1SVBA

Envelope glycoprotein from tick-borne encephalitis virus
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
395
structure length
395
Chain Sequence
SRCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTGDYVAANETHSGRKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The envelope glycoprotein from tick-borne encephalitis virus at 2 A resolution.
pubmed doi rcsb
molecule tags Viral protein
molecule keywords TICK-BORNE ENCEPHALITIS VIRUS GLYCOPROTEIN
total genus 80
structure length 395
sequence length 395
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 1995-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1svbA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 1svbA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 1svbA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 1svbA03
3J2PA 3J27A 3N42F 3C6EA 5AAWC 2JSFA 2JV6A 3UZEC 3WE1A 4BZ1A 4BZ2A 5GZOA 1SVBA 5B1CA 2HG0A 3P54A 4FFYA 5H37A 1PJWA 1Z3RA 4UTAA 3UAJA 5JHMA 4AM0Q 4GSXA 2P5PA 3UZVA 4UT6A 3IRCA 1UZGA 3N43F 2GG1A 4FFZA 5KVGE 1OK8A 3MUUA 5JHLA 3UZQB 1RERA 3N40F 3VTTA 1URZA 2R29A 3N41F 4X42A 5LBSA 4UTBA 5IZ7A 1TG8A 3I50E 1OANA 4AL8C 1ZTXE 1OKEA 4ALAC 3N44F 3G7TA 5GZNA 3UC0A 4L5FE 4GT0A 5LBVA 2JQMA 1S6NA 4UTCA 5KVDE 4FG0A 2I69A 2ALAA 4UT9A 2R69A 1Z66A 3C5XA 5KVEE 5LCVA 2V33A 5KVFE 3UYPB 2H0PA 5IREA 5AAMC
chains in the Genus database with same CATH superfamily
1FH2A 2Y6SC 5K5YA 1O5PA 4HIIB 3P2BA 5IB4B 5EZPA 1UH3A 3KPQB 3P4OB 4LVHC 4P59H 3S88H 3U0WH 3DX8A 1JTPA 1X5KA 1J0JA 4L8BA 1SBSL 3O0RL 2KLRA 5ALCH 3M46A 4ALAH 3TPKA 1ONQB 2HLAA 3LPWA 1QFUL 2D7QA 2VLJB 5I5JA 2CG9X 3FQXB 5I74C 1Q1JL 3T3PE 3DOSA 1QVOB 4X8JA 1G6RA 4HWBH 1QQDB 4YSTA 3FB7B 3V0GA 1XF4A 4N2MA 3FF7A 4UQCA 2X7LA 4LEXL 2ADFH 3IFLH 4XWGH 5FAAA 1MJUL 2BMKA 4GKZB 1BZ9B 4KHXH 5HY9B 3GNMH 3TYFA 4PJ6A 2A9NL 4GP8B 3R1GH 3QDMD 3VQMA 4LLYA 4HJUA 1H3WM 3US1A 4MJ6B 3EYFA 3MRCB 2FO4A 3KPLB 2BP3A 2J5WA 4JM2C 3W0WA 5I2IA 1CO1A 1TTRA 3NVQA 2VAAA 1S7QA 3EUDA 4PJDB 5DC4B 3VWKC 1A1NA 2DY2A 2HJLA 5IHUH 4UOZA 2CK0L 3CVCA 5T1DH 1X9UA 1AQ8A 4PJBE 3HC2A 3WD5H 4L3EE 1J9TA 1JZFA 3C8KA 3CXHJ 3IDJB 5IROC 2XQBL 2XPYA 5GGUA 3K6SA 2VZ1A 5DD6B 5B38A 1E65A 3JV5A 4U6XB 4OLWH 3WL9B 2QLYA 4AIZA 3GSQB 3TVMC 4GH7B 1E3XA 2Y5QA 1HYSD 1N70A 3WYRA 3H2QA 4AT6B 2GK0A 2OW6A 4P5TB 4PTUB 2BSSA 4FC3E 1KJVA 1X5ZA 2ATPB 2XBDA 2KERA 2YD7A 3CH1A 1AGDB 3A6BL 4DWHA 1Z66A 4P5RA 5HI3C 3FQTA 3K6NA 4R7NB 4NQEE 5L88L 2VC2L 1N6VA 1VESA 4B7LA 3TVMB 1JGDB 2ED6A 4MLSA 2Z64C 4JN2A 4P2QE 3IU3B 2DLGA 3QCVH 1DZBA 2A38A 2P7TB 1LDPH 4L9LC 2W9DL 3QDMA 1O7DC 5IOPA 3V5HB 3ZQXA 3KW7A 4L1LA 2BIIA 2D4DA 3G5VA 5CJQL 4OGQC 3CDGA 4KO9A 5AQ0A 2H32A 5E0QA 3PGCA 4XNBA 4K07A 2XWBA 2M26A 4AGQA 4JFXA 3BEWB 1QSEA 1D5ZB 4KMTH 1NIBA 3GMMB 5AYTA 5L9DL 3VGDA 4LLVA 2YEVB 3QFDB 4L9LB 2X4PA 4K3DH 4AH2B 2IG2H 5BW7A 2BVPA 5I76B 1CURA 1KENL 4UT6A 4HIXL 4FNTA 3AWGA 4ORGB 2UWEA 4WFGE 1PZ2A 1U3YA 1Y6MR 1K8IA 4HEMA 1FLRH 4I8DA 2VW6A 2XOTA 3Q3GA 5IQOA 3QJUB 1AQDA 4LZKA 3CFBA 3CLEH 2DH3A 1UOVA 4NGHL 2XTSA 3T5WA 4HPHA 2Y07H 3VX1A 2CBPA 5K9JL 2IQAA 3QNFA 1DO5A 4BKTC 4XBGA 1W72B 2O30A 3EH3B 3OKLB 2ICWI 1UFGA 1OE1A 1M57B 1NAMA 1YMHA 1DQJB 7FABL 3SPCA 2ZG2A 5CINH 2FT7A 2YGVA 1KC5L 1M1XB 5BRZA 3DX7A 5AKTA 4M9OA 2QADC 6TAAA 4FQ2H 1IGIH 1DN2A 4AQ1B 5DMGD 4NHUB 4BA0A 5AZ2L 1FV1A 2NMSA 4KVNH 4NWTL 3F04A 4O02H 3COOA 3VI3B 2NY0C 3DX4A 1F4WL 2NRDA 2VUKA 2EIEA 5CGYC 1ES0B 2OCCB 4K3GA 4R5XA 1U3HA 1JZ7A 3L1GA 2VR4A 3A67H 1O9VA 1JXKA 4J4PA 3H3KA 3OKOA 3C5SA 3CGTA 5B8CA 1G7JB 4HFUL 1ZS2A 4H88H 4MXWH 2XRAH 4NN6B 2ZWYA 4UTBL 3SODB 4NI3A 4NC0B 2PCXA 4LVNB 4GLRI 4BWUA 1TTGA 4I3SL 3ARTA 4M8QA 1Q72H 1PGRB 4JPKH 3LKRA 4GMTH 2CU9A 1PY4A 3GD1C 1T4WA 3U2SA 3D08A 5CLXA 1RZJC 3U9WA 1BF2A 3QISA 1YEGH 3V0WH 1XF2A 3BLKA 4JRXD 4ZUSB 2EDWA 3GNML 2OXHA 3U1PA 2K4AA 1ZTXH 3MNWB 3KLSA 5E2WL 5C08D 3UO1L 4DH2A 5JPNA 5IQNA 4KROC 2CHXA 4JPWH 4LGRB 3E3QC 5DQDH 5DJ6B 3S37X 4G7VL 4ABUA 4QF1A 1PNCA 5E7BA 3VI4B 4MNHB 4FHKA 1KJ2H 3PWUB 1G9NC 1SMDA 4GSDH 4S0HA 2WZAA 4CN4A 2NW2B 3G9AB 4HF5L 4HEME 4JQVC 5F97E 4BGDA 5EU4B 4TM9A 3GMOA 2IAND 3EYSH 3K8KA 2V33A 1M7DA 3JBG7 3UBXG 5JQIB 1Q38A 3DXAE 5E9DA 1M7UA 1JDAA 3FUHA 1MF2H 4Y5VA 5DZAA 1TZHA 3AAZA 4CVZB 3QULA 5I0DA 3PQYE 3NCBB 5JOFA 5FO7A 3NZHL 4P06A 1IAOA 3L8QA 3UGUA 4OLWL 5HI4C 2AQTA 1XZWA 3FYIB 4IS6B 2JB6B 4N8UA 5IMKA 2QGCA 4NUQA 5JHBA 3TNMB 3DSFL 1AVAA 5IVZA 2IBGA 2PO6B 4XB7A 2XDHA 4OD2B 3BVXA 5IW1B 1CDYA 1AY1H 2YAMA 1LO2H 4HCRA 1MNUL 3CG8A 3FQYA 1QMUA 3T65A 4J3UA 1PZBA 3ULVH 1KTKE 2N1TE 5EZJA 1U8CB 3D50A 3LNFA 1PMYA 3NPSC 1ETB1 3BQVA 4HPYH 2L7QA 3L4UA 3APNA 4ACPA 2OMYB 3MV9B 2NLJA 2ZXWB 3KPOB 4J7RA 4LBEA 2BRRL 2BNQB 3N1PC 4FFZA 4G7YL 1GIGL 3O2DA 2B4CC 1O7VA 3S4SB 1KWGA 3HZYA 1AMXA 1LGVA 2VDPB 5DI8A 5EU6D 1I7RB 4QD2E 4KOCA 5CNHA 5FHAH 3ZTCC 3K2UH 5AYQA 5BMFH 1IX2A 1RK7A 4U1NA 2D7MA 5GZOC 1KN2L 3VE0B 3TN0A 5J5EA 3JWNE 4ELDA 4NRZB 1P4IH 1FE8L 3BP6A 3K81A 4LQFL 3REWA 3RNKB 1JGVL 4L9DA 3HZVB 4HISA 1EK3A 1J87A 2BS9A 3C60D 2P1YA 1FFPB 4OIIL 4KQ0A 4L1SA 4Z7VB 2LGNA 3EH2A 4MSWB 2HT4C 4MQXC 1AGFA 5CN2A 5IVXF 4GUPA 4AVHA 