1SVCP

Nfkb p50 homodimer bound to dna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
311
structure length
311
Chain Sequence
PYLQILEQPKQRGFRFRYVAEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*AP*GP*AP*TP*GP*GP*GP*GP*AP*AP*TP*CP*CP*CP*CP*TP*A
publication title Structure of the NF-kappa B p50 homodimer bound to DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 60
structure length 311
sequence length 311
ec nomenclature
pdb deposition date 1995-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00554 RHD_DNA_bind Rel homology DNA-binding domain
P PF16179 RHD_dimer Rel homology dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1svcP02
2.60.40.340 Mainly Beta Sandwich Immunoglobulin-like Rel homology domain (RHD), DNA-binding domain 1svcP01
3V6OA 1CE6A 2EH7H 1YNTB 4U1NA 2X4UB 2HVKB 2GAZB 1EAPA 1FL3A 1W8OA 4WUUB 5IMMA 3IDJA 3QEQE 4TUKH 5DQ9A 3KPSA 4ZUUB 1RZJH 2Z92A 2FJGA 3H7BB 3L3HA 3KNBA 3RDTA 4TPRL 2ZJSH 2F19L 4NT6B 1QFWL 5D4QA 1XF5B 3KXFA 3HCVB 4OZHA 2R1WA 5L0QB 4U7KA 1H3WM 1Z3GL 3K7UA 1OTSC 2X5PA 3GSQA 3MRQB 1WIUA 4XCNA 4KMQA 1ZGLP 3SCMA 3BIBX 1UADC 3HNTH 5HBBA 1KSRA 1BZ7B 1QSFB 5CJOH 4XHJD 3RPKA 2CUMA 4HBCH 3HC0A 25C8H 3PGCB 5DJAB 3EYQD 2HRLA 5IHUH 5D1ZD 1KEGL 1EFQA 1B4JL 1ZT1B 4PJ9A 5DJDA 1OF2A 1A7PL 4XC3H 4L8BB 1DL7H 1KENH 2X4RB 4XP1H 2J6EH 4QRPD 4RAVB 3EYSH 4K94H 4ZTPL 3GMOA 3B9VA 4UTAL 2P7TB 3W0WE 3P9WB 2YRLA 1YEKH 3DMMC 4GJTB 3KR3L 5CKAA 5KVFL 3B3IB 4NO5B 5HHXH 2W59A 3VI3E 3ARFC 4HWEH 1CS6A 2GSIB 4EI5D 5ESQB 5HYQA 2Q8BL 1A6ZB 2QEJA 4ZUSA 1X5HA 4JPKH 4J3XA 4LSPH 1U36A 5GGRA 1T80A 1KG0A 5JUEH 3OJDB 4DN4H 3FTGA 4R7DB 2OJZL 1CXKA 4U0RB 1HI6B 1FSKB 2EYRB 4KI5E 4FQLH 5IBTH 2WWKT 3TA3D 4OZ4A 4MCZA 1KN4L 1FYTE 5CWSB 5JHDB 1PKQB 3UPRA 1KIRB 1KOAA 2GEEA 2NY7L 4NRXA 1DFBL 3R0MA 3BAEH 1URLA 4J7RA 1OAZL 1BVLB 4S1RL 1MCQA 4X6DB 5DO2D 3SKOA 1ZANH 4R2GB 3DMMA 4ZS7L 3N06B 4PRDA 