPA 2HBKA 2Y9TA 2ESEA 5JU5A 8ICXA 4CDGA 2V4QA 5AKKA 1L3SA 2YY6A 1JUDA 1X9XA 3KKAC 5AK3A 1IG6A 2ZJ5A 4MF2A 4OJOA 1T7PA 2WF6A 1N5WA 2FPLA 9ICIA 4R64A 3RH5A 1XSNA 2EAPA 3CNHA 4QWBA 1D8LA 3QUBA 3PW2A 4PL1A 2W55A 5J29A 3NUQA 3AMZA 1UT8A 4Y2TA 3RAXA 1UHUA 4Y2XA 8ICLA 3H8JA 4F3OA 3KZIU 1UA1A 5KAIU 4PHDA 4JMUA 2CN1A 4IRDA 2OYYA 1T3NA 3C5GA 3MFIA 3GIIA 1ZQFA 4B9SA 4O3PA 2I1QA 1JALA 1NOMA 1L7NA 2FMPA 3QXGA 1ZD4A 3F53A 3M9MB 3LWLA 2BQUA 2JEJA 4F4WA 4K4HA 4R66A 5C0YA 2JH1A 2EZXA 1LVHA 4O3RA 8ICFA 5KT3A 2VKQA 1O03A 5EE9A 5ALWA 1TAUA 5CEHA 7ICRA 4DFMA 3HP6A 3A0BU 5ALIA 5J0QA 4KLUA 1WCLA 3VCBA 2R8KA 3C23A 2P35A 2YMPA 4B9UA 2ZIUB 3QU7A 4XUSA 3B0XA 2HHSA 2JHDA 2YX8A 4OJLA 2JV3A 2OEHA 4F2SA 1QSLA 4Y2PA 3T5HA 1WCNA 3AL0B 4I2IA 3SV4A 2YMQA 4KLIA 3HPOA 3BDPA 1B4FA 4C7ZA 4PZNA 3AQFA 3NRZA 3KKAA 4NLZA 9ICVA 2GWSA 4KX5A 3Q8RB 3ISBA 3ZDBA 2ASLA 2KVSA 5KG3A 4DFDA 1SZPA 4DQSA 9ICBA 4OJPA 1LKYB 1UT5A 3UXNA 2ZIUA 1RYRA 1NZBA 1TV9A 1JI7A 1NK9A 3AUOA 2IMWP 1DK2A 4F4XA 3HX0A 4PPXA 2KV2A 4R8UA 1MN8A 3H0LB 4YVZA 1J2NA 2VA2A 2XO7A 2F1IA 1ZQRA 4FFDA 1JRPA 8ICQA 3OJSA 5TISU 4C8LA 2KJ8A 2LMRA 4NJ8A 2BKEA 2EH9A 1TK0A 3ISDA 1ZQ1C 5DDYA 4C4TA 3RRHA 1PZNA 5CWRA 3GZFA 5EWGA 4QZCA 3TKAA 4FS2A 5EE1A 2OH2A 1SXEA 4ED1A 1QSSA 4Q43A 4ECTA 3N4MB 1S0NA 4MEXA 2BQRA 3LYSA 4ECUA 4IQVA 2NV3A 4RPYA 4YN4A 3MR2A 4UAYA 5DB8A 5J0YA 4KITB 1PVQA 3C1YA 5ALJA 1F0MA 7ICHA 3J81j 1ZQIA 3R9KA 5H2FU 2H3IA 2KKPA 1WWUA 4DSLA 2M0NA 2FMQA 2AGOA 1XNSA 1BVSA 1UA0A 4QZHA 4QIWF 2WB1C 4F5QA 2C2DA 2IA6A 3HRDD 1N63A 5DB9A 2YN4A 1V97A 4LVSA 2XGQA 1X6JA 3JPNA 2QKQA 5KG2A 3MGVA 1NK8A 4KMOB 2F76X 2NRWA 2W9BB 2C28A 1T3QA 3WK8A 5DQHA 2W3RA 5KFCA 2XGPA 1L7PA 5IIJA 3MGIA 4C4SA 5KAFU 4DQRA 3WK4A 2AQ0A 2A3VA 5ALXA 3WKBA 8ICPA 3WK9A 2OXOA 2Y1JA 5KG7A 2XC9A 2W7PA 4KLLA 5AI9A 4F72A 3ZDCA 1ZQOA 2AGPA 2LI6A 4B9MA 3WK7A 1JXLA 2PKEA 2OM6A 5ALNA 1TK8A 5KFOA 1FIQA 3FYHA 3RRGA 2K8BB 5HNKA 4YR3A 8ICAA 5GTIU 1Q3VA 4IRKA 3H40A 3V6KA 1RYSA 3I28A 4TUSA 1A0PA 3F2CA 3ONNA 3TARA 2ASDA 3SR6A 4IQUA 2JEFA 2ZUCA 2KFZA 4DL6A 1ZQJA 2I5HA 2PI5A 1TKDA 3IDWA 1NKCA 3K4GA 4DLGA 2F1HA 5KFSA 2V4RA 4BDPA 3GV5B 5IIKA 3QU4A 3UM9A 4YXMA 3RBEA 2MU2A 5K4LA 5CB1A 1N48A 4UASA 1QSYA 3K1ZA 1KRPA 5AKGA 3JPRA 3DDHA 1RM6C 2G07A 5L9XA 4GIBA 4MFAA 4O0IA 4J9QA 2HOIA 2JXJA 3QEAZ 2I9GA 5G5GA 4K4IA 3FM9A 4KLDA 2YTUA 1NK5A 4QW9A 1F44A 4BGDA 9ICOA 3TAPA 1B0XA 3MR6A 4DSJA 5DKWA 2FLNA 2I6XA 3ZDEA 2RQ5A 2DKXA 4IC9A 1ZRMA 4JK1A 3PW5A 3LDAA 3TAQA 4I2CA 2Y9UA 1QTMA 2K60A 1S0VA 3RB4A 3OHAA 5KFIA 3NVWA 2LM4A 3C28A 2PMZF 3RJGA 5DGBA 3QUCA 2DGZA 4DSEA 2H3FA 2ZJ8A 4BWMA 2IBKA 3RFAA 2HCFA 2HI0A 1EXNA 2ALZA 2AGQA 1A77A 3WKEA 3AM9A 4FZNA 2KVCA 3HKZC 1PK1B 3Q8KA 2V9WA 2ZIWB 2BCUA 7ICTA 3NVVA 1ZQWA 2HOQA 2ASJA 2R8HA 2E8PA 3OSNA 3F5AA 2Q0ZX 4NV0A 5CP2A 3ZDAA 2BCQA 5KG4A 1RQLA 5AIAA 1ZQNA 4BXOA 9ICPA 2B0CA 5AKZA 2GO7A 4M2YA 2P66A 5KFWA 4DQPA 4YFKA 2PMZC 3H8WA 5J0UA 5AKJA 2PI4A 8ICEA 5DLGA 1QCKA 1AQ6A 