3KYMA 4LPVA 4MAYB 1E5YA 4AKOA 5IB1A 2CBQA 1R3JB 2EACA 1XGQA 5DZLA 4BH7A 4QJ4B 4OM0H 1LEKB 3I50E 5AW1B 4NRXB 4FQ1H 3AGWA 1J9CT 4C56E 1KB5A 3GYRA 1ZWIB 3CX5J 2ED7A 1OSZA 2WNKA 1UKQA 4ACTA 3U7WH 5IM7B 5IBTL 1JHTA 3DECA 4XC1L 4ERSL 5HJ3A 3NSJA 5F7EH 4BFJA 1BAFH 1DEEA 1NGYA 4RDBA 1JMXA 3BDYH 1IC7L 4JFVA 4CU6A 3W82A 4ODHH 1RIVH 4JNXA 1JP5A 4GKNB 1LM8V 3QEUB 4JCWA 3WFEL 4DN4L 5LXGH 1T1XA 4KKNA 2E7DA 3OR7B 1MFDH 4W9FC 2FX7H 2FBJH 4WI7A 5CXPA 3GI8L 7TAAA 4ODVL 4BBWA 2P52A 1UJ3B 5IEKB 1FFOB 3SYAA 2OMVA 2DYRB 2VLKB 3DIDA 1IBHA 3LRHA 2J88H 2YPLD 3HI1B 4FQ2L 4K3EL 1KDIA 3DURA 1XIWB 3ZYZA 3BZ5A 3NESA 4O58H 1P7QB 3B9KC 4KVNL 4O02L 4AZUA 4KVCH 4KKAC 1EZLA 1MRFH 2KDGA 2UZIL 4TVPH 3FB5B 2UUDH 3C5ZC 3IDNA 4JRXA 4N5UA 3QQ3B 1JD7A 3N41F 3VFNB 1UJTA 1PIFA 2NYYD 3S36X 1YY8B 2YA2A 1E28A 3C08H 4J3VA 3MR9A 5ETUB 5LNDA 1BQUA 3Q2VA 4M7KL 4KDVA 5D1QD 3KPSB 4K2UH 1SJHB 3DTUB 2X4RA 3MNVA 2NTFA 5DJ2B 3VFGH 2LU3A 2VSCA 3PREA 5B7MA 2APTA 1DJWA 5T1LA 3VB9A 4GMTL 3H6AA 4CN6A 1N8ZA 1Q0YH 3ZYJA 1U92A 3CWGA 1S7WB 3POHA 4LEXH 4XWGL 3MLXH 4M93B 4KHTH 2KMWA 2FZ3B 1HOCB 1I8UA 1FZOB 3FN0L 3L9YA 4EXPX 1COBA 3PDOA 4PRBB 5A7BA 1PYWB 3D25B 3H4FA 5DQDL 5D71H 3VFMB 3ECBB 4C56D 3MRDB 4OQTA 2JKWA 4IRZL 2GKIA 4UV7L 4DK6A 1H3PL 2WXKA 3TV3H 2FH6A 4ETQA 3D9AL 3O3EA 5I6KA 1V05A 3L3IB 4G6AD 1L3WA 1BBJA 4OVVA 3WIIH 4DZ8B 4R97B 1KBVA 3SE9L 5E8OB 4TYUA 4DVRH 1WPCA 2F74A 4LPUA 4X7TA 3TC9A 3T4YA 1AS8A 4OZHB 3QB7C 3MVSA 4XP5L 5KSBB 3MLYL 1BGXL 3B34A 1UB5B 4NNXB 1HHKB 1R5WA 4IOFC 1JWSB 4MMYA 1EJ8A 4LE8A 3U7YL 5ITBH 1WBZA 3HMXL 2RALA 1EO8L 1YEDB 2DDQL 4ZW8A 1AZNA 3ECVA 3GMLB 2F8XC 2BCKB 3C8HA 4PP1C 1FZKB 1AIFB 1P2CB 2ZD0A 3FB6B 1JGLH 3SKMB 4IRSC 5D8JL 3O6LL 4RSVA 1NCUA 1QUNA 5LGYA 2FIKB 2W65A 1KIRB 2PPEA 5JA8B 3DSNA 1O9WA 4K8RL 4ZOBA 1SJVA 1OHZA 3GMNA 4EI5A 2VH5L 1KYOK 3P54A 2H9GA 5DMGC 3IMWA 2HUEA 3V6FB 1Y1DA 4PRPD 3APDA 5GIRA 4FGMA 3E38A 4JAMA 1YUKB 4X0NA 4AGNA 3CFEB 1RIHH 2ADIA 2BIHA 4PRPB 2PWEA 4MA8L 4LHUD 2NY4C 3S35L 1WIUA 5TGBA 1T5WB 5JLZB 3C8DA 4HJIA 3CZGA 4NQUA 4GO6B 1TJGH 3PNWA 3S5ZA 3C6LB 4N0FB 3VG0L 1W72L 1XB3A 2W5PA 3FFDA 3GI9L 3P3TA 4MASA 4KKQA 2DWXA 2F0CA 4X6CB 1SEBB 4FMVA 5D1XC 3VQLA 1TTFA 3QPXH 3WDJA 1U91A 4H1LG 3BZFB 4UTBA 1HS6A 2X42A 4FTVD 4JPIB 4OTXH 2LAAA 2FEDD 1W0VB 4RA0C 3V4LA 5KS9E 1QVOA 5DEJA 1SXBA 3RY5A 1PAMA 4XXDB 3O2VL 5IVXB 4LMQE 5J9PB 1S9WB 1E2VA 1SOQA 4Q14A 4GKZA 1BZ9A 4JFUA 2H1LM 5B8CB 2F15A 1WBXB 4HS6A 4QT5A 3S8GB 3EW3B 5A43C 4LIQL 2P80D 4BFFA 2WMPA 3UTTE 4X98B 3W39A 3L4WA 3ARDD 1H6EA 3KPLA 3DO7B 1KT2A 5I8CA 1OF2B 4WJKB 5E5MA 4AYGA 4U4BA 1OB0A 4D7BA 3QZWB 2X6AA 3CHRA 4G7SB 1OP5K 3FUIA 2E9WA 4PY8I 2OTWB 4X4ME 5H4YA 3V5DA 4BQ9A 2D3JA 4RIRA 3ZTJH 3TBYB 4JFZH 5LCVA 4Y4FA 1BQSA 3IXAB 4WW1A 1KELL 3KAAA 2K6YA 2YK1L 3QRGL 4P3CH 3ESPA 5F88A 3FO9A 1G87A 5D7SL 5F7LB 4XHJC 2EKJA 4OCRL 3GSQA 2BSDA 5FA4A 4XMWA 2R56L 2IF7A 4XMUA 4YBLB 5F96H 4XN5A 3ZU8A 1M6UA 3CLWA 1DJXA 2DQEH 3R18A 3RTQB 1BF8A 4QAWA 3QDJA 4G9FE 2F61A 1ZLSL 1FFRA 1DQQA 2BSSB 3WFDH 4XWOC 3VCLB 1HYSC 1EWHA 1BLIA 2X2IA 3QNYA 4PPTA 3CH1B 3K74B 2ZCHH 4XO4A 2H3NB 3ABKB 2O5XH 3HRZB 4HJSA 4KUZH 1UT1A 1UZ8A 1L0XA 3J2PA 1W2KT 3DO4A 4OT1H 3RL1B 3TVMA 1JD9A 1JGDA 3U1QA 4K0OA 2WZ6A 4JN2B 3IU3A 1RMFL 3VXMB 4ANVA 3EO9L 4ZS6D 3QDMB 1X7TA 2J6WA 1ZA3A 2YRLA 43C9A 4XVSH 5KVGH 4NNPL 2EE6A 2WVVA 4IMLA 5A2FA 5E2WH 1XEDA 3HRZC 4HJ1A 2GJRA 3UO1H 4F1SA 2YUXA 4PU2A 3QUKB 3QHZH 4IBYA 1NFDF 2FECL 5D93B 4UV7H 2WCSA 3ZKMD 4MJIE 2VLRA 1N6QH 1HH9B 4GSDL 2VTFA 3S8FB 2F2HA 3L4XA 4HWEH 1MXDA 3PHAA 3K1DA 5EDSA 3EXJA 4FNUA 4GLRH 2WNGA 3BAYA 3PWVA 1K8IB 2J5LB 2QKSA 4PRDB 3MUJA 3ZT7A 3FF8A 5JXEA 1AQDB 1UH2A 4CC4A 2VDPL 4U2ZA 4UIKH 2E86A 4RGNE 1UD4A 4FFYL 3EOTH 4WI2A 3D2TA 3FU9A 1ILUA 3ZQWA 4MNGA 1OSYA 2XKNB 5C0IA 1DVZA 1ADQA 3VFOB 3QIBD 2J44A 4ZD3L 1W6WA 5L2KA 4GG8A 3GM0A 5C6PB 2ZXEB 2DQJH 2OQJB 4LSTH 3AQZA 2HH0H 1S9YB 4Y2OA 2HVBA 3N55A 1M6OB 1NAMB 2SEBA 1TQBB 4RAVA 5E1QA 5FEBA 2OJEB 4KKBC 5K9QG 2YD4A 5EOQH 5GSVA 1L7TL 3VXNA 1PLGL 1X5GA 2IV9A 4XX1E 4PV8B 4PWIA 3BFQG 2VXTL 4PJIF 1GIGH 4PRIA 3EYUH 1H3TA 4EUPA 5CBEB 3FCBA 3U1SH 3F7YB 3WE6A 2CO6A 5DZPA 4X2UA 5C0JA 3WUWA 4LIQE 1GS7A 5IIEB 1OAQH 4IBSA 2K3HA 3CFIC 3GK8H 2FLBT 3FQRB 2R0KH 2AHIA 3WDHA 1YEHH 4MDRA 1ZT1A 2NDFA 4E9LA 2D03L 3L1FA 1CGYA 1VPOH 2P5WD 3A6BH 4HLJA 3OB0K 5D7JC 3SE6A 3D18A 3D2UB 4ECNA 1HK6A 1UD3A 1YJDH 2CM5A 3NJIA 4F1ZA 5AW3B 3ARZA 4ZS7L 5SX5K 2RH0A 1HZKA 2YZ1A 3TO4A 3PL6C 3R19A 2CD0A 1U8HA 2RBLA 2H2SD 1VEMA 3KLAA 3UEZA 5J3HD 4NN7C 4P2RD 4YHPA 3PXLA 2ZX8A 4P57B 25C8L 2DF3A 1BQ5A 1NUNB 4J39A 3RDTB 1MI5E 3WIFA 1HEJC 4OFQA 1GPOL 1II4E 1YEEH 3B9KB 4PJDE 3M6DA 3L5WB 5HHOA 3ZBMA 2F7QA 3C5ZB 4Z95H 2VMFA 1OQXA 2G9HB 2CJ3A 5EU4A 4BFKA 2GHZA 2XG4B 1BIIB 1RJZA 4XR8C 4JVWA 4IRSD 5H4ZA 5KVDH 3ZTNH 3FOMA 4E41E 3FU7B 1VFAA 1P53A 2DQFB 2MHAB 1X9QA 1MCEA 2OBGA 3MX0A 4YK4C 1N7ML 3HBZA 4RRPA 4Z7WF 1OGAB 1EO5A 2VQTA 2WHVA 3BEVB 5C0AE 4GBXD 4MHHI 1VIWA 2P5WE 4NBXB 1VADA 3TBTB 2FAUA 5E99H 1PZ5A 2R56H 3NFPA 4IU3B 4BKLA 3IVKB 1KFGA 2OYKA 1E8ZA 4ANWA 2A7BA 1H9DA 4WZ9A 3VYPA 3DA0A 1J88A 4F7MB 2VDOH 4WU7A 5KVEL 1GYCA 2EXSA 5JHLH 5FM5M 1H3UA 