3MRLB 3N9GL 2VUOA 3BUYB 1FJ1B 3CJJA 1WIPA 1CGTA 1I9EA 1KCLA 4QF1B 1H3XA 3STBA 4UZGA 3CFEA 1TXKA 3VWKD 4NQDB 1GZQA 3FRPG 4LSSL 3KJ4C 4E42B 1X5LA 2NY5C 4J4PA 2H32A 3IDNB 1KGCD 2DDQH 1XF1A 3BEWB 5IQ7H 1NUNB 1WZKA 4IOSD 4KZDL 5EO0B 1B0GB 4NKOA 3ZYJA 1LE5A 1JPGA 4BFIB 1I3GL 4CUCA 2RHEA 6FABH 4K8RD 2XIDA 1ZHLB 1IC7H 2CLZA 2WZPD 4HUXB 5JHLH 2IQAB 4TSAH 3MRNA 4Q6IA 4HWZB 3MXWH 5D2LF 1A6AB 3UP1A 4XWGH 5D9SA 3N1PC 5FGRA 5I18L 3TJEH 1UZ6F 3PDDA 3H42H 4XBEL 2K9UA 4ISVA 4KUCD 5D2NE 2Q1EA 4HXBH 1ZLSH 4GFTB 4WEMB 2KPNA 5FHBH 1ACZA 4UNTA 3BP6B 2XQYK 2P8MB 1WFOA 4M1GH 3LKPA 5DEGB 4PJ5E 4KC3B 3TWCH 3VFUA 5I1IH 3CDGB 3Q2CA 2V9QA 4MDIA 2L0DA 5F9OH 2AJVL 3MA7B 3WIHA 1CFVL 4XPAH 2JK5A 3U30B 4NN6B 2VABA 3ORJA 1PX3A 1FFOA 4HKBA 3D1MC 5GS1B 2L7JA 2Z4QB 1KCSH 4JKMA 3V0VA 1RZIB 3LS5L 4FQHB 3QNZA 1U8MB 2BDNH 2DKUA 4MA1B 3AFLA 4EZMA 4I13B 1JIBA 2FH6A 3OTTA 2OZ4A 1CGWA 5L8KB 3DGCR 3LRSB 3QHZL 3ZHLA 4D94A 1CFSA 3G5ZA 1NANH 4KTEL 4OLUL 1YEJL 5D7LB 1S9XA 4P4RA 2ADJB 1RZKC 2H1PL 4K23L 4Q74A 4OCSL 3DX8B 3SDYH 4NQEB 3REVA 3DURB 1DLHB 1U8QA 3GSRB 4PRBB 4ZAKA 3QIWC 2NW2B 3LQMA 4JO3H 2D0FA 2VXQL 2ZUQC 4O51A 3SBWC 4LLUB 1QEWA 3S8WA 5JXEC 4PJAE 3E0GA 2E8YA 5IB2B 1I85C 1BX2A 4FQCH 1T1ZB 1WITA 1U8JB 1Y18B 1INDL 4X0KA 4HWBL 4K71C 5MEQB 2VDPH 1J8HD 1A1NB 43C9A 1BWWA 1FBIH 4N0UB 4JQIL 5AG9A 2O5XL 3FQRB 3OKDB 3KPRD 1B90A 5I1HH 3E2HB 3O3UN 2CIKB 1RUAH 4UIMB 1VACB 2FB4L 2AXGA 3DLQR 1PQZB 1A6WH 1Q38A 4NBYB 1LGVA 1IAMA 4G5ZH 5HDBF 2QQNL 3O3DA 1CL7H 2AXFA 5FOBB 3QAZC 3NCMA 4KROB 1TZIA 5AD0B 1S7UB 4TTDD 4XZUA 4N0RA 3ZSSA 1LP9A 3SBWA 1GYAA 4GW1A 5JXEA 5EU5A 2ICWI 4G3YL 1G6RB 1PSKL 4ZSOE 1KXQE 5CUSL 3D69A 4ODTH 5EO9B 4X98B 1SJEA 3VFTA 3F6IA 3PWJB 1TJHL 1OSZB 2BVYA 4GO6B 3V7AG 4G42A 3QUXD 1YZZA 4W81A 5GJSL 5INCB 5EU4A 2IH1A 3U0WL 3FB8A 1CK0H 1LHZA 2F53E 4ERSH 5KSAC 2KZWA 3BKJH 4CMMB 3OX8A 1A7NH 2OR8A 3TLRA 4KUZH 1JHKH 3D25B 3G5VA 3MCKB 4JY6A 4QRRA 