4DL3A 1ZQPA 1U49A 3QUTA 1FEZA 1XSPA 4Q8FA 2M9NA 1D8YA 3NASA 3EUB2 5KFPA 2VJ4A 4Z6FA 4J03A 5KT4A 5J0WA 4GC7A 1XO0A 1COOA 5DQGA 2J6TA 2QARB 2KN7A 5ALDA 3GIKA 4US8A 1S0OA 2XY6A 3LWMA 3ORYA 3N7PD 4Q45A 3DV9A 5BPCA 3C2LA 1ZQXA 3PSTA 1ZQYA 1MSWD 4RQ3A 2QARA 1NJZA 4DSFA 5ALMA 3MC1A 2HW3A 2KJ5A 1YZ6A 4EELA 4OD0A 2FLPA 2L5YA 1RXWA 1KEJA 1DGSA 3H8SA 2F2AB 4KN7A 3D2QA 2MA1A 3ALRA 4DL4A 1LKYA 1ZQUA 1K1QA 2HHWA 3QU5A 2BCSA 4DL2A 3V7JA 2KNJA 2F1JA 2KIWA 4CF3A 1SKRA 2P6RA 4XRHA 5EWEA 2JEIA 4GC6A 2Q4TA 5KFBA 4ECVA 4NM2A 1P7DA 4KLEA 4NL9A 2D3DA 3BQ2A 5J8YC 2F77X 3AU2A 4I2AA 2LYBA 1T8EA 5CHGA 4F4YA 2ZTCA 4TUPA 1X6IA 5BOMA 1DGJA 4RQ7A 3MGHA 2RDJA
chains in the Genus database with same CATH topology
2Y9TA 2ESEA 5JU5A 1OW5A 4PZOA 5KNIA 2FE9A 1B4FA 1DXSA 1X9XA 5F3XB 4PZNA 3KKAC 2F3NA 3KKAA 2E8NA 2EANA 2YTUA 2QKQA 3SEIA 1B0XA 3BQ7A 2KIVA 1PK3A 2EAPA 1X66A 1LKYB 2DKXA 3BS5B 2QARB 2DKZA 1PK1A 3TACB 1JI7A 1Z1VA 2DL0A 1UCVA 2Y9UA 2K60A 4NL9C 2K4PA 2KE7A 3BS7A 2B6GA 5L1MA 2QB0A 4RQMA 4MHVA 1WWVA 1SV0C 2D8CA 2ES6A 3HILA 3K1RB 2LMRA 2QARA 4NJ8A 1COKA 2KMDA 2EAMA 1X40A 2QB0B 2L5YA 2E8MA 1UQVA 3H8MA 2KG5A 1SXDA 2KSOA 2GLEA 2E8OA 1SV0A 1LKYA 3TADC 3TADA 1PK1B 4IS7A 1SGGA 5JRTA 1V85A 2LPEA 1SXEA 1SV4A 3SENA 3IDWA 2E8PA 1KW4A 3BS5A 5JTIA 4NL9A 2F44A 2D3DA 5J8YC 2EAOA 2F8KA 1RG6A 2KSOB 1OXJA 1F0MA 1V38A 2JV3A 5J8YA 2QB1A 1WWUA 4RQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y9T A;  2ESE A;  5JU5 A;  1OW5 A;  4PZO A;  5KNI A;  2FE9 A;  1B4F A;  1DXS A;  1X9X A;  5F3X B;  4PZN A;  3KKA C;  2F3N A;  3KKA A;  2E8N A;  2EAN A;  2YTU A;  2QKQ A;  3SEI A;  1B0X A;  3BQ7 A;  2KIV A;  1PK3 A;  2EAP A;  1X66 A;  1LKY B;  2DKX A;  3BS5 B;  2QAR B;  2DKZ A;  1PK1 A;  3TAC B;  1JI7 A;  1Z1V A;  2DL0 A;  1UCV A;  2Y9U A;  2K60 A;  4NL9 C;  2K4P A;  2KE7 A;  3BS7 A;  2B6G A;  5L1M A;  2QB0 A;  4RQM A;  4MHV A;  1WWV A;  1SV0 C;  2D8C A;  2ES6 A;  3HIL A;  3K1R B;  2LMR A;  2QAR A;  4NJ8 A;  1COK A;  2KMD A;  2EAM A;  1X40 A;  2QB0 B;  2L5Y A;  2E8M A;  1UQV A;  3H8M A;  2KG5 A;  1SXD A;  2KSO A;  2GLE A;  2E8O A;  1SV0 A;  1LKY A;  3TAD C;  3TAD A;  1PK1 B;  4IS7 A;  1SGG A;  5JRT A;  1V85 A;  2LPE A;  1SXE A;  1SV4 A;  3SEN A;  3IDW A;  2E8P A;  1KW4 A;  3BS5 A;  5JTI A;  4NL9 A;  2F44 A;  2D3D A;  5J8Y C;  2EAO A;  2F8K A;  1RG6 A;  2KSO B;  1OXJ A;  1F0M A;  1V38 A;  2JV3 A;  5J8Y A;  2QB1 A;  1WWU A;  4RQN A; 
#chains in the Genus database with same CATH topology
 2W03 A;  4J9N A;  2N1R A;  4F91 B;  4RQ1 A;  2GOL A;  1J97 A;  1Z19 A;  3RB0 A;  4IR9 A;  1YT3 A;  1S97 A;  3ZD8 A;  7ICJ A;  5D4B A;  2WF7 A;  2MRL A;  4EZ6 A;  2DFL A;  3ED5 A;  4EYI B;  1HEK A;  4RQ5 A;  4M47 A;  5DLF A;  3AN1 A;  2YMM A;  3WKA A;  4RUC A;  4OJ6 A;  4B9V A;  4RUA A;  3GDX A;  4RPX A;  1QLN A;  4WJ3 B;  1PVP A;  2MAX A;  1N2X A;  5J2C A;  4I2F A;  4I2H A;  2DPI A;  1ZD2 P;  2WB1 F;  2KE7 A;  2A1A A;  2RRD A;  