5K33A 2YKLL 5GJSL 2BZDA 2IOMA 1MCFA 4WKXA 2H2PD 3EJPA 1TTCA 2PP8A 1U8IA 2B1OA 4J1UB 4ZS6C 1MOEA 4TNWF 3TIDB 4BGLA 2DQIL 4WQOA 2Z8VC 1KXTB 3GO1H 5E8PB 4JFYB 5I9QC 2VM9A 5C0RH 1MI5A 3Q2NA 1CG9A 4H1LB 2QSCL 3DOHA 5HHQA 2W0PA 1NEUA 5KBMA 3CU7A 2MRYA 3UTSD 5PCYA 3QFJE 4V11A 4I0PC 4M43H 2IADA 3REWB 2H1XA 3BP6B 3RNKA 3VWJB 4ELKB 2XFGB 1VF5C 4PP1D 1N5YL 5CJOH 3GHEH 3IK2A 2ZOTA 5E1AA 4HKZA 5F1IB 5C07E 3D06A 5AFAA 3I02A 1YNLH 1GTNA 5EWIH 3ZGHA 1NZRA 3TZVA 4N0CD 3TEYA 4HH8A 4WEBH 3NGBB 1WAAE 2Z35A 1J5IA 2R8SL 3L4YA 3KL5A 1O6SA 3QRLA 2MQGA 2R2HB 4JDZB 5IB2B 1F3JB 4HJJH 1GAFL 1J8RA 4WCYL 5ILTH 3MTRA 2HLEB 4ZUWA 4LCYB 4D9QE 5AG9A 1KEGL 4G7VH 1OZTG 1FVEB 2R69L 3KYNB 4L1HA 5JIMA 3OR7A 1A4KB 3MHZA 4WJ5A 1UD6A 1WAEA 2MCPH 3VGHA 1TEGA 1A6WH 3T0EE 5G4NA 3V4UL 1CXHA 5D1XB 1YMME 2BY0A 3GEWB 3OKNB 5EZLB 1J11A 1DFBL 2VLKA 4G7RB 4OLYL 2OA9A 4N8CL 5AWNH 1BPVA 1GZPB 2OTUA 1IZJA 4FQHA 1RUMH 3HI1A 4TUJB 4DPAX 3MODL 5D7JA 5AVWB 2FQDA 4F7EA 4GI9A 4MA8H 5D1QE 4F91B 4XNDA 4MYPA 1J1OH 3N85H 2ZYSA 1H0DA 3VD7A 4HMEA 4KITB 1AR1D 1KB9J 4V1DB 1MCBA 4GQQA 1QFWI 3NRQA 1J05A 2DQ6A 3HHSB 1E28B 1E5CA 2HRLA 3MR9B 4GNKB 5BQDA 3LQMA 1UQSA 5AVYB 4TSCH 1CVRA 3KPSA 4GG6E 1HX0A 3G5ZA 4XBPA 3UAJC 5EN3A 4JG9A 4KJWD 4OCSL 3NCJH 4FLRA 1T80A 4OLXH 4H8VA 4PB0H 4NO0B 2VLMD 4RBPK 2AQ1A 4D9RD 4I0CC 2A6KB 2PPCA 5C6WH 1AS6A 3PGFH 2NTSP 5IGXH 2QHLA 2QSQA 3HAEB 4KKLC 5TF1L 3VD3A 5KYXB 1JZ6A 2WXMA 2NX5D 1WE5A 2VQUA 4MS8C 5C2UB 1LK3L 3IKKA 1A6AB 3N6YA 2W60B 2XN0A 4DKAA 3ECBA 1BVNT 3N0AA 3QEHA 4MMXA 4JY5L 5JR1H 3FT4B 2CPUA 3WS3B 1OAKH 2WWMC 3QWOA 5C0FA 4DZ8A 2WSKA 3GT6A 3QIWD 1UC6A 3CZKA 4BUQA 3FH7A 2F74B 4JHZA 2VMDA 2XI9A 5FGCB 1F6FB 4K7PX 2OK0L 3TO4C 3QW9A 4YXHL 2HTKC 4JFZL 5KSBA 1ZGLM 4HW6A 1R5WB 1OK8A 1JWSA 4KUCF 4MMYB 5TJWK 5HYIA 2R2EB 4M6OL 5CEXA 1N64L 3ZKXB 3WXWL 2CDFA 3NJMA 4ERSH 3LRMA 2XQYG 5DFVD 2DL9A 3H9YA 3PJLA 3QNZB 2AJSH 3DX6B 4OQTH 4AV0A 2Z3FA 3DSNB 5KVEH 3X3GL 5EO0A 2NXZB 2BNRD 1PZDA 1HTYA 3GMNB 4XNXH 4YZWA 4LL4A 3AITA 3G08B 4ZK8A 1BD2A 5E8NA 4HUNB 5EOCH 2YQBA 2EEFA 3HG5A 3MRHB 1KCRH 4FQXD 4HFWB 3ESMA 4J8RA 4NZ8A 4ZODA 1YC8A 1E8WA 3VFWB 3INOA 1INQA 4AYMC 2UY7B 2WBJD 1NAKH 2CKBH 2DWEB 4G9DB 2ADIB 2IPKA 4XNZB 3INUH 4L37B 3O3DA 1OSPL 3PPSA 5C86A 1R3KB 4H7VA 3FT2B 2HRHA 3ZTJG 4HIEB 1T5WA 3AWFA 5E4OA 1D9KD 4XP6L 2YBRA 5I30H 2DRUA 3FCUB 5B39B 1BAGA 3IPBA 1AKJD 3QC6X 2P8LA 3DJZA 4LNVA 2VN5A 3IYLW 1T3FA 5ESVB 3EHBB 4IOFD 1B88A 1HL9A 3WY2A 2VIRB 1YEFL 3D69A 2ZCZA 1ML0A 3QXAB 4YDVB 3EHBD 1EJFA 4L8CA 3AY2A 3DVNA 1HH6B 2LTQC 1TYEB 4MMZB 2APBA 4ZO8A 3G5YA 4JUTA 2G75B 4G42A 3ALXA 3O11A 4XXDA 4R0LA 2G5RA 1I4FA 1MCDA 2CAKA 2YD8A 1S9WA 4ZX4A 1KBGH 2IQ9L 2TSAA 3VRJA 5L4FA 1GHFH 3Q06A 1W8NA 2TAAA 3IN0A 4IGBA 4OF0A 4ZUUA 3ZKMC 5HJBA 1OWRM 5CGTA 1ADWA 2EDTA 2F53E 5I66A 2R1YB 3UYOD 5HDOA 4YUEL 3TCLB 4YX2L 2BP8B 2FD6H 1BJ8A 3RDJA 4Y9GA 3JWNH 5FUZL 2BVUA 4MAYC 3UDWA 1LWJA 2OTWA 3M8OL 5EOQL 4GSQA 4I2XB 1HHHA 3K2KA 5JXED 2Z8RA 4FXGB 4KI5F 2B2XL 2WGXA 4OGAD 2D7OA 3MLYH 3TBYA 4JB9L 3BN9C 4OFVA 2VW4A 1KIPA 4G6FD 4YWGL 5LG1A 4JQVA 3MO1A 2PR4L 4AL8L 1XTMA 1JHKH 2HPOA 2WQWA 2Y1YA 2ZP9A 1SY6A 3C5ZD 4XMPL 5D8JH 3RGVA 4LMQI 3QP3A 1B4JH 4FXGC 3QDJB 4RBPH 2GUOA 4J3OC 1DBAL 1KTRL 2XA8H 3W38A 5EEYA 2VH5H 3JWDC 3KGSA 3RVWD 4QOKD 2H3NA 5F9OH 1H15A 2X89A 3T2PA 1MH5A 2L7EA 3VXSB 3SKJH 4H8UA 2WC7A 3SBQA 3RIFK 3HMWL 5JIHA 2AXGB 4IBZA 2XPGA 5EIQA 3BH9A 1P6AB 2GPZA 1OHQA 1K6QH 4KO7A 1L6XA 3DJ9A 2QMKA 5GS1A 2ZNXA 2W94A 1ACCA 3T0EB 4IIQC 4YDJA 3VTMA 4DKFH 3EH5B 5HI5D 2ICWB 1AR1C 4PG2C 4LRNH 4GAYA 1HH9A 4BFNA 4FXKA 5DJAB 1KTJA 2ZWLT 1T6VN 2NY3D 1N0XH 3ZKSD 3SO5A 5F1SA 3MTXA 4JS7A 1WF5A 1PZSA 1U93A 1V55B 1I8KB 3U4EA 3ZHLA 5A1AA 2Y36L 1B6UA 3G6JB 1E9QB 3U4AA 2BK8A 1TU2A 3BKJL 3PWVB 5ADOH 1A2YA 3MCKA 1ZANL 2EVGA 2LLNA 1CYWA 1UXLA 2DBLH 3FBKA 5AYUH 3O2VH 2A74A 2AK4D 4PJCF 3CC1A 3CHPA 4N25A 3MZGB 1PBYA 3VWJD 3L1OL 1AHMA 4TSBL 2EE0A 1HNYA 2NZ9D 3R1GL 4Y19A 4KC3B 5FHBL 2XG5B 1DJHA 3QH3A 4QGTA 2O6DA 3DI3B 5TDOA 1HDMA 3F7PC 1L9TA 1A6VH 3QAQA 5JQ6H 2E6PA 3CPLA 5DZNA 35C8H 4JFOA 3JWOC 1IAIM 2OJEA 3SGKA 2X53A 3W9EA 4W81A 4C4KT 1WC7A 3EJRA 3BCFA 4FG4A 5GS3A 4AJYV 4P2CG 3X17A 4IRJC 2I60H 2Y2TA 3JVFC 4HUMB 3MNDA 2A9AA 1CI5A 1G1YA 3WUWB 1IRAY 4M02A 3RU8H 4F57L 1HHGB 1XZ0B 2M83A 3C6EA 5DRWB 3SYPA 3T08A 4DVBB 5E2UL 2V9QA 2NNAB 5JIQA 1UM6L 1MKFA 2QQLL 1OCWH 3QJTB 1LLAA 4YL9A 4RAHA 1G7IB 1NFDB 1E6JL 5E70A 1ZSHA 3MREA 3R4RA 1W0YT 3X1GA 2ADGB 1DVFC 2XKUA 1NFIA 2EKSB 1CK0H 1T66D 4UAHA 1G0YR 1G7LB 4F8TA 2YKKA 2EYSB 4WEEA 4D8PB 1S3KH 4BCYA 5IY5B 4HX1A 1OGTA 3AW5A 1AGBA 4PS4L 4JFEB 2JTYA 5B3NA 3OAUL 1KB9K 4NUJA 1TVDA 4P57A 4Q2ZA 5EZIH 5TQ2L 3PABB 3NSXA 3PWPE 4J3OF 4WCYH 3GKWH 5TK4A 2R1XB 3U9PH 3H9SB 4YSCA 1ILSA 1JGEB 1KCSL 1PKQB 3C5ZA 3AFLA 1NGZB 2VABB 4NENA 3ZLQC 1SVZA 1OB1A 2NYKA 5C0DA 3OAYK 2J8UF 2ORBL 2IG2L 3ZT6A 4NN5B 2V5YA 1BIIA 2NY5H 2CHWA 4NSKA 3MRNB 1E9OA 1XHHA 2DQFA 4N1EA 4Y8DC 1KTDA 3N1GC 4MRBA 4S1DC 4PJAA 3QFJD 1KYAA 2A9CA 5IV2A 1R3HA 2AV7B 4Y89A 1DLHB 5F1KC 2ALWA 3BEVA 3C2SA 3H4HA 5AVZB 2OSWA 5D1QC 3ZL4L 1EBAA 1VHPA 3OZ9L 4UB0H 3AG2B 3L3KB 5DK2A 5SWQA 3BWZA 1JK9B 