2J8UE 4XI5D 3IETB 1YNTA 2HVKA 4JE4B 2EDRA 2GAZA 1F8TH 4KY1L 4F33B 4WUUA 5EIVA 1KCUL 4RGOL 5AWNL 1WSST 3H7BA 2LAGB 3RHWK 1K85A 3HS0B 4NT6A 4ZOBA 1XF5A 3HCVA 5GRZA 5I9QB 4TYUA 1REIA 1AI1H 4YHLL 4XP5H 5TH2B 1G6RL 1NC2B 4IHOB 3PIQB 4JFFB 1FNEA 3PP4L 4KZEH 4HFUL 5EWIH 4WU5B 4Z0BH 4LAJH 4DGVL 4OLVH 2H32H 2PW1B 5C0NC 1MF2H 2XOTA 1BZ7A 3VFMB 5KSAA 5GZNC 5DJAA 4ODSH 4XTRC 3KYKL 5A2LH 1ZT1A 5C0BE 1A1OB 3RVUC 1NBYB 1QRNE 4P2QD 1BEYH 4M7JH 5IQ9B 2X4RA 4OBSA 4RAVA 4LVOB 4MA3B 1VESA 3O41B 2WBJC 1IGCL 3FFCD 3Q48A 3TO4C 3B3IA 4NO5A 2R0LH 1FNSH 3ULVL 5HYFA 1MFAH 3OAUH 4PJIB 3DXAE 3NIFE 5I1CL 4PJXB 2D9QB 1P7HL 4OGXH 2PUQT 5MENE 1QPPA 5ESQA 2NXZD 3QQ4B 3V79C 1NEUA 4BK4A 5TE7H 1P4LB 3MOBL 3C6LD 2D7TH 3MV9D 5CFHA 4HIXH 2PO6B 3U6RB 2K1MA 3OJDA 4PB9L 4R7DA 4ZNEE 4K3GA 4C56D 3ZKMC 2EYRA 3NCFB 1AR2A 5DD6B 4M1DL 4BA8A 2ZOKB 5HI3C 2VLME 3WFHB 3EOTH 2FD6L 2NY6C 3BGMB 1I7RB 5CWSA 5JHDA 1PKQA 3DWTA 1KIRA 4PGJA 3VDBA 4JRXD 1UWXH 2GIYA 2P5WE 4XXDB 4RISL 1BVLA 3QDHA 4X6DA 4YGVB 1R0AH 5EG6C 4YDVB 1YPZA 3MRLA 5T1MB 3BUYA 4P2YA 1E6OL 4WFHD 4XVSL 5GPRA 1FJ1A 1LO4L 4KKAD 4QHNA 5E94B 4PJHF 3UTSE 4BSVA 5GGVL 3RRQA 4NQXB 4QF1A 3NCYS 1A6UL 3RBGA 2OZ4H 4H1LA 3QHTC 2VZOA 4NQDA 3U36B 4E42A 3T0ED 1UVQB 3IDNA 1AO7D 5FGSA 4DGYL 5KG9B 3BEWA 5FEBA 3BRGC 3TT3H 1FLRL 1B0GA 2R1XB 2FLBT 3P77B 1FE8L 5K9QI 2FRGP 3K4AA 4L9LC 4QXGH 2XY1A 4BFIA 4TVPH 1GAFH 5JORA 5KZCD 4JZJC 1T7WA 3HI6L 5F9JB 1FORH 4MXQC 2EDNA 1IGTB 4NZUH 1VEPA 1ZHLA 2GKIA 3INUL 4PRPD 4H88L 5GS1C 1ACYL 4P5TD 3SJVB 5FDWA 4K7PL 4HUXA 3TEUA 1LDSA 2IQAA 2JELH 4HWZA 3BSZH 3R1GL 1KJ3L 1A6AA 3DJ9A 3RL2A 2IBZY 2WMPA 3MODL 3P0YH 2WSKA 4BH7B 4GQPH 4X7EC 1EEQA 3EKCA 1SM3L 3IKCA 5E1HB 5FA4B 4BQ6A 3UYRL 1WAAA 1NGYB 3BP6A 1Z2KA 2P8MA 3C08L 1XZ0B 3W9EB 5DEGA 1U8KB 2GCYB 2UV3A 3U46B 4B50A 2P8LB 4RMSA 1OAUL 3CDGA 4XRCA 1NBQA 4TPRH 4HG4J 2F19H 1QFWH 1QFUL 1VGKB 3VXRD 1BHGA 3MA7A 5T3XD 1Z3GH 3HR6A 