3HT3 A;  5J0S A;  4EBE A;  1RQN A;  2HDO A;  2K4E A;  3PV8 A;  3M9O B;  3IG5 A;  1NZP A;  3AEV A;  4DL7 A;  3AU6 A;  4CCH A;  4XA5 A;  9ICU A;  2KHV A;  4O3S A;  4PL2 A;  3K75 D;  4O3O A;  2ZIX A;  4FS1 A;  1HIW A;  1Z3E B;  3GIJ A;  1MQ2 A;  3ETR A;  3PML A;  5B5E U;  2WF9 A;  2HOF A;  1L6N A;  4JWN A;  2YML A;  3KHG A;  1JMS A;  5KFL A;  4NXZ A;  4TQS A;  2JZB B;  4Y2Q A;  1S9F A;  2MSN A;  2KZZ A;  4QNL A;  1BPZ A;  1SGG A;  4QZG A;  1V85 A;  4C0Z A;  3GFK B;  2HVH A;  5F9N A;  9ICF A;  1KN5 A;  1N60 A;  3RAQ A;  1BPE A;  1V9P A;  2JH7 A;  1ZXI A;  3HW8 A;  2HHV A;  4RQ0 A;  2G0A A;  4TQR A;  1ZYQ A;  4I2D A;  2FPK A;  4CE6 A;  3I76 A;  2YB4 A;  2W9C A;  2WTF A;  3IHQ B;  1XWL A;  7ICG A;  3LK9 A;  4KTQ A;  9ICT A;  3L5K A;  3C1Z A;  5KFM A;  1B43 A;  4R65 A;  1ECW A;  2K8C B;  4Z6C A;  2FE9 A;  2KZM A;  4PGY A;  2KZ3 A;  5F3X B;  2HHX A;  3RH4 A;  2W9M A;  3SAF A;  3RH6 A;  3H7I A;  2EAN A;  4JV2 A;  1Z1B A;  5CJ7 A;  5GTH U;  4I2E A;  4F5O A;  5KFY A;  3THV A;  2K8A A;  2PFP A;  5KFD A;  4DSK A;  5KFN A;  4ECX A;  3KHL A;  3Q8L A;  4YCX A;  2OCE A;  1X9S A;  3C5F A;  4QWC A;  2AHO B;  1ARO P;  1IIP A;  1SL2 A;  3C2K A;  3PO5 A;  4YQW A;  1SB3 C;  4Y2J A;  4ECZ A;  1KFT A;  4NLC A;  1RYU A;  3UXO A;  3T5K A;  2XCA A;  4J9S A;  1ZQM A;  2IOF A;  3E2E A;  2LBO A;  2AXT U;  3PX6 A;  1BNO A;  4F2R A;  4DQQ A;  2JEG A;  7ICS A;  5DBB A;  3PY8 A;  2JGA A;  5HMM A;  4YP3 A;  4EEK A;  4J9P A;  4ED3 A;  1KBU A;  3TAD C;  4C80 A;  1NK4 A;  3Q8Q B;  1TE2 A;  3ETL A;  4Y2R A;  3JPO A;  4F50 A;  8ICZ A;  5AKL A;  5HR7 A;  3T3F A;  3GQC A;  4MF8 A;  4DFP A;  3SEN A;  2FDR A;  3TQ1 A;  2AU0 A;  3UQ0 A;  1S5L U;  9ICK A;  3NTU A;  5JUM A;  5JTI A;  5J2I A;  3QNM A;  4C7Y A;  3M7D A;  1KKX A;  4IRC A;  1BPY A;  3IG8 A;  5ALE A;  1OXJ A;  1Q8K A;  8ICB A;  7ICU A;  5J2B A;  5ALO A;  3G6X A;  1KDH A;  4KLJ A;  4EEN A;  5J2H A;  3QZ7 A;  4Y2Y A;  5KL8 B;  5AM1 A;  5ALF A;  5ALY A;  5ALR A;  3EWA A;  1L3U A;  3M8S A;  1N5X A;  1ZQV A;  3V6H A;  3BQ7 A;  4DOA A;  4G3I A;  5KFV A;  4BXO B;  5G5H A;  1D9F A;  5ALQ A;  1DRG A;  9ICS A;  4DS4 A;  5AI8 A;  5AK5 A;  4QZD A;  1ZQG A;  4J9K A;  4F4K A;  4C4R A;  3HWT A;  4JV0 A;  1RZT A;  5AKE A;  2FI1 A;  1U47 A;  1JIH A;  4B9N A;  1XSL A;  5AKY A;  4FBU A;  4PHA A;  3HIL A;  1LV5 A;  1Q3U A;  2R8I A;  4ED2 A;  4BX9 C;  2A1J B;  4M04 A;  8ICT A;  2HMX A;  2J6U A;  1FFU A;  4DOB A;  3KZX A;  1IV8 A;  5J2D A;  2EZZ A;  3UMB A;  2O6K A;  3H8M A;  5AHX A;  3SMV A;  4DWI A;  2A19 A;  2E8O A;  5AKI A;  2W54 A;  4DQI A;  1YZ7 A;  2WF5 A;  4IS7 A;  9ICX A;  1K1S A;  4P0P B;  1SV4 A;  2FPM A;  4JB3 A;  4C8M A;  3SI8 A;  1XS9 D;  2ISO A;  4LZG A;  3D2S A;  1KLN A;  1XU4 A;  3SD7 A;  9ICR A;  9ICC A;  3FAH A;  1ZJN A;  5FP0 A;  4ACO A;  3UMC A;  1D8B A;  4I28 A;  1U45 A;  4KLQ A;  2ISP A;  2XY7 A;  2KP7 A;  4EX7 A;  1S10 A;  3QE9 