1JUFB 4QRAA 5G4MA 1XGYL 1A6PA 3B8SA 1QP1A 3L3HA 4OZFH 4XXWC 1U8MB 4LKXA 2CJUH 5EMYA 3QO1B 1MUJB 2EDFA 1PCXA 2XA8L 4S0SD 4QHNA 1KPUA 5DTFA 1MFMA 2AZAA 5IBLC 1UOWA 2EIDA 5F7DA 1EUTA 1FJ1A 2Z0BA 4Z7AA 1PLGH 4ZXBB 5D7KE 1JGUH 4K23L 3SKJL 4Y1AD 3TYGL 3RKPA 4M6NL 2XLLA 4JMNA 4PB0L 1F00I 5D6CB 4GG6A 2RACA 1TITA 1ZVSB 5LBSA 5J13B 2HN7A 4O9HH 4G9FA 1QA9B 3ECQA 5ISZB 4OJDH 4FLQA 2R9HD 3MUGB 1XF5B 4ES9A 5HHQB 2D7NA 2X6UA 3V6OC 4P2RB 1JE6A 1X5IA 4P5MA 3T9WA 2EC9T 1CCZA 4KNQA 2P44B 1NCOA 4HKJA 4LAQL 3ALWA 4NKDA 3TA3A 3PE9A 3J27A 3SBWA 2VDKH 1XSOA 2YAOA 3MRFB 4M7LT 5C9JB 4TLKA 4P46B 1RZGB 5GISL 2J6EH 2EO7A 5E1AB 2CCVA 5F1IA 1KLGB 5F3BA 2JB5L 2GIYA 3L4VA 5DS8B 3AGVA 1U3JA 3BLBA 4JFHD 1M4KA 3TWCH 1XR8B 2X4SA 4FQIL 2YAHA 4M1DL 4WGWB 3IFNH 4YE4H 3CFNA 2J8UE 3O6MH 1IC4H 1OPGL 3OG6B 3MACL 1CTOA 1IAKA 5AL8A 4ELMF 4PG9B 3V2AR 2E9GA 3H9SE 1A47A 2CDEA 3A4EA 4FEIA 2WXGA 3OHXC 2R2HA 5IB2A 2A4CA 5IREA 3M7FB 4PCTA 3BWAA 4JZJB 4F7TA 3DETD 1D6VH 1ZIBA 3VG9B 3G04A 3FBQA 1RSYA 3CSBA 4ENZA 3SDCA 1INDL 5MEOB 3ZE2B 4PJXE 1MVUB 3PJNA 4GYBA 4L4TE 5ID0B 2JCCF 3F12A 3D39B 1H8SA 2PCFB 4MWFB 4IKKA 3KM2A 3OKNA 3V7AG 4BRJA 2Y1ZA 2E5EA 3F5WB 3WD5L 3DV4B 5JW5B 5JOPD 3T2QA 1GZPA 1SLVA 4A6YA 1RULH 3S37H 4QAMB 1Z5LA 1IGIL 1WA2X 5AVXB 4EN3C 4JZOB 1U58B 3DMMC 4X5QA 1ZLDA 3UTSB 1E42A 4K7PH 1H5BC 1QAWA 2A73B 4DF9A 1H8LA 3I2CH 3RB5A 5FUOL 3MV7E 3DDGA 2VRKA 5IK3A 3KXFB 3DVGB 4ZMAT 2IAMA 2R2CA 3E6HA 4OAWB 4PLJC 1NIDA 5HVFB 4NLHA 4OBRA 2V2XA 2VDRB 3HHSA 4GXUM 2DQTH 4FYRA 2JIXD 4QRBA 5TDPB 5D2LF 2X2YA 5IT2H 4BFIB 4WKZA 4R7DA 1UQSB 2PKDA 5JHDA 3DMMB 3B7SA 4UTAL 2DM7A 1NCJA 1KGUA 3HJEA 4H5SA 3VNYA 4G5ZL 1HESA 1BQHG 1CL7H 1CFNB 3GSNB 5D6DC 4CNIA 1U8NB 2F58H 5KYXA 3HAEA 3E80A 4K94C 4TULL 3U7AA 4G5AA 1KOAA 1FCCA 4DAGH 2DKSA 2GBVA 4QLWA 1JPSL 4U6VH 4ELME 1WH0A 5AKVA 3V4PA 2P43B 5TPWL 3UACA 4G11A 4TNEA 5C7XL 5FM4A 3O9WD 1CF8L 3QWOB 5C0FB 1HE8A 3GHEL 4HGMA 5C0CB 1FL3A 2MFNA 1FVCA 1B3IA 2R23B 4WV1B 3C9NB 5FYKE 4GAFB 4MJID 1P4UA 1S7XA 4MJ5A 4IEFB 4LVOB 4JRFA 3LZPA 4N8VG 3TJHD 5DT1H 4AQ8C 4AENA 5FCUL 4MJIB 2R27A 3FUMA 3B43A 1NCAH 5EOTB 1FL5B 4PY7A 4E5XB 4QI3A 3P9LB 2MCAA 3EFOB 2X9XA 5DRZA 1AACA 2J43A 3OJ2C 5DZOA 4HK3J 3P11H 5F9WC 4NZUL 4XO3A 1T89A 2XX0A 1DQKA 2HFEA 1XXFC 1KBBA 2CUHA 1YNTB 3S5LG 3CX2A 1QBMH 2N0KA 3HG1E 2FX7L 1AR1B 2KL6A 4JLRB 4J3XA 2XJLA 3B37A 1R3LA 4PWFA 2BNRA 2XX1A 3LS4H 4W9LC 2F08A 1R4XA 2C1OB 1KYOJ 1GSMA 2P46B 3P9WB 4R83A 1T5XA 1DQLL 3JWOL 3QIUB 3MRJA 3MODH 1IBBA 4O9HL 1IKOP 5ERWB 4AQOA 5IW6A 2NY2D 1YG9A 2PP9A 4HIEA 3VXTA 2UVFA 4E9YA 2HSIA 5FLUA 2ZAHA 2JSFA 3AS2A 4ABWA 4HIIA 2P8LB 1UCTA 1A1OA 3P4NA 4J12A 4PGDB 4PGCA 3D4YA 1AP2A 3SDAB 5FV2A 1F2QA 4U3SA 1J5OH 5E5UB 4MXWL 1HU8A 4A55A 2YPKA 4PG2A 4PI2A 2HJFB 4FQ1L 2AW2A 1LP9F 4G80B 5C3LD 1M1SA 3P4MA 2EDMA 3CDZA 3K6FA 4U6TA 4FAAB 4XN4A 3CQPA 1AKPA 2BMKB 5AAMC 4N3TA 1J7VR 3H8NA 4K7FB 3F01A 1I1AA 2FLMA 2J4WH 3KHOA 4TVPE 1IC7H 4U6HB 2XTJE 4LLYB 2YQ3A 4LNRA 3AU0A 5CEYA 4L8SB 5JW4N 2AKRA 1INDH 4M8RA 3V4VH 4NQQA 2FUQA 2YMOA 2H26B 4L8DA 1HIMH 1J48A 4ODSH 4UM9B 4KNUA 4LASL 3NJJA 4HGWB 5KYUA 2WSDA 2OS7A 4FYQA 3BCDA 1P4BL 2WXQA 3CZLA 3GMPA 4N3UA 5C07B 1N19A 4HQQH 1DQTA 1CLOL 1ZT7A 4LP8A 1HKLL 2H0JA 5I1CL 5KBDA 3KNBA 3SCMD 1HC1A 3PAYA 1MJ8H 1UGNA 4AIZB 1J0HA 4Z7OB 5FOBB 5INDA 1MRFL 5LHDA 4NP4H 2YOCA 3EDDA 4U4IA 3GSWA 4N68A 5ESAB 2C9UA 1ZPLA 4PTUA 2PPFA 5JPMC 2VDNB 4XPFL 1QSZA 3HNVH 5D72H 4LVHB 3RGVD 3EJYD 3QC5X 3RRQA 4BDVA 1YPZE 2LR4A 1ND0B 3UX9B 2WUCH 3JSSA 4U1MA 5IUSA 1A65A 1WUZA 3GRWA 3L17A 4WO0A 5AALA 1V27A 1IAIH 4LXFA 3IBOA 3KPNB 1Q0YL 5KBKA 4A6YL 2XPGB 4PUBL 1DBBH 1YAIA 5E4AA 5JPMB 4OI7A 1VLXA 5EUOB 2ZWKA 1T0MB 3LHPL 3V5HA 3FU3A 4MQ7B 2WLIA 1KXQE 3RUGB 2CALA 2JWYA 1RZ7L 1SLUA 3LIUA 3GIZH 5IFHH 2ZP0T 3L9BA 5LAXA 4AQEB 1DBJL 3O6KL 4XWOD 1N10A 2UZYA 2QKIC 3QFDA 2V7HA 4NUPA 4BIKA 4DVRL 4ZZFA 4UTAA 5C0GA 2JK5A 1PPIA 4F37K 4F2FA 5D7IE 2XQYK 3HR5B 3Q8CA 4ZOCA 2AXJA 2K4WA 1A7RL 1F18A 3Q3GB 4PBVC 4EAEA 2EDXA 4DP5X 4HS8H 3RAJH 3LPFA 1WTGT 3L5HA 3U7WL 2DWDB 1PX4A 3LXBA 2J72A 2O6FA 3QIBA 3F00A 3CXHK 1WSST 5AW9B 4HKBA 4EJ1C 1SMOA 1A6UH 4Y5VC 3U30B 5CWSA 4N2CA 5EZOH 3VMOA 4QHUB 4BSWA 1I9IH 1KIQA 3U2IA 1SM3L 5ECJE 4NRYA 2QVMA 3NIDF 4D0BA 3LVEA 3FZUD 1QBML 3ISWA 1KGCE 4JO8A 1MEXL 1XGUB 2WKLA 4HUWA 2X2UA 4AEIL 4MNQB 3B4NA 1AXSA 4S1RL 2F5AH 1CFTB 2Q3XA 4I89A 5KYWA 4YHOH 4AQ8A 5B7FA 3IETA 3RL2A 2BNUB 3CFUA 3GSNH 3MROB 4RGOH 5I6PA 1A9VA 5A40E 4OI9A 5D7SH 2F54B 1UB6B 3PHSA 1AGCA 4PVNA 5L8JB 4PJAE 5A16A 1QNIA 1RJLB 1JHKL 5DRWA 5L4MA 4DVBA 3IXTB 4ODUA 4WFFE 4PHZA 2HYMA 1F4XL 4DGIH 1ES0A 3VD0A 4Y5YB 1JZ4A 1GOFA 1NFDA 4PLOB 3EZ8A 3C5SB 1MFEL 1JPGB 5AAMA 3I9PA 2Y4SA 4Y1AA 1FNEB 5BRZE 4ANUA 2HXAA 3I75B 4LHUG 3BGFC 3OWEA 3MRKB 5KG9B 2PLTA 1KXQA 2EYSA 1QFWL 4N2AA 4P9ML 3BAWA 4JHAL 4M8QB 4D8PA 4WTQA 1AGBB 3TFKD 4JFEA 4CDHA 2K6ZA 3QI9C 1QD0A 3MACH 3TT3H 1HWGB 4W4NA 4NUJB 1XF2B 3BUQA 3KXFD 4U1LA 1IL1B 4CUCA 4DP2X 2J4WL 3MXVH 3CZFB 4L3EB 1FRGL 2VLME 4AKPA 1NM9A 3A47A 3FFCD 5I18H 3FSZA 3PWUA 1KLUB 4RGNB 3GBDA 4ONHB 1HQRA 3CPUA 3TN0D 4FJZA 2QZQA 4WK4B 2WQSA 1SDDA 1K4CB 12E8L 3MRGA 4CBPA 1V5JA 