4WFFE 2HG5B 1G7JB 4HWBA 4KFZC 4X5XB 4OD1L 5GS1A 1GGTA 3ROLB 1PYWB 1CFTB 1RZIA 5T5NG 4FQHA 2H41A 1I3VA 2UVEA 4RWYL 1B4JH 4GKOA 1A7PH 2ARJQ 2BNUB 4HAGA 4YBLB 3O8XC 3E2HC 3QPXL 5D7LA 3PG2A 2X4QB 2ADJA 4UTAH 3KR3H 3T2OA 5KVFH 5IW3A 3U1SL 4NQEA 3DURA 1DLHA 4PRBA 4CVWA 3K0WA 2NW2A 4LLVB 3D0LB 2Q8BH 2CKNA 4LLUA 4E41D 1X6NA 1JWSB 2GUOB 3ARFD 5IB2A 3LRGA 3OQ3B 1T1ZA 4GBXC 4NP4L 1Y18A 1F97A 2OJZH 5MEQA 4POZD 2J7LA 4RBPK 3BQUB 3C8KB 1A1NA 3FO2B 1HOCB 4N0UA 1G9NL 1YQVL 2UYLB 2YR3A 3MJ8B 1KN4H 5HHOB 3OKDA 3IFNH 4AQOA 3O0RL 1EHLL 2W9LA 2NY7H 3N0PB 1DFBH 4QT5A 4UIMA 3OKOB 1OAZH 1VACA 4S1RH 1PQZA 3D3VD 4ZS7H 3QUYC 3N9GH 3F5WB 4GMSL 1MI5B 4PG2A 1R3IL 3MNVB 1IGJB 5HGDB 5C9KA 3MMEA 2EDLA 2B1HH 4PBXA 5FOBA 3U9UB 1NLDL 1MCNA 4F7MA 5AD0A 2APVA 4WDIA 5J56B 1XGRA 2XV6B 1S5HB 5BRZD 1NC4D 3ARBC 1J5OL 1NCUA 4KK6C 4XBGB 4I18B 4XXCA 2EE6A 3DV6B 3RBSA 2ITDB 5EO9A 3P4OB 4LSSH 2IQ9H 4X98A 2B5IC 3PWJA 3QFJE 3MJ9A 1I8KB 4AEHL 1I7ZB 4M00A 5INCA 4X6BB 3BWAB 5CBAA 4QTIL 4KZDH 1BFOB 4ZUVB 2I9TB 1EPFA 1VB9A 2F5BL 1J8KA 4QXWA 3C6SB 2X9XA 2DQIL 4FFZL 4JLRA 3WV0A 2P8PB 1BJMA 1IGIL 1OP3K 1T66D 4DJMA 1I3GH 4N1CA 3QG6B 4MXWL 3B8SA 2B0SL 3D25A 3MCKA 5BZDB 2Q7NA 4W6WB 2DQEL 3GBNL 1AD0B 3U83A 4LVOC 3QUYA 5IVXF 3ZZ1A 1EVTC 5EORL 2ESVA 3A6CL 4ZOEA 3MLYL 1ZA3A 1MCEA 1ORQA 5LKNA 3V4UL 4JJHA 4XBEH 3UEZA 4WI5A 2GQHA 3DARA 1IAIL 2R2BB 5TH2A 2YWZA 1NC2A 4OGAC 4IHOA 3DI2B 3PIQA 2LTQB 2Z31C 3B6SB 4WU5A 4OUOA 5C08D 4JQVC 4UDUB 2PW1A 2P49B 3QI9C 3CFJA 3H7LA 3VFMA 1BLNB 5JMRA 4G9FE 1EO8L 5CP3H 1JK8B 4HS8L 3ZKQD 5CCKL 4Z5RB 1A1OA 1DVFB 1NBYA 4MNQB 2AJVH 1CFVH 1Q9OB 1MHEB 2K7PA 1R6VA 1HXYB 4MA3A 2IG2H 4OV5B 2C1OB 4Z7VB 3RNQB 4MNGB 1FH5H 3LS5H 1KCRL 5E8NB 1LEGB 1GXEA 4PJIA 4OCRL 5FCSH 5FYLE 1PG7L 4PJXA 1P5VA 3P3YA 5I19L 5L9DL 1AGCA 3QQ4A 2BZDA 3LMJL 3QHZH 2FBOJ 1P4LA 1MJJB 1MVUB 4OLUH 1YEJH 3F7PC 2DICA 5JW5B 2H1PH 3U6RA 4JQVA 4K23H 4XVJL 4PRHB 4JN2B 1INQA 