Y;  5ALS A;  4USA A;  4AYB C;  4DS5 A;  4RNO A;  4Q8E A;  4YMM A;  1NNL A;  4P0P A;  2KEY A;  1KTQ A;  3RR7 A;  2Y0S C;  4F93 B;  2BCV A;  1NJW A;  1NJY A;  2E1E A;  2KIV A;  2W3S A;  3ZD9 A;  4FZM A;  3TI0 A;  2YQE A;  1TVA A;  1SIJ A;  1S8O A;  3LVV A;  4M9G A;  8ICO A;  3L4P A;  2ZIX B;  3V7K A;  5J0P A;  3GIL A;  1URJ A;  3PR4 A;  5DGA A;  2NRX A;  5CR0 A;  2ZXH A;  4P0Q B;  5KFH A;  1UPH A;  3CW2 C;  2R8J A;  1CI4 A;  2JZB A;  2Y0S F;  2ZXI A;  4CF4 A;  3JPP A;  4TUQ A;  1IXR A;  1KL9 A;  5AM0 A;  4YG2 A;  4ELT A;  4IQT A;  1JXE A;  3GV7 B;  2PFQ A;  2VAN A;  4GFJ A;  4U7C A;  5TZV A;  5AM4 A;  2W9C B;  4LZD A;  3TAD A;  4RNN A;  2DF4 B;  3EPG A;  4M9L A;  3QX7 A;  3RJK A;  4I2J A;  2BDP A;  3KBB A;  3LVW A;  8ICW A;  2F44 A;  2ZIV A;  4P4O A;  4UB6 U;  3NVY A;  2NO4 A;  2Y1I A;  1HJP A;  3EZ5 A;  3PSI A;  1ZET A;  4M9J A;  4BUG A;  1U9L A;  2H5X A;  2W7O A;  1NKE A;  4IQW A;  2HHQ A;  9ICH A;  3O0F A;  3D2N A;  3RJJ A;  5AM3 A;  5J2K A;  3N28 A;  1KFD A;  2J6S A;  5AI6 A;  3F2D A;  2EDU A;  8ICM A;  1ZQZ A;  1ZOL A;  1O08 A;  5KNI A;  4UW9 A;  2G08 A;  2PXI A;  3V6J A;  3H4D A;  1ZQT A;  3C21 A;  3PW7 A;  3MAB A;  3PW0 A;  4I29 A;  4KLH A;  7ICV A;  1TAM A;  5J0X A;  1X66 A;  2KD1 A;  3PMN A;  2MUT B;  4F4Z A;  2W04 A;  4NY8 A;  3PO4 A;  3ICX A;  2LHT A;  4CGZ A;  3F2B A;  5J2A A;  2RDI A;  4NL9 C;  2P6U A;  4YD2 A;  5HP4 A;  4ED7 A;  3H4B A;  4DF8 A;  5KG0 A;  4UAR A;  3A0H U;  1U48 A;  3N7R C;  1MQ3 A;  4P4P A;  4PJ0 U;  1N61 A;  5KFX A;  5ALV A;  5AI0 A;  2FJ6 A;  1SWV A;  4FE3 A;  1MC8 A;  3CP8 A;  1XC9 A;  1L8L A;  4M9N A;  1UQV A;  1SXD A;  4DO9 A;  5J0T A;  1C7Y A;  2XY5 A;  2JRZ A;  4ECY A;  9ICN A;  1X9M A;  2BR0 A;  1ZQB A;  4P2H A;  1KSP A;  9ICA A;  4QWA A;  5D49 A;  1ZQH A;  3BS5 A;  3WK6 A;  4UQG A;  4AYB F;  4QZ9 A;  5HHI A;  4YR2 A;  1LB2 B;  5CA7 A;  3OGU A;  5CRX A;  4BJQ A;  4GXK A;  3H0R B;  2QB1 A;  4YMO A;  1A6S A;  4QZI A;  1BPD A;  3WU2 U;  2JR5 A;  3RJF A;  4RPZ A;  3QYP A;  5KL1 B;  5KFF A;  7ICF A;  4UB3 A;  4B6J A;  2PFO A;  4QW8 A;  7ICP A;  3S6J A;  3MFH A;  3OHB A;  2ZIW A;  4RNM A;  1Z4O A;  2KOB A;  4ECR A;  1PK3 A;  2NRV A;  1TK5 A;  4JV1 A;  5KT2 A;  2BPF A;  3TAC B;  4EZ9 A;  1GO3 F;  1M6Y A;  1Z1V A;  1SL1 A;  2AJQ A;  4M9H A;  4QWD A;  5KG5 A;  4DSI A;  1WG8 A;  1ED1 A;  2DQN B;  9ICG A;  4YMN A;  3VC8 A;  5L1J A;  4RQ2 A;  3M9N B;  4O9M A;  4CNQ A;  2K4P A;  2W43 A;  2BQ3 A;  1OUQ A;  1Y88 A;  1VDV A;  2AQ4 A;  3C29 A;  3B0Y A;  4M6W A;  4RQM A;  5KFK A;  2DWQ A;  9ICM A;  1C20 A;  2OHF A;  2ZJA A;  4PH5 A;  4UBB A;  3CRX A;  4QZ8 A;  3IN5 A;  1X40 A;  8ICG A;  2E8M A;  2HHT A;  2KG5 A;  5BOL A;  2CPR A;  5J0O A;  1SZH A;  1BPB A;  2XIC A;  5C5J A;  1QQ5 A;  2IOH A;  2ZIV B;  2UVR A;  5JRT A;  4FZL A;  4GXJ A;  4Y2U A;  5IIL A;  3N7S C;  5ALH A;  1CRX A;  4ECS A;  5KG1 A;  2RP5 A;  1ZD3 A;  3QUQ A;  