1FNAA 4WWOA 2UZXB 3W9DA 4B3EA 4LSDA 3BRGC 3DKHA 3FT9A 5K1NA 1E9OB 4MGXA 4MMZC 4GEJA 5ES4B 1CFSB 1IJNA 2OR7A 5CP3H 3SPGA 4PMEA 4CVZA 5DJYB 3QULB 1ED3A 4HXBL 5D7HA 2EXWC 5CLZA 2AV7A 1DLHA 2CHNA 4GP5B 1ASPA 4GUQA 4LU5H 3QFJA 1RERA 2AQNA 5IMKB 5JTWA 3DUUA 1YY9D 4E0RB 1CLZL 3IGUA 1OANA 3EOAA 4LSVL 3STBA 4Y2DD 1GTFA 2PO6A 1N0LB 2HVKB 3FN9A 4Y16C 2CR6A 4OCYH 4PBDA 5KVFH 3RVVC 3ULUH 1NUDA 3F64A 3OB0H 2F1EA 4HC1H 4QXUH 1I8LC 1YEJL 1CZ8H 1MAJA 1ZV9A 4ZXBA 1IFHH 4LBEB 4H4NA 1NEZG 4O51B 5FYJE 4B7IA 5ACZA 2WLYA 1FDLH 3LQAH 4PJ5D 3NUKA 5DD3L 4BM7A 5E94B 1URZA 5F71A 4RAUB 3WAKA 5KZCB 2KZKA 4GSUA 4LLUA 1C12A 4LCCC 2V9UA 1XH3A 4X6EB 2VXSH 1XF5A 1ZGLP 4QRRE 3OQRA 4K5OA 4WUKL 3HN5A 4KAQL 4PYHA 2X1OA 4H8HA 5AAPA 4NB7A 2GCYA 4A2DA 3WJLC 4MAUH 3K8MA 1E8YA 3IDXH 3B5GA 1C1EH 3GRWH 4I13B 4NNYB 4UQ2A 4MAZA 3X12B 4EDWL 2HZHA 1AI1L 2AXFA 2DMCA 2CO1A 3F6JA 3GSOA 3OC8A 4X7CC 5SWSE 4F7KA 5DS8A 1CL7I 2X4TA 3W0WE 3QEQE 1KB5B 4BZ2H 2NX5A 4BELD 1RK1B 4N2OA 3KLHD 1G1KA 2ZCLL 3O8XC 5GRVK 1JHTB 5ELIA 5KOMC 4BQ6A 1NEZB 4FZ8H 1CLCA 2LVEA 1AE6L 4YDLB 2Y6SD 2EDBA 3LEXA 3ARDC 3SDCB 4GKNA 2QPSA 3MNZA 3V5KA 4X6FB 4WK0B 3GZQA 1UXWA 4I77H 1WGOA 5ID0A 4I9XA 1CIDA 3FTVA 4C56A 5E6ZA 1A1MA 2WJ5A 2R0ZH 3CD4A 4ZMZA 5IHLB 4ICWA 5CINL 2HVJB 3FTZA 4IGBC 5MI0C 3KPTA 3BX7C 2DM3A 4G1EA 1TSRA 3DV4A 5JW5A 2V4LA 5E51A 2EEBA 3BHBB 5GGVY 3F3HA 5ENWB 2P26A 3V52H 3QQNA 1O75A 3U6XS 4GQPH 4UDUB 3A4DA 2Z6FA 1X4XA 2N3JA 1L7IL 1TYJA 3SGEI 2FH8A 3NQKA 4UAOB 5E2JA 2DICA 1AFVL 1SY6L 3B9DA 2WQAA 3BPLC 4I2XE 4EDXA 5CEZH 4Y16D 1OD9A 2IAMB 3E6HB 3QQ3A 3N40F 3D12B 1INEH 4YHMH 3QJZA 1HI6B 3IGAA 1EMTL 4BFIA 5FWQA 1CS6A 1M2OA 1WT5A 4GRWF 5T1MB 2JFCA 4NO3B 3OV6A 5F7WC 3MNVB 2NTFB 1JGUL 4IM8A 4JGMA 4K23H 3EYOA 3UEQA 4R4BA 3HC3L 1EFXA 1RZJH 4GEIA 1O9ZA 1LEIA 1EHLH 1CFNA 2GJPA 1ODUA 1N8ZB 4YHYB 3SD5A 1J8HB 2Q3ZA 1G7QB 2C9VA 3HE6C 3KWWB 3PV7A 2AQSA 2MTAA 5BRPA 3W56A 4ELMB 5CJXA 2XNAA 1FZOA 5LBGA 1FH5H 5IMLA 3MV8D 1X7SA 1UT2A 1DZ0A 2XXGA 3ASOB 3BOVA 5CEZE 5ANME 2MMXA 3WHXB 2X28A 2ZKHL 1JXDA 4S10A 4YSAA 3F58L 3VXRD 1Z6JT 1BBJB 3RB7A 2EVHA 4PJ8B 1NANH 5JDSA 5LGJB 5C0CA 1X5YA 2BFGA 4PJFE 3DBSA 5GISH 4HWZA 4ADJA 5GGSA 2WUBH 3C9NA 4F5CA 2XETA 2XICA 4OZHA 3O3BB 4A2FA 4XMTA 5I16A 4WW2B 4P05A 3WN5B 3PRZA 4EE2A 4PY8J 1HHKA 1NQBA 3CFKB 3KEHA 5FYKD 3ZDXE 4OD3H 2Y1VA 4MJIA 4E9WA 3NPSB 1GL4B 1VB9A 4L0ZA 1A64A 3ZHDA 1YQ2A 5I8OH 1AIFA 4JVUA 2XKSA 3EXLA 4JRYB 4X7EC 3UP1A 1MCWM 2HKFL 4U33A 1E30A 2PXYC 4QYOB 3VFTA 1S7TB 2J20A 3BAXA 5DHEA 5ITFB 2G3MA 3UTPD 3UTQA 4YOKA 2WXFA 4BINA 3ATFA 3B8YA 5T3ZL 1GGBL 4JLRA 2YLHA 3SJVB 1KG0A 4EMZA 2HTLD 3KDMA 1HZHL 2GSIA 2QTEA 4LPXA 3BGMA 2O93L 2C1OA 5GIRB 3US0A 1U8OA 2YQ2A 5IBUB 3MRJB 3CN1A 4XZ4A 4A6YH 3GO1L 3WJLA 1QWUA 2ZTBA 3NZ8B 4QHKI 3R7RA 2E3VA 3AZUA 3U1SL 4N2GA 4ZQKB 2O5ZL 4BRVA 1ESOA 5IQLA 1KN2H 2ESVE 1BEYH 2XN2A 4NQEB 4Z3HA 3C6LA 4N0FA 3AT8A 4JO3H 1NBQA 2V5RA 2XC8A 3O8XA 2IDSA 4HH9B 4ZSOA 3UMNA 3BWUC 1CDBA 2OAAA 1IE4A 3W11D 2RMNA 5DQ9A 1FO0H 1OTTC 3BZFA 5DEFA 2VLLA 2ZJSH 1QTSA 4YH6A 5ALBH 2Y7NA 5EFIB 4PJXA 4BE6A 2OMTA 2F7PA 4FFTA 2V5MA 3I6LD 4ZSOE 5J9PA 5TF1H 2E76C 2C9XA 4FLSA 4E36A 2VZOA 2BP5M 1OZUA 4ZW5A 3O6FD 4N2LA 2E7LC 2R0WL 4FS0A 4D0CB 3DIFB 1P9MA 2G5BA 1XEUA 2WMPB 4L8SA 3U48A 2R69H 3V4PH 3W39B 3E9TA 4I87A 4PJEB 5E2VL 1LE9B 1UKSA 3BJ91 1KT2B 1OF2A 3T3PB 5KS9A 3L9EA 1NCNA 1FBIH 3GTTA 1NKOA 4L8DB 4W6YB 5C3TA 2ARJB 4XMVA 1TQUA 2FQGA 4AV5A 3K3QA 2P49B 2QGEA 4RIRB 3ASNB 2CDGA 1PCSA 1CFMA 3RVTD 2N56A 5F8QC 3IXAA 1BQLH 2NY2B 4M8VA 2C5DC 1MJ7H 2ZOLA 3D6GA 4N0RA 3V52L 5F88B 4JM4H 2E7MA 4XMKL 2JQAA 1JZ8A 2BJMH 1RZKC 2EAEA 4EI5C 4QRQB 5INDB 5DQJB 3AB0C 5DUMH 3X1BA 3DLQR 3GSWB 4NM4L 4OFKA 4CVUA 3LNHA 3RTQA 1R17A 5GRXG 1MLBA 3V4VA 1R75A 1OAXH 4LCWD 2Q6WA 2VDOL 4AC4A 4HU2A 4PJIE 1O7SA 1ND0A 3QZLA 3AG4B 1NOFA 2Z7ZA 2GBTA 1R5VB 4LLMB 4LCWB 3PFUA 3G9VA 2LLGA 1I9EA 3NCJL 2ZUVA 3VI3E 4KJYB 3S34L 1BP3B 3CFTA 3JWOH 2Y7MA 4KVPA 1DYZA 3QORD 1F0LA 1W0WB 4NO2A 3ZE1E 1G5AA 1ASOA 3RUGA 1YMMA 2WVVB 2NR6C 3BMWA 4KMLB 3V0HA 2J2ZA 5CMAA 4X0KB 3QR1A 3B9VA 1S8DA 2BSEA 2HB0A 5JW4M 5JORA 1J1PH 5LAXB 4IRZH 3CQQA 1F42A 1CYXA 4NXSA 4LF3A 2ED9A 4Z7NE 4Q6IC 5CJOL 1BQKA 3C2AH 1VGEL 3D09A 2XWEA 4PJ5B 1WD8A 4BFRA 4AM0Q 2VRQA 1OIOA 3T0AA 3HCVB 3K71B 4M3JA 1UM5L 2HT3D 3MZTA 3QPQC 3QXVA 1UT9A 3S35X 4DGUA 1MVFA 2VERN 1TETH 1D5XA 2C4FT 2Y5TA 1GH7A 3V0IA 3QIBB 5A2AA 1A7NH 3IKCA 4N2HA 5B3SB 4UV4H 5IESL 3HHRB 4QKTA 1J1XH 1YJDC 5EOCJ 1DSFH 1LK2B 2K7QA 4PJFA 5DUJA 5K9OB 2JKRM 5FYLD 4F8LA 5L2KB 1NCDL 2IANA 4ZMTA 4D0BB 1QHPA 1LL1A 2PCYA 3BQUA 4Y2OB 4XNXL 5DFAA 3ESUF 3BW9B 3SPVB 4XVTL 1IJ9A 1XGUA 4QWWD 4Y4HD 4UUJB 3TA3C 3WEXB 2VR9A 4YL4A 2YFNA 1T1YB 3FKUS 1SF3A 4TF4A 4LCIH 1BWMA 1U8LB 2DKMA 4E5XG 4MKMA 4H40A 1EEZA 3L3JA 1TT6A 4WFHE 4XH2B 4F3FA 1CLVA 2NNRA 3QPKA 1PLCA 5HDWA 2GJ6E 4JHWL 1D6EB 1OGAE 1MCHA 3RVWC 1UB6A 5HGDA 1AGCB 1KTCA 5C0JB 1A7OL 3PAUA 2GI0A 5GQBA 1RJLA 3VI3F 4Y5XC 3QARA 3SDXB 1JOIA 1FORL 3PWJA 3QUXA 2Z92A 4MQTB 4GINA 5CP7B 3FQRA 4YDIL 1UVQB 2HMIC 4PB9H 4WUKH 1D5IH 1ZD6A 3FOLA 3UZQA 5F7KC 2M1KA 4GO8A 1JNHA 2A83A 2CLZA 3I75A 4G8GE 4GP4B 5F8RC 1J0ZA 4UT9H 3WBDA 1JN6A 2ZJSL 4JY6A 3R8BB 5FW6A 2UUDK 3JWNG 4KK6D 1TCMA 4NS0A 5HGBA 4OM0L 3ZUCA 5DD1L 5ISZD 2QMJA 3PQYB 1YEKL 1FAIH 4YSRA 4YHPB 1V3MA 2DYPA 5AKRA 5A2JH 5EH1A 4AYFB 1IL1A 2D7PA 2J21A 1BXUA 5IQ7H 4HUVB 1BG9A 4PFEA 3MOBH 3F7VB 3IB4A 4H1LH 3X1FA 3MLVL 3GLZA 4R5VA 1L5GB 3V8CA 3GIZL 5IFHL 4DKFL 1MIEL 3NP3A 2A6DA 3BUYB 4D8OA 2H7WA 5L9DH 4EIBA 1MAML 4ONHA 3M86A 2EUWA 2G9HA 4TQPA 2UY6B 4LEOA 2FGZA 5HGGS 1K4CA 3ARYA 4N90E 1RUAH 4PD4K 5F93C 5HYQA 4JFTA 2VDQH 4PRID 1WAAF 3FOMB 3FU7A 4R7VA 4HKXB 4W1TA 4L4VE 1CFSA 1IIKA 2RQ8A 4ZTEA 2WINB 5FUCC 4EZKA 1OGAA 1FVDA 3IRCA 3NN8B 5EEZA 4LB8A 1RP8A 1DN0B 1PZ3A 1TZAA 4ZNEE 4APXB 4TOYL 1SN2A 2F8OA 4FZEH 3RVUC 1MJJA 3MMEB 4HUXB 3II1A 1U21A 5SWSB 3LRLA 4BKLB 4YHZL 1EJOL 5I71B 4M3HA 5EF2A 1S2EA 4PWGA 3X3GH 1A9BA 1OAUL 2F8VA 3CH8A 1F41A 3L3GA 5DUBA 2ZKMX 4HS3A 2OW7A 1XGZA 1NDMA 3UZEC 4P99A 5I73B 2NY3B 5JW4R 3L48A 4WRLA 2VZTA 5I1IH 3OQ3B 2WKGA 1MNNA 1G6RL 2DLFL 4RRPM 3EYVA 1TFPA 2BINA 3BH8A 4AWJC 1KXTA 4K73A 1T20B 3RWGA 1BFVL 2RCSH 4O5LH 4JFYA 4I5BB 1H6TA 2EH8H 1OSPH 5ID1B 1EHNA 4OLVL 2BIQA 1QTPA 1I8LA 1FPTH 2C3XA 1CB4A 2MIZA 1JRHH 4DGYL 3TZVC 1BVLB 5DXWA 5L2KE 4J2QA 2XZCH 3OAZK 1YCSA 4B9GA 3B2UD 4LEBA 5DRNB 5EN2A 2YD6A 3U36B 1BG1A 3QPQD 4YIQA 5DWUL 1YA5A 1T83C 2Y36H 4IMKA 2MJWA 1EXUA 4C4KO 1Q72L 2C7UA 3PAZA 3L3OA 4TNVF 3E6FB 3EGSA 5C09A 3U7YH 3AJ7A 1D7BA 3TZVB 5FS5A 4KKBD 1T7YA 4K3JL 3BGAA 2X6CA 4XOCA 3VDCA 2CNZA 3I50H 4OV5B 3N04A 1QPXA 1WFNA 5FHBH 3BWUF 3GWJA 4U6YA 3LEXB 2OKMA 1KCSH 3FO2B 4EO5A 5C0CD 4IKIA 3FB8B 1KCWA 2PABA 3GTVA 2QKIB 3NCCB 3W2DL 3X3FL 1OOWA 1XAUA 4KKLD 1CGXA 1TTAA 4C56B 5CD3A 3DV6B 5E6IC 2MQ3A 5D1ZC 4OZIE 3BVDB 2YD2A 4JBSA 1K4DB 1QLFB 5K39A 4CSSA 4HIJB 4QXGH 5ENWA 1UKTA 2I60L 1SBBA 3VSTA 1ID5I 2R4RL 3LKQB 1T4KA 5IBLD 1X5AA 2NPLX 2IDUA 5F7NC 1QI3A 4NZJA 4X99A 2ROYA 3P2DA 2Y7LA 1IM9D 1T7WA 4WHTA 4HLEA 1CQKA 3GJEA 3MRIB 2CJUL 3VG0H 1I3RA 4HJ0D 1E5UI 2CBMA 4O2CB 1T2QL 3QK0A 5KVFL 3BI9X 2VSKB 4G6KL 2HLFC 4ZO7A 2Q76A 3NSDA 3ES6A 4NO3A 4X4ZA 1FO0L 3G5ZB 1VFOA 2I7SA 4MA3A 3REVA 1JMZA 4FQQB 4R4BB 2W81C 4MD5B 4OGXL 1NBYA 2WK2A 2BOBA 3B7YA 4OZHF 4PJ9B 5EBMA 2BERA 1EAJA 1QRNA 2CR0A 3T2NL 1QACA 3DGDA 3QDGA 2EYRA 5DYOB 1T21A 3HS0A 4WUUB 3RWCB 1QSEE 3MA9L 2IALB 1URIA 4JHUA 5L7XL 1XIWC 1IUZA 5ISZE 3KPSE 4Y5YC 2XTLA 3KZ8A 2V3DA 4MMXB 1EV2E 4O2FB 5EB9A 4BZYA 2QVIA 4Q56A 4UOW1 2EQDA 1MQKH 3NRPA 1QRNE 5BJTA 3MPCA 1HHIB 3BO8A 4PJ8A 2WKOF 5B3JF 1JZIA 5JDSB 5LGJA 3CAFA 3I74A 4X8CA 3VH8G 4NQXB 1KTLB 3OXRA 2RR3A 1RL1A 4CC0A 3TWCL 3WN5A 1FCGA 1TVHB 1I7ZB 2J8UA 3C12A 3T0VA 3Q48A 2XWRA 5CEXB 5FO2A 2VJ0A 3ZSSA 2CDFB 3D0LB 3FSWA 1RP9A 3CFCL 1FZJA 4OIAA 4QY8B 4PSPA 2OZNA 2DMHA 2HRPH 1ZVYA 3BVVA 3DX6A 3H7LA 2WOBA 4HOWA 4RGNC 5KVFE 3BKMH 1A4JB 5ITFA 4WWPA 3UTSE 3LD8C 4FP8L 5EO0B 1G9ML 1GGTA 1MWAB 2BO0A 2Z93A 4Y9BA 4DFIA 2IAMD 5D4HA 4APQA 1BD2B 1LYQA 4RMSA 3GUTB 1AHKA 1ODAA 3VD9A 3UJJL 2B9BA 1KG0B 4OFYD 4KTDH 4WTXA 4Z0XB 5BQ7A 4XX5A 4NFDA 1WBYB 4YHKH 5TE7L 5T33H 1F90H 1U8OB 4HUCA 1F5WA 1P0SE 2RA1A 2DWEA 1F2XK 5INCA 4HG4K 5EC2B 2C9RA 3I84A 1F97A 3NZ8A 1JNNH 1HXMA 4L37A 1D9KB 1WISA 3BYYA 2Y0SA 1NDGB 4EI6B 5L2KD 3FT2A 2QHRL 4OZHE 5CU5A 1UHVA 5AKSA 5HHXL 3CDCA 4WI4A 5T3XD 3U2JA 1UM6H 4R2GB 1W9XA 4Y2DC 1A6ZB 1EBPA 1JRHL 3AMKA 4LRIC 4QRPA 4QHPA 5MP6H 3MLZL 5B39A 1NIFA 5DGRA 4XAKD 5IT2L 4Q74A 3QHFH 3VYNA 4ZO6A 2AEPH 1JJUA 3AROA 4B0MB 2NY4D 2DIBA 3DOIA 4OIFA 3X14A 1UEYA 4Z77B 5HVHC 3D69B 1BZEA 2DN7A 1ONQA 3PP4L 5ANMA 3N9GH 4W68A 5ICYB 3CSGA 5DMYA 3LRKA 2XN9D 4L8CB 1AJ7L 1NGPH 1U42A 4DKEL 1QQDA 1V3JA 2X4UB 4POUB 4FTVA 1G1CA 2LV4A 2E8YA 3IT8D 4N0UB 3ZIMA 4BSVB 4AEFA 4K3JH 1A3ZA 4DN3L 3S3PA 1YNTF 1ZKAA 2MOQA 3EOTL 4NHCH 3TYFB 4F5CE 1ZTXL 3GGWB 4ENEC 4L2LA 4PS3A 1WAAA 4X9YA 4B95C 4OI8A 2G5BB 1MG2C 2R1YA 2ZKXA 1B2WH 3EYFB 1NCDH 3MRCA 1KJ2L 4J6RH 2DQJL 4LSTL 2BP8A 3HE6D 3CLFL 5MENA 4P8QA 4Z8FL 2P8PA 4KPHL 1FN4B 4ZFQA 4PRAA 5I1AA 3RVUD 4KGLA 2ZWSA 3MBEC 4JFQA 4I2XA 4LCIL 2P3YA 3D3VE 1RZFL 1IV8A 2CDGB 2HFFB 3OSKA 4ZMVA 1QW8A 3SGDI 3MGTA 1RHFA 5LKNA 1GJUA 3HMXH 3LN5B 2YLKA 4YDLC 3VTAA 4Q7DA 1NINA 3RG1C 2FSEA 5CD5D 4YDKL 4A66A 1X5XA 3BESR 3BSZA 1AZUA 1IT9H 2Q8AH 1SLWA 1K2DB 2ICEC 1RIUL 2JJSA 4MNQD 4XTRC 1D5IL 2J57A 5HI4D 3QE5A 2AAAA 1LE5B 2ZSWA 3VXSD 3MDJA 4KROD 5I6XC 4IU2B 4YDMA 5GS0H 1R5VA 3UYPA 2TRHA 2ENSA 4YAQA 2DQGL 1NBZA 3KWUA 4LHQB 1IGJB 4UIMB 3U82B 2P7TA 2TRYA 2I25N 4HP5A 1NKRA 3LB6D 3WNPA 5AB9A 4WWKB 5IQ7L 1KBPA 3K2UL 4YFDB 3ULUF 3BPLB 4HEPG 4P07A 4ZOAA 3F85A 1LK3H 1W91A 4JRLA 4X0KA 4ANKA 1KXVC 2XWBB 3H85A 2E74C 2WQUA 3V9CA 4HBCL 5A2LH 1C7SA 1HEZB 3SDDB 3SGKC 1NANI 4LF3B 1J0YA 1ZGLB 4Z3FA 1IM3D 2APFA 4BYHA 1PQZB 2VQ1B 1NCGA 2BVPB 4G6MH 4MDJB 4Y9FA 3VXOB 5I76A 4AZ8B 3D3VA 3ZRSA 1D7CA 1VA9A 3Q9QA 3RVXC 5DT1L 2DZEA 1SDAB 3QI9A 1IO4C 1P7KA 3TONA 3DGCR 3TTYA 1VKXB 1DVFD 1JHLH 4I4WA 1TQVA 4QRRD 4ZJ9A 4DP9X 3W57A 4EIUA 5DWPA 2H6OA 4JVPA 4MB3A 2FBRA 4NBYB 2JE8A 4YHZH 5EPMA 3P11L 5F6IC 5TE6H 5K9OA 3EJZD 3P0VL 4OIBA 4XBGB 1ID2A 1RFDH 2AAVA 3S5LB 1UWFA 3BW9A 4MXQD 2FL5A 4NQVA 3S3DB 4P2RE 3L81A 3ARGA 1UTDA 1T1YA 2D3LA 2F6AA 1JPFB 3LIZH 4ZPTB 3L3JB 4IBVA 2Y22A 