3GV8 B;  3UPQ A;  3EW9 A;  1J2M A;  5AKX A;  4ELU A;  2QLT A;  3RJE A;  2DUY A;  1NK0 A;  3QU9 A;  4DFJ A;  9ICJ A;  3OTQ A;  5DDM A;  3MR3 A;  2ZUB A;  7ICL A;  1B22 A;  1L8O A;  1XO1 A;  4Y2V A;  4CRX A;  4I27 A;  3D6J A;  1JX4 A;  2LYH A;  2EZY A;  5DBC A;  4GXI A;  8ICC A;  2UVV A;  5AM5 A;  4F5R A;  3GU3 A;  1WUD A;  4QZF A;  1S77 D;  4UB8 U;  4NLK A;  3MDC A;  5DQI A;  2C2E A;  4G9B A;  4M0A A;  3FDS A;  5KT7 A;  3F5E A;  4J9R A;  2K4I A;  4OO1 J;  5L1M A;  4R63 A;  4O5E A;  4MHV A;  4AP9 A;  4DL5 A;  1WWV A;  2ES6 A;  2WHE A;  7ICN A;  3MR5 A;  2YB1 A;  5IIN A;  3KTQ A;  3RTV A;  1FO4 A;  4DLE A;  1ZQD A;  4PHP A;  3NGD A;  3ZDD A;  4B9T A;  2UVW A;  3TAN A;  5KTQ A;  1VLB A;  7ICE A;  4KX3 A;  5F9L A;  4F5N A;  4J9O A;  4M6W B;  3U26 A;  4O3N A;  1IM4 A;  5ALL A;  3JPQ A;  2VIX A;  2ATL A;  2XVT A;  3OJU A;  5L1I A;  4F92 B;  4Z6E A;  4E0D A;  4ICA A;  2ODG A;  5KFR A;  1T94 A;  3IRU A;  1RG6 A;  3TFS A;  2FMS A;  3RBD A;  1V38 A;  1JRO A;  3JPS A;  1JN3 A;  4K4G A;  4RQN A;  5AKH A;  3Q8P B;  4QZE A;  2KTQ A;  4DFK A;  4O3Q A;  1OW5 A;  2KFN A;  3SV3 A;  4RQ6 A;  5ALZ A;  3RJH A;  4O5C A;  3L3F X;  3V7L A;  2FLL A;  4O3M A;  1L3T A;  3KOO A;  4DEZ A;  5KG6 A;  3PVX A;  3HJE A;  3TFR A;  4DF4 A;  1KQQ A;  2KHQ A;  5KT5 A;  5EWF A;  3EYZ A;  8ICI A;  4US9 A;  1DOQ A;  1L7O A;  1T4G A;  1A76 A;  3T79 A;  3SZ2 A;  1ZRN A;  4OJ5 A;  3ISC A;  2E1F A;  3BZC A;  3NS1 A;  3WK5 A;  8ICK A;  3BS7 A;  1ZQA A;  4XQ8 A;  2E5S A;  2D8C A;  1WYG A;  1HUO A;  4I2B A;  2G06 A;  3UXP A;  3T5L A;  2GH1 A;  2DPJ A;  2BHN A;  3E0F A;  2QB0 B;  3RR8 A;  4F71 A;  3B9J A;  2KSO A;  5ALU A;  7ICK A;  5AIB A;  4P0Q A;  2HBJ A;  3C2M A;  2BGW A;  3SAG A;  4MFF A;  5ALG A;  2KKV A;  2LPE A;  2HBL A;  3I1Y A;  1CEZ A;  1Q46 A;  2K89 A;  8ICH A;  2B21 A;  1BPX A;  2KJ9 A;  4UAW A;  1KW4 A;  1S0M A;  3NRW A;  3G6V A;  3E58 A;  5KFU A;  2ZTE A;  1H38 A;  5IIO A;  4Q44 A;  4QZA A;  5EOZ A;  3UQ2 A;  3MBY A;  3ZI4 A;  3HKZ F;  3M1Y A;  1ZQE A;  4PHE A;  5J8Y A;  1BGX T;  3OSP A;  4RQ4 A;  2R18 A;  2VJ5 A;  2LKY A;  1SWW A;  5KT6 A;  2KIC A;  1Z00 A;  5ALK A;  3IV6 A;  2BZF A;  4Z6D A;  4LJX A;  5AK4 A;  5KFZ A;  3M6K A;  4UB4 A;  4UAT A;  4J9L A;  1L3V A;  4CF5 A;  4ECQ A;  3G6Y A;  4F8R A;  1DK3 A;  3BS5 B;  3Q8M A;  2NYV A;  1Z00 B;  2DKZ A;  1PK1 A;  1ZQL A;  4P4M A;  2W9B A;  2DL0 A;  1UCV A;  4Y2S A;  1NK7 A;  2B6G A;  3EPI A;  2KK0 A;  3PW4 A;  4UB5 A;  5AM2 A;  1SV0 C;  4J9M A;  2H3V A;  1ZD5 A;  2NO5 A;  3K1R B;  5AK6 A;  2MUT A;  1TFR A;  5L1K A;  4ED0 A;  2NRT A;  2EAM A;  1S76 D;  5DBA A;  2DBY A;  2BPG A;  1QH9 A;  5III A;  1PVR A;  2LM1 A;  5A0L A;  4O5K A;  2OWO A;  4C8K A;  4GLX A;  2GLE A;  1SV0 A;  5J0R A;  4OCZ A;  5ALT A;  4JUZ A;  4EYH B;  2HHU A;  3WKD A;  3PSP A;  8ICR A;  2E3T A;  9ICL A;  4EX6 A;  7ICI A;  2CXY A;  1MA7 A;  1K5O A;  4RQ8 A;  5KFE