1M1XA 5BRZB 2WWOA 1FC2D 3DX7B 5D2NB 1KELH 4P4RA 1PD1A 4V2CB 3GUFA 2XU9A 1UXMA 5MEPB 4BQCA 2X4QB 1WZMA 5AEAA 1GS6X 4BK5A 4K7PL 3HI6H 1EDYA 1IGMH 2OXGB 1GGUA 1E3ZA 3FH5A 3WLBB 2WXHA 3VI3A 4KTEH 2X05A 3UBXA 4OGZA 4FLOA 3QUXB 4TVPL 4DUXA 1FPTL 3FQNB 3BJLA 5DZVA 1EEQA 1H9VA 1X7QA 3QQXA 4Q0XH 6FABH 1OAXL 4PRIE 4LL9A 3FOLB 3UZQB 4U1JA 2ADGA 3GXFA 1IQWH 1BOYA 3RYMA 1P4LB 3U0TA 4D9LL 5I5RA 4PREA 4WI0B 1TZOA 2W95A 1A4CA 5DWUH 3U9UB 1XV8A 3OKDA 4JY6B 3MV7A 4PR5A 3QQ9C 1AJ7H 1NGPL 3UCRA 1SUHA 3DIVA 4Q9QL 3RHWK 4CSTA 1IFGA 5A3ID 4AYFA 3PABA 3EDFA 2ZUUA 2GVYA 3IMVA 2OXHB 3RI5F 3LEYL 4S11A 1L5GA 2XVKA 1DVSA 3BH4A 3LNEA 1W8EA 4X4MA 1DR9A 3IJHB 1DBJH 1Q9KA 3QA3A 4GW4A 3SE8H 3VI4A 4OKVA 4F15C 4R90L 5DJDA 5HHMD 3WJJC 5D7KD 1VCBC 2WWKT 2LHAA 3NCYP 4OKDA 1F02I 5FUZH 2UY6A 3PUUA 4LEOB 5AB0A 1VGEH 2JCCB 4UT9A 1BQRA 4S0TD 2YA1A 4OJYA 2F9BT 1FGNH 3MLUH 4XAWH 3CBJB 3KJ6H 3GZPA 4Y5VB 3D7PA 3U30C 4G8IA 1T7XA 1TZHB 4C83A 4IRSA 3O2DH 5B1AB 1K8DB 1R3HB 4YNYA 5HI3D 2JKSA 3DPDA 1DN0A 4CJ0A 4KRNA 4PJXF 4H2AA 5KANI 2Q0ZX 2YQGA 3P4LA 3G6AB 3LV3A 5IVZB 4RFNB 4YDKH 3VSVA 2DLTA 4JFFB 1OM3H 3ZK0A 4R8WH 1TLMA 2H45A 1V3LA 1R5IB 4AYID 1ERNA 3ARQA 3HNVL 1DSYA 1LILA 1U8CA 2DQDH 2APXA 3A21A 2PW2A 3OGCB 4OZGF 5EZJB 4ZXBD 1UWEL 4QHNB 1QZ1A 1KPUB 2YPVH 4XVTH 3ZQ9A 2XZAL 3GIVA 2ESVB 1MQ8A 2OR9L 2RFXB 4WSJA 3IFPA 3RGHA 3SY0A 2PPAA 1S7UB 1YN7B 2NLJB 1KXVA 3KPOA 3RVTC 1NGWA 3QUHA 3ZIYA 1A3QA 4N9GB 3EYVB 4XB8A 5D6CA 4H8WH 4YSSA 3WY4A 1ZHKB 3JT2A 4NQSB 4U1IA 3EO0A 3RWGB 1K6QL 3FCTB 4F9LC 4PLNC 1QA9A 3ARWA 4XN1A 4JR9H 3MUGA 5FYKH 4U1NB 2VUYA 4ILDA 2NSMA 3GK8L 4P5MB 4LPCA 1NKGA 1I82A 4QHMB 3A5VA 3ULAB 1BBDL 3ARPA 4PJ5E 1MCJA 4H13C 4U3HA 1ZA6B 2QQQA 4I9WD 4DW2H 5FB8A 2JI1A 4XMLL 3LEVL 5F0PB 4K3DL 1F6AA 1YNKL 3ARFC 4WFEE 3SBPA 4N2KA 4GUPB 5CHNA 1CDJA 5B7EA 3KLKA 4A1RA 4L18A 1RUQH 4HZ1A 1AIZA 3L3OB 2X4SB 1KFAH 5C09B 4P4KD 3T2OA 1IAKB 2LE9A 5FFOA 1XGPA 4YFLF 2EIJB 1M9SA 4IDLA 5C09D 4JM2B 4GW1A 2MPAH 3FSAA 3MRQA 1D9KC 1XB8A 3OM3B 3LDBC 4ZTPH 1FIEA 5GRYA 1WA1X 3TBVA 4U6YB 2ZSVB 3RHWF 3VW3L 1YQVH 3FSVA 3ZZ1A 3Q2LA 3FB8A 1CLYH 3HZKA 4R97C 1MEXH 3O3UN 2WBXA 2VLJD 3VWJC 1DFXA 4JJ5A 2M8XA 5DZ9A 3DETC 1IU1A 5C0BE 1OLLA 1HIML 3Q8EA 4ODSL 5CD3B 3ZT5A 1FFOA 2X3AA 1CTNA 3GZKA 1K3IA 5ECGA 2KPWA 3FCGA 3LZQA 5I5IA 3F5WA 4OZGE 3LDBB 3S36L 5I75B 1FSKC 3ZKNC 2KLSA 4A6YB 5FKPA 2D7TL 2VLKD 3LKQA 5F89A 1T4KB 1FYTD 2JV6A 3HI6L 2ED8A 1LO3H 2CO7A 2EE2A 5EHFA 3RU8L 1EJ6A 5KSUB 4XPBH 1DDTA 4LSVH 2D31A 5LN4A 3BUIA 2WO4A 3ARVA 3QCTL 3BSZL 1IB5A 1Z7JA 1KY7A 4X4YA 1PEZA 2IXQB 4NC1C 4P59L 3OSVA 4MCMA 3U0WL 4P3DA 1ITBB 4A38A 3QHFL 1IVLA 4KK8D 2FYYB 3DTXA 4R4ND 2Q76B 3VXPA 1MXGA 1I1RA 3ROOB 4FQQA 4HPOH 1DBML 5DJ0A 4YBLC 1FWXA 1TENA 3BAIA 4CNIB 2BW4A 4AKQA 4M5YH 2UXGA 4MA1C 1MCOL 3VGGA 1T21B 2ZT9C 3CHQA 3RWCA 2BIOA 3ARRA 3H1ZA 1KBKA 3QR2A 4I9WE 4NNPH 3MJ8B 4X7DC 4CDGC 5JA9A 2AJZA 4PRBA 2B1HL 1L3NA 3O9WB 4L4JA 4M7ZB 2YD9A 2FJSA 4MCNA 4XP9H 2XYCA 5DHVH 1VDGA 3RX5A 3UXFA 3VG9C 1UADC 3MRDA 2CMRH 5D70H 1HE7A 4J6RL 3C6SA 4I1PA 4Z3TA 3O3EB 4DP7X 2FO8A 2ICEB 2ORBH 1HHIA 5H37G 4OJAA 2ZWZA 3HS0C 1KTLA 3LH9A 3WTXA 4AYDC 3KCPB 5FGCE 1QASA 4A7SA 1QHOA 4NNXA 2DMBA 1S7VB 4GAGL 2J8UB 3H3BC 4KY1L 4HS8L 3RAJL 2BS71 1QFHA 1S9XB 4ZFZB 1FL5A 4PY7B 3FDWA 4ZAKC 4AMKH 3ZTEA 4B9YA 3EFOA 2RGSA 3M17A 2KBGA 5E6RB 1E4WL 4NZRH 1B4JL 1KIRA 5LVEA 3HNSL 2EE9A 3IMRA 2FJHB 3ULVL 2X44D 1A4JA 2AJXH 1EEYA 2AVFA 2DWSA 3X3FH 4NJAH 2B8OT 1UWEH 5I24A 4XCCL 4KH9A 4JG0H 1KPVB 3FTWA 4U0RC 2VN4A 4GUOA 1CZ8L 1O0VA 5EU6E 3V6FA 5AAWA 5E8DL 2XBZA 3MRMB 3SGDH 3LKNB 5DJCB 2VXTH 4CA4A 3IDIA 4HHAB 4I48B 5KBNC 4M5ZH 4QTIL 3DBXB 5F3HA 4FHJA 2YOAA 2OYPA 3VA2C 5EC2A 2X12A 4KI5C 2XY1A 5FHAL 5J1AA 1HL5A 3I9IA 4AMWA 4EI6A 5BMFL 2X9ZA 1NMAH 1XCXA 3KE0A 2KQNA 2E7CA 4YEEA 3PNWB 3CN0A 2CUAA 4PLJD 1B9ZA 1TFHA 3MLRL 2P8MB 5DMKA 4OCXL 4PGCB 3KCWA 5I8KH 1SEBA 3Q5YA 5D6DA 3P3SA 1HNFA 3QG7H 1U91B 4G70B 4XCYA 5ANMB 3WJMA 2VLJE 3VRLE 1KEML 2F53D 1OEZW 1S6NA 4JPKL 3IFNL 4PS8A 4BKSC 3OKKA 2FB4H 2X4UA 1OPGH 3Q0HA 4NKMA 5KVEE 1PLBA 2QPUA 3STZA 5CF3A 3HE7B 4Z7QB 1A8JH 3ZL2A 4KUCD 4IHOB 3RZCA 2A0LD 1YVLA 4B9ZA 3MXVL 3P9MA 4I0PD 1ACZA 4QT5B 2X1WL 1GPOH 1QEWB 5D93C 2FBOJ 3NEOA 1OE2A 5CEYB 4ZMOA 2V8LA 4RMRA 5H8DA 5F21B 1IM3A 2GFBB 1AR2A 1IC5H 1MFBH 1S7RB 3DO7A 3WY3A 3QXWA 3KGUA 1RPUA 4HETA 2P8PB 2H26A 4IOSA 3QZWA 2IWEA 2FGWL 3EYSL 3AXLA 3QGVA 4UM9A 5DURB 3AQXA 1S3RA 3UC2A 2WUBL 1E5ZA 5AZEH 4M8UA 2R2BB 2Y25A 2H6PA 4MB1A 4B9PA 1QSFB 3MGTB 4A04A 2GI7A 4MTMA 1N2RA 3LPPA 4NT6A 2AJYH 3DHJA 1TXKA 4KWUA 2YXMA 2WTOA 5FOBA 1AKJB 5HPOA 3WEMA 4DESA 4YZFE 4WHYG 1H6FA 3IWUA 4Q97A 4U1SA 4ZX6A 3TN0C 1XH2A 4FN0A 4L3CB 1Q8MA 5CCKL 2IGFL 4NAMA 3O2WL 1ZLWH 4TRPL 4MA7H 3B5TA 5DMIH 4FA8A 1MRDH 3GXUB 5EUOE 2ZSWB 3UAEA 4AC2A 4AYBA 5J1TC 3KR3H 4YE0A 3T4AA 1B6DA 3S96A 1PNDA 4PCYA 4GXVH 5EOCL 5DVKA 2BSCA 1UZ8B 4KKPA 4O2EB 4X50A 4YAQB 1U8JB 1MHEA 2LAGB 4PJAF 3HC3H 3JTSA 3HS8A 4YBHA 3TO2A 1Q9LB 4QHLA 5EBGA 3WV0A 2BWDA 2X41A 4Z7NB 3LQAL 3KPNA 2E0PA 3KYAA 4CSPA 4UZSA 3IJ7A 4QHKJ 1ZJAA 2E9IA 4Z5RB 1E2ZA 2AEQH 3FN0H 1FH5L 1LO0L 2B0SH 2WXLA 3GBML 5KTEL 4NQDB 2B1HH 3W0WD 2YD5A 3LH2H 3L6FA 4JPWL 3ZN6A 1JV5B 4P49A 1MFAH 1QFWM 1QSVA 2GAZA 2WIIA 4M7JH 1NLBH 2FEEL 4MAUL 4CW1A 3ZZLA 4TLSA 4MDJA 5DGQA 4KQ3H 2VISB 3O4LD 3QQ9D 4C54A 4YSUA 1T1ZA 3E3QE 5C0GB 1KPRA 4PJ9C 1CXKA 2PW1B 3QUZA 4F2ME 4FG2A 4PJ8C 1P7KB 3VFVA 4AM0A 2W80C 1YYLL 1B4RA 3HW7A 1ZK5A 4H25A 4G8FB 2A1WH 4YXKH 4FA6A 2QT6A 3F7RA 4FL4C 4DK3A 1UXSA 4M4PA 1BF5A 5CWSB 2XKNA 3DJRA 5EPMB 3CSYB 2YSSB 1YSOA 1GR7A 2AP2A 4H8QA 4OB5H 1EAPB 3VWKD 4LKCB 4IIQB 2BVQB 4AEHH 2LVCA 1PLAA 2NY2C 3NK3A 2DPKA 4KPHH 3B3IB 5E9AA 1G0DA 3IE4A 4WI3A 3ARGB 3HG3A 2BWIA 3O6FC 5DS1A 4ZFGL 2R0ZL 4FQLL 3GF8A 2XWDA 4HGKC 4ZPTA 4JZNA 2HFGL 5BV7H 2EDKA 4IKNA 3UC0A 4N8CH 5AWNL 3EIFA 5D2NA 1BQLL 1C8QA 1U33A 5K69A 2BNUA 2FJFA 4FHBD 4LESA 5MEPA 2F54A 1A25A 4V1DE 1SQMA 3F7YA 3WE6B 1CGUA 3KBHE 5D1ZI 4P2QA 5A16B 5IIEA 1DP0A 1Q9OA 2MKWA 3H55A 1FZMB 5CFAA 1ADQH 3UBXB 3IXTA 4GXUN 2D0FA 3BPCA 2IFGA 1X7QB 1UURA 1W16A 5C2BH 3CFJA 1QYGL 2VZUA 3SE4A 1JBJA 2B15A 1N26A 2XQ0A 4JY4A 4FI8A 5D7LD 1NPJA 1RUQL 4GAJL 4X6DB 3D2UD 1JI2A 3BZ4A 1U8HB 5AZUA 1GYUA 4EUPH 2BVOB 2WYHA 3NJHA 3VD1A 2FNBA 3CX5K 3SDXF 5I75C 5K9KB 1CGTA 4KHTL 5CGMA 2C3HA 4L3EA 1MY7A 4QRRB 3FTUA 2J25A 4LIQH 1W15A 3MOQA 3NK4A 2ZKHH 3MJ7A 4Q9RH 2WB1A 1UZ6F 4OKVB 5DJDB 1EHAA 1KLUA 2BY2A 3LYRA 4FEMA 4KO6A 4Y4KC 1WWWX 3G6JF 2MNUA 3NYKA 4GBXC 3PWPA 4BHUI 4XP5H 3MX0B 5CCJA 2PYEB 2VN6A 2J12B 1WCBA 1MPAL 3NFSL 5JQHC 1KBWA 4DFHA 3L95A 3M45A 1Z9MA 4X6DF 2YXWA 1SGKA 1J8KA 4P23B 3AM8C 3KEDA 3NJVA 4TTDC 1I3GH 4WU5B 1DCEA 2QDVA 5E7FA 5FUOH 3WELA 5KG9A 1KN4H 3LH8A 4KK9D 4NM4H 2WQRA 3VXRA 2AQRA 2BS8A 3TEWA 4JFHE 4F7MA 2WXPA 4WU7B 2A2QT 3I6KB 1BSIA 1W6LA 4X5LA 2OPCA 4ZPVA 2DW5A 3AB0B 3P1VA 4OCWH 2ESVA 2VJXA 2EH7H 2QSTA 3UO8B 4E42B 4UQ3B 3IFOB 4O51A 1H3XA 3BGFB 3SDYH 4AOFA 5ACZB 3G5XA 2UYLB 4G7QB 5D96C 4CMHB 4N9GA 4Y5XB 3TIDA 1NAKL 3GSRA 3EO0B 3EFDH 3ZPDA 4NCDA 5JDJA 1TQTA 4ANXA 4G43A 1G9HA 4OBSA 2NYZA 1C12B 3AABA 2EC8A 4X6CF 4N26A 2X4NA 1GZHA 4QHMA 2K7PA 3GRBA 3CN4A 4M4RB 1OCOB 3NCYS 1QSFE 3D87B 4GIAA 4N0YL 3WIIL 4Y16A 4YC2B 1PEWA 1CK0L 2CIIA 5SV3A 3V95A 4EIGB 1F56A 1LQBC 4K5PA 4UT9L 2WGNB 2XUWA 2AXFB 2WAHA 2IOIA 2WIMA 3MJ6A 4Y4HB 4EN3B 2B1AL 2PYFB 1BGXH 1Y0LA 5J12C 3DVIA 2AC0A 4P9HL 4AK1A 3ZKND 4E9QA 1QKZL 3NH7H 3DRTB 1LNUA 3ULSB 1RUPH 2B77A 1XGPB 4F93B 2YAQA 2DEXX 1A7BA 3QDAA 5HDQH 2BVTA 5C0CE 4L1TA 3LKOB 5GS2H 1AYRA 1DANT 4PJFF 4RNRA 3EJZC 4NZDA 5A2BA 2VDKB 2COQA 3MNZB 3QIWA 3V5KB 2ZQKA 2OSLA 4OU3A 2D2CC 2D2OA 4AEHL 4DNLA 1EEUA 3SD2A 4WJ5B 1VEOA 1VZGA 1LXMA 4PJCE 4NO5B 5K93A 5F44A 3I6LE 2GB2A 3Q6FA 3UJIL 3NACH 3X1NA 1UOKA 3MLUL 1WO2A 5E2TH 3EOBA 3SB3A 3D34A 4S1QL 2EINB 3BHBA 3SE4C 1UG9A 1SYSA 3H3PL 4R9HA 5FKPB 2BNQD 4WI8A 1U36A 1A7OH 2X3BA 4JDVB 3OLDA 2YS4A 1BXXA 4WHYH 4PW3A 1BD2D 2DEYX 4BXSV 1I3VA 1RAMA 2DQDL 2ZX9A 5D2LA 5T1KA 4APQC 3ZJAA 2KH2B 5EO1A 3KXFE 3OAZH 1IBYA 2X10A 5FIEA 5T1MA 4HC1A 3C6LC 5JIIA 1RH8A 1LWRA 3C60B 5LGKA 4WY7L 1MHPH 1TO5A 2V8MA 3Q8BA 1JXJA 2WP3T 4EKJA 4MAYD 4HJEA 1MHCB 2EDOA 3FU6A 1J8HA 1G7QA 3OHMB 2B3RA 1CXLA 3QUYA 4HIQA 3X2QB 2C3GA 2VLRE 3QIUD 3B1UA 1UYWL 3EJYC 3D5OF 4HSQA 3UTPE 1NPNA 3TOPA 1EVTC 4XCEA 1MDAA 3V6BR 5E95B 1ORQA 4HLZH 3LNIA 4LRIA 5GRUL 4HCFA 3L2NA 4MX7A 3FT4A 3WIAA 2JXMB 1SHWA 2ICEA 3EBGA 1P6FA 4WLCA 1AMYA 12E8H 2GIXA 1UA7A 4UILL 5DO2D 4HWZB 4KZDH 3FRUA 3FQUB 1MCPL 3BUBA 1NC4D 5F6HI 1JSYA 3KCPA 4FXLA 1X6NA 5BV7B 3LRSA 1GGYA 3C5JA 1MPAH 3NFSH 3O6ML 3RFZA 3UJTH 1IILE 4HIHB 4NAQA 4EOWH 2GW5A 4PJIA 1S9XA 3VYOA 2BP0A 4JFSA 3V6OA 3T77B 2X6BA 3ILQD 1AAJA 2IH1B 3FQ4A 4ODXB 5E6ID 2ZOKB 4A2MA 3M17B 5CCGE 1DSFL 3QNZA 4BK4A 5E6IB 3VFTB 2I07A 1MRDL 4PVBA 5JHLL 5I28A 3W2DH 4NWUL 1I1YB 2NT0A 2CIKA 1BAWA 1KPVA 1GA2A 3SJVA 3BKYL 1EDQA 4RMUA 1IGTA 2C4XA 4TNVK 1HSAA 3EBHA 2GSIB 3VU2A 3FO1B 3VFWA 3T6QC 3KPSD 5DJCA 3FT3A 1PU0A 3TCXA 4ATTA 5DK0B 1OM9A 2FK9A 1L6ZA 2ZNWA 3DDFA 1CU4L 2DTSA 3DNKA 4PHXA 3H2WA 1QI4A 1CVSC 2OX5B 3HAEH 3ZKQD 4CBZA 4Q9CA 5J1AB 3MRBA 3CUPB 1TNNA 3BFOA 3L2LA 3UP6A 2WBJB 1R3KA 3UYRH 5IJVA 4QYAA 5CJQH 1XCTB 2WANA 2VR6A 5L8LB 1RHHA 1JZHA 3CVIL 3JVGA 2QQKH 2YGNA 3RNQA 3BSZH 5L0QC 2ZICA 1Z9PA 3N42B 3KPQA 1EZUA 3P4OA 3VD5A 3ZMRA 1CQYA 5I0YA 2ITEA 2X87A 3O8XB 4ZSOB 4JG5A 1T3FB 3CSFA 2QGDA 1V8HA 1YZZA 3LZFL 5D1XE 4PV9B 4UT7H 5CM1A 2IH3B 4XCYB 3WJMB 3E1F1 3RUGE 3QXAA 4PJCB 4G5ZH 3ZE1F 4JGNA 2OCJA 4KV5E 5CAYB 2HT3C 3QIWC 4Y8AA 4BJLA 1FLRL 3CVBA 3EGDB 5TK2A 5F7YC 4WGKA 2WWMD 3O11B 1AD9A 4IGBD 4YS4A 1Q90A 2X7LB 4NPJA 3HE7A 3CCHB 3U79A 5IMMB 3ULVE 4W9JC 5I17A 3EFFB 4IGBB 4IJ3C 2Q7YB 1QEWA 4IKJA 3DYPA 4B60A 1WZ1L 1SNRA 5GGRB 4OB5L 4D9RE 1WZKA 4MJ6A 2GFBA 1IM3B 1T89C 3D52A 3FZUC 4LSSH 1IAMA 1MY5A 4Z95L 3TCLA 1SOSA 3EZJB 4BV1A 3SIKA 4CL7A 2G2PA 2CO4A 1LHZA 3AQDA 3DPBA 2Q10A 1A1NB 7FABH 1M71A 3QI9D 1ZHLB 2DBJA 2VDQL 3BP4A 3QJFB 3FQ2A 4ZYKB 4PD4J 3TNNB 1AXTL 3D85D 1E4HA 3VX0A 5MEQB 3PPEA 2WAQA 2ZAIA 1XGTA 4KY1H 1P5VB 3EYUL 5DD6A 5C71A 3ARSA 2WNWA 2KDYA 1UGKA 3BVNB 3PWLB 4LOEA 4GY4A 4MBOA 3HC4H 1N67A 3OZ9H 1N8OE 1AFVH 1T04A 3QUYD 2DQUH 1X4ZA 4DEPB 5LDUA 1FYHB 2GK0B 1CDGA 5JLZA 1UD5A 2GUOB 2DI8A 2J3SA 1YEHL 3QJHA 2E7LA 1PKQE 3BSGA 4Z0BH 1C5DA