A;  2LYA A;  4YXJ A;  2F8K A;  5EE0 A;  3T5J A;  2VA8 A;  3WKC A;  2KSO B;  3SYZ A;  3BQ0 A;  4UBC A;  1D9D A;  1RDF A;  2BCR A;  3GIM A;  4KLS A;  2G5I B;  4PGQ A;  3RB3 A;  1ZJM A;  1RPL A;  2A1J A;  2WF8 A;  4RZR A;  1SL0 A;  1NK6 A;  4UB2 A;  3RJI A;  4PZO A;  5KFJ A;  1L7M A;  2R8G A;  1DXS A;  4RT2 A;  2EQY A;  2PFN A;  3M8R A;  2H3Q A;  2WFA A;  5AI4 A;  5J2G A;  4KLT A;  2W8K A;  3IP4 B;  4NLN A;  1KFS A;  4UAU A;  3PR5 B;  5J2F A;  2H3Z A;  4KMU A;  2ZUD A;  4ZOH C;  4QJF B;  4KLF A;  3KHR A;  4U6P A;  5ALP A;  4ELV A;  5J2E A;  2IHM A;  4EEY A;  2D6F C;  2W8L A;  5E79 U;  4DCC A;  8ICJ A;  2G5H B;  2CRX A;  5T14 A;  4RU9 A;  2ZG6 A;  4TUR A;  2QB0 A;  3BQT A;  4F5P A;  3M6Z A;  4KLG A;  7ICM A;  1CUK A;  4DOC A;  1Z4N A;  2RLT A;  1QQ7 A;  3NVZ A;  3Q8S B;  1COK A;  3H0M B;  2KMD A;  5KFG A;  3RB6 A;  3OPX A;  3KD3 A;  4RT3 A;  1U4B A;  1VJ5 A;  1N56 A;  3BZK A;  1TAQ A;  3PSF A;  4JWM A;  2XI9 A;  1ZQS A;  1PUZ A;  2XID A;  3KFU F;  1F5S A;  8ICV A;  4B9L A;  5DG9 A;  4IL6 U;  3SAH A;  3KHH A;  5IIM A;  1RXV A;  3IM1 A;  5B66 U;  4C8O A;  4YR0 A;  2W9A A;  4BWJ A;  3BQ1 A;  9ICE A;  5EE3 A;  2EAO A;  4PGX A;  4ECW A;  8ICN A;  3QEB Z;  5J2J A;  9ICQ A;  1ZQC A;  3UMG A;  1ZQK A;  3SQI A;  1X9W A;  4NM1 A;  1N62 A;  2NRZ A;  3QZ8 A;  1NJX A;  4EBD A;  2C22 A;  8ICY A;  5KFA A;  9ICW A;  2AH5 A;  4UAV A;  2RHF A;  5HR6 A;  2F3N A;  2E8N A;  4FO6 A;  2IOF K;  2UVU A;  1X2I A;  2W11 A;  3SEI A;  2IHN A;  5AI5 A;  2WAQ F;  5DB7 A;  3FC4 A;  2F8L A;  5DG7 A;  4HYK A;  8ICU A;  3CYM A;  2JMG A;  4ZH4 A;  3MDA A;  1HUZ A;  4YD1 A;  2XCP A;  4QZB A;  3BJY A;  1SKW A;  5KFQ A;  7ICQ A;  2BDU A;  4C8N A;  2Z7J A;  3JPT A;  3PNC A;  1FFV A;  2BPC A;  4ED6 A;  5HML A;  4R8U B;  4NLG A;  5DB6 A;  2WAQ C;  2HVI A;  4A8E A;  1SKS A;  3N97 B;  4ED8 A;  5L1L A;  1NI3 A;  3RF9 A;  4FBT A;  4HAI A;  5D46 A;  2K4H A;  4EBC A;  4X5V A;  4KN4 A;  1L5U A;  4UAZ A;  2C2R A;  8ICS A;  1NKB A;  5DG8 A;  2G09 A;  3PX4 A;  4MEY A;  2ZTD A;  2HBM A;  5HHH A;  4KLM A;  4QWE A;  7ICO A;  1ZQQ A;  3DEE A;  1QQ6 A;  4NLB A;  5KFT A;  1X42 A;  4MFC A;  3V72 A;  3PZP A;  4KLO A;  2VA3 A;  4QIW C;  2HSZ A;  4IR1 A;  3QU2 A;  4UB1 A;  4NWI A;  3AQE A;  4I2G A;  3PX0 A;  5AIC A;  1BNP A;  2HBK A;  2Y9T A;  2ESE A;  5JU5 A;  8ICX A;  4CDG A;  2V4Q A;  5AKK A;  1L3S A;  2YY6 A;  1JUD A;  1X9X A;  3KKA C;  5AK3 A;  1IG6 A;  2ZJ5 A;  4MF2 A;  4OJO A;  1T7P A;  2WF6 A;  1N5W A;  2FPL A;  9ICI A;  4R64 A;  3RH5 A;  1XSN A;  2EAP A;  3CNH A;  4QWB A;  1D8L A;  3QUB A;  3PW2 A;  4PL1 A;  2W55 A;  5J29 A;  3NUQ A;  3AMZ A;  1UT8 A;  4Y2T A;  3RAX A;  1UHU A;  4Y2X A;  8ICL A;  3H8J A;  4F3O A;  3KZI U;  1UA1 A;  5KAI U;  4PHD A;  4JMU A;  2CN1 A;  4IRD A;  2OYY A;  1T3N A;  3C5G A;  3MFI A;  3GII A;  1ZQF A;  4B9S A;  4O3P A;  2I1Q A;  1JAL A;  1NOM A;  1L7N A;  2FMP A;  3QXG A;  1ZD4 A;  3F53 A;  3M9M B;  3LWL A;  2BQU A;  2JEJ A;  4F4W A;  4K4H A;  4R66 A;  5C0Y A;  2JH1 A;  2EZX A;  1LVH A;  4O3R A;  8ICF A;  5KT3 A;  2VKQ A;  1O03 A;  5EE9 A;  5ALW A;  1TAU A;  5CEH A;  7ICR A;  4DFM A;  3HP6 A;  3A0B U;  5ALI A;  5J0Q A;  4KLU A;  1WCL A;  3VCB A;  2R8K A;  3C23 A;  2P35 A;  2YMP A;  4B9U A;  2ZIU B;  3QU7 A;  4XUS A;  3B0X A;  2HHS A;  2JHD A;  2YX8 A;  4OJL A;  2JV3 A;  2OEH A;  4F2S A;  1QSL A;  4Y2P A;  3T5H A;  1WCN A;  3AL0 B;  4I2I A;  3SV4 A;  2YMQ A;  4KLI A;  3HPO A;  3BDP A;  1B4F A;  4C7Z A;  4PZN A;  3AQF A;  3NRZ A;  3KKA A;  4NLZ A;  9ICV A;  2GWS A;  4KX5 A;  3Q8R B;  3ISB A;  3ZDB A;  2ASL A;  2KVS A;  5KG3 A;  4DFD A;  1SZP A;  4DQS A;  9ICB A;  4OJP A;  1LKY B;  1UT5 A;  3UXN A;  2ZIU A;  1RYR A;  1NZB A;  1TV9 A;  1JI7 A;  1NK9 A;  3AUO A;  2IMW P;  1DK2 A;  4F4X A;  3HX0 A;  4PPX A;  2KV2 A;  4R8U A;  1MN8 A;  3H0L B;  4YVZ A;  1J2N A;  2VA2 A;  2XO7 A;  2F1I A;  1ZQR A;  4FFD A;  1JRP A;  8ICQ A;  3OJS A;  5TIS U;  4C8L A;  2KJ8 A;  2LMR A;  4NJ8 A;  2BKE A;  2EH9 A;  1TK0 A;  3ISD A;  1ZQ1 C;  5DDY A;  4C4T A;  3RRH A;  1PZN A;  5CWR A;  3GZF A;  5EWG A;  4QZC A;  3TKA A;  4FS2 A;  5EE1 A;  2OH2 A;  1SXE A;  4ED1 A;  1QSS A;  4Q43 A;  4ECT A;  3N4M B;  1S0N A;  4MEX A;  2BQR A;  3LYS A;  4ECU A;  4IQV A;  2NV3 A;  4RPY A;  4YN4 A;  3MR2 A;  4UAY A;  5DB8 A;  5J0Y A;  4KIT B;  1PVQ A;  3C1Y A;  5ALJ A;  1F0M A;  7ICH A;  3J81 j;  1ZQI A;  3R9K A;  5H2F U;  2H3I A;  2KKP A;  1WWU A;  4DSL A;  2M0N A;  2FMQ A;  2AGO A;  1XNS A;  1BVS A;  1UA0 A;  4QZH A;  4QIW F;  2WB1 C;  4F5Q A;  2C2D A;  2IA6 A;  3HRD D;  1N63 A;  5DB9 A;  2YN4 A;  1V97 A;  4LVS A;  2XGQ A;  1X6J A;  3JPN A;  2QKQ A;  5KG2 A;  3MGV A;  1NK8 A;  4KMO B;  2F76 X;  2NRW A;  2W9B B;  2C28 A;  1T3Q A;  3WK8 A;  5DQH A;  2W3R A;  5KFC A;  2XGP A;  1L7P A;  5IIJ A;  3MGI A;  4C4S A;  5KAF U;  4DQR A;  3WK4 A;  2AQ0 A;  2A3V A;  5ALX A;  3WKB A;  8ICP A;  3WK9 A;  2OXO A;  2Y1J A;  5KG7 A;  2XC9 A;  2W7P A;  4KLL A;  5AI9 A;  4F72 A;  3ZDC A;  1ZQO A;  2AGP A;  2LI6 A;  4B9M A;  3WK7 A;  1JXL A;  2PKE A;  2OM6 A;  5ALN A;  1TK8 A;  5KFO A;  1FIQ A;  3FYH A;  3RRG A;  2K8B B;  5HNK A;  4YR3 A;  8ICA A;  5GTI U;  1Q3V A;  4IRK A;  3H40 A;  3V6K A;  1RYS A;  3I28 A;  4TUS A;  1A0P A;  3F2C A;  3ONN A;  3TAR A;  2ASD A;  3SR6 A;  4IQU A;  2JEF A;  2ZUC A;  2KFZ A;  4DL6 A;  1ZQJ A;  2I5H A;  2PI5 A;  1TKD A;  3IDW A;  1NKC A;  3K4G A;  4DLG A;  2F1H A;  5KFS A;  2V4R A;  4BDP A;  3GV5 B;  5IIK A;  3QU4 A;  3UM9 A;  4YXM A;  3RBE A;  2MU2 A;  5K4L A;  5CB1 A;  1N48 A;  4UAS A;  1QSY A;  3K1Z A;  1KRP A;  5AKG A;  3JPR A;  3DDH A;  1RM6 C;  2G07 A;  5L9X A;  4GIB A;  4MFA A;  4O0I A;  4J9Q A;  2HOI A;  2JXJ A;  3QEA Z;  2I9G A;  5G5G A;  4K4I A;  3FM9 A;  4KLD A;  2YTU A;  1NK5 A;  4QW9 A;  1F44 A;  4BGD A;  9ICO A;  3TAP A;  1B0X A;  3MR6 A;  4DSJ A;  5DKW A;  2FLN A;  2I6X A;  3ZDE A;  2RQ5 A;  2DKX A;  4IC9 A;  1ZRM A;  4JK1 A;  3PW5 A;  3LDA A;  3TAQ A;  4I2C A;  2Y9U A;  1QTM A;  2K60 A;  1S0V A;  3RB4 A;  3OHA A;  5KFI A;  3NVW A;  2LM4 A;  3C28 A;  2PMZ F;  3RJG A;  5DGB A;  3QUC A;  2DGZ A;  4DSE A;  2H3F A;  2ZJ8 A;  4BWM A;  2IBK A;  3RFA A;  2HCF A;  2HI0 A;  1EXN A;  2ALZ A;  2AGQ A;  1A77 A;  3WKE A;  3AM9 A;  4FZN A;  2KVC A;  3HKZ C;  1PK1 B;  3Q8K A;  2V9W A;  2ZIW B;  2BCU A;  7ICT A;  3NVV A;  1ZQW A;  2HOQ A;  2ASJ A;  2R8H A;  2E8P A;  3OSN A;  3F5A A;  2Q0Z X;  4NV0 A;  5CP2 A;  3ZDA A;  2BCQ A;  5KG4 A;  1RQL A;  5AIA A;  1ZQN A;  4BXO A;  9ICP A;  2B0C A;  5AKZ A;  2GO7 A;  4M2Y A;  2P66 A;  5KFW A;  4DQP A;  4YFK A;  2PMZ C;  3H8W A;  5J0U A;  5AKJ A;  2PI4 A;  8ICE A;  5DLG A;  1QCK A;  1AQ6 A;  4DL3 A;  1ZQP A;  1U49 A;  3QUT A;  1FEZ A;  1XSP A;  4Q8F A;  2M9N A;  1D8Y A;  3NAS A;  3EUB 2;  5KFP A;  2VJ4 A;  4Z6F A;  4J03 A;  5KT4 A;  5J0W A;  4GC7 A;  1XO0 A;  1COO A;  5DQG A;  2J6T A;  2QAR B;  2KN7 A;  5ALD A;  3GIK A;  4US8 A;  1S0O A;  2XY6 A;  3LWM A;  3ORY A;  3N7P D;  4Q45 A;  3DV9 A;  5BPC A;  3C2L A;  1ZQX A;  3PST A;  1ZQY A;  1MSW D;  4RQ3 A;  2QAR A;  1NJZ A;  4DSF A;  5ALM A;  3MC1 A;  2HW3 A;  2KJ5 A;  1YZ6 A;  4EEL A;  4OD0 A;  2FLP A;  2L5Y A;  1RXW A;  1KEJ A;  1DGS A;  3H8S A;  2F2A B;  4KN7 A;  3D2Q A;  2MA1 A;  3ALR A;  4DL4 A;  1LKY A;  1ZQU A;  1K1Q A;  2HHW A;  3QU5 A;  2BCS A;  4DL2 A;  3V7J A;  2KNJ A;  2F1J A;  2KIW A;  4CF3 A;  1SKR A;  2P6R A;  4XRH A;  5EWE A;  2JEI A;  4GC6 A;  2Q4T A;  5KFB A;  4ECV A;  4NM2 A;  1P7D A;  4KLE A;  4NL9 A;  2D3D A;  3BQ2 A;  5J8Y C;  2F77 X;  3AU2 A;  4I2A A;  2LYB A;  1T8E A;  5CHG A;  4F4Y A;  2ZTC A;  4TUP A;  1X6I A;  5BOM A;  1DGJ A;  4RQ7 A;  3MGH A;  2RDJ A; 
#chains in the Genus database with same CATH homology
 2Y9T A;  2ESE A;  5JU5 A;  1OW5 A;  4PZO A;  5KNI A;  2FE9 A;  1B4F A;  1DXS A;  1X9X A;  5F3X B;  4PZN A;  3KKA C;  2F3N A;  3KKA A;  2E8N A;  2EAN A;  2YTU A;  2QKQ A;  3SEI A;  1B0X A;  3BQ7 A;  2KIV A;  1PK3 A;  2EAP A;  1X66 A;  1LKY B;  2DKX A;  3BS5 B;  2QAR B;  2DKZ A;  1PK1 A;  3TAC B;  1JI7 A;  1Z1V A;  2DL0 A;  1UCV A;  2Y9U A;  2K60 A;  4NL9 C;  2K4P A;  2KE7 A;  3BS7 A;  2B6G A;  5L1M A;  2QB0 A;  4RQM A;  4MHV A;  1WWV A;  1SV0 C;  2D8C A;  2ES6 A;  3HIL A;  3K1R B;  2LMR A;  2QAR A;  4NJ8 A;  1COK A;  2KMD A;  2EAM A;  1X40 A;  2QB0 B;  2L5Y A;  2E8M A;  1UQV A;  3H8M A;  2KG5 A;  1SXD A;  2KSO A;  2GLE A;  2E8O A;  1SV0 A;  1LKY A;  3TAD C;  3TAD A;  1PK1 B;  4IS7 A;  1SGG A;  5JRT A;  1V85 A;  2LPE A;  1SXE A;  1SV4 A;  3SEN A;  3IDW A;  2E8P A;  1KW4 A;  3BS5 A;  5JTI A;  4NL9 A;  2F44 A;  2D3D A;  5J8Y C;  2EAO A;  2F8K A;  1RG6 A;  2KSO B;  1OXJ A;  1F0M A;  1V38 A;  2JV3 A;  5J8Y A;  2QB1 A;  1WWU A;  4RQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...