3ZDXE 5FUOH 5DD6A 2ZOKA 3WFHA 3GM8A 3OKEB 2XN9B 2VXQH 3K3QA 2XFXA 3RWJB 3RX8A 3BGMA 1I7RA 2YPLE 2A38A 4AH2B 3AVEA 2QADD 3QIWD 4XXDA 4YGVA 4YDVA 4D9QE 1INDH 5T1MA 4HWBH 1HSBB 3ZDYF 3DX9B 4JDZB 3VGEA 3FAXA 3LCYA 3AB0B 1X7QB 2J5LB 4K9EC 2O5XH 1MWAB 1ZK9A 5E94A 4FXKB 5CGYC 1FP5A 3BGFB 3GJFK 4NQXA 5L88L 2UUDH 3LEYL 1UKSA 3VWJB 3QEQB 2Y06H 4OZIF 2FB4H 3MOAL 2B2XH 1RD6A 3U36A 3IF1A 4N8VG 2WBWB 1UVQA 5E8DL 4M3JA 5KG9A 3VGAB 2QQNH 2CD0A 2CRYA 1H3TA 1OSPL 1WISA 3JZ7A 2R1XA 5F7NC 3AGVA 1P7QB 4OQTA 4QGYA 4FG6C 4D9RD 4UIKL 4AL8L 4G3YH 2VLJD 4U6VL 3D2UD 5F9JA 1IGTA 4BELD 5DSCB 4L3EE 4H0HB 4Y4HD 1TJHH 1NL0L 4KWUA 2FCBA 2FZ3B 2E6JA 5GJSH 4FMFA 2UZYB 3U0WH 1HHIB 4GS7B 2WM0A 4M62L 3LSOA 3W0WB 4M7LT 2HKHL 3ARWA 1MAJA 3LKNA 4QHMB 5CKGA 4BH7A 4YBLC 3MNZB 4M1CD 3VG0L 4YFDB 5ABDE 2ZSVB 4K07A 4XCCL 1NGYA 4KY1H 1BQSA 1XZ0A 5ICYB 1EDQA 3W9EA 4C55A 1U8KA 2GCYA 3IXAB 1KCUH 1ULVA 4RGOH 2P8LA 3U46A 3GDBA 1Z5LB 3WL9B 5GGUB 3QYCA 1NCTA 4LSTH 4Y1AE 5BV7C 2E7MA 5E9DD 1FNAA 4JFDD 1VGKA 3MV7E 5CINL 4G8EA 2X7LB 3ZKNC 2HG5A 1G6RH 2DMKA 3GHEL 5F7MC 4OIBA 3PP4H 1A6TB 4X5XA 4HFUH 2V5YA 4DGVH 1DSFL 1UURA 1FYTB 1T7ZA 3LKOA 4EXPX 3ROLA 1PYWA 4H5SB 4KHTL 3DIFB 1CFTA 2G5RA 4HUNB 1KULA 4QTHB 3BQUC 3NVQA 4KRPC 1B0WA 4CNIB 3WEXB 1W8NA 3KYKH 4Y2DB 5BCAA 3QNYB 4O2FB 2HN7B 3BN9D 3QA3B 2BNUA 1X44A 1ROWA 4XTRD 1QLEL 4XPBH 5C3LD 2X4QA 2AQ3A 2P44B 4JRYD 3RVUD 3BUTA 1IGCH 4OZGE 1OLLA 1I1FB 4HK3J 4PRAB 3CX5K 3ULVH 3N1MC 3ZE2F 2UWEE 3ULVF 4OFDA 4Q9RL 5I1CH 2WBJD 4P2OC 3M45A 4LLVA 3D0LA 5C1MB 2QQLH 3SDAC 3SE4C 3TO4D 4WO4D 1D6VL 2ARJB 4I18C 1JWSA 2GUOA 3MOBH 4G7VL 3IGAB 3TBVB 1KLUB 3NN8B 1WFNA 2XWBB 2RJMA 4GKZB 2DWDA 4QHLB 2P42B 3BQUA 3C8KA 2M8XA 3FO2A 1HOCA 1EMTL 4M1DH 2UYLA 4FQJL 2FD6H 1I4FB 1KN2L 3MJ8A 2VLLB 5HHOA 3ME0A 4YWGL 4ZFOL 4ZFGL 3KLHC 5HI3D 1OHQA 1T89A 3OKOA 4RISH 3S88L 1T83C 5DMYA 3U4EB 4WWKB 4Z8FL 2Y23A 4KQ4L 3F5WA 1MI5A 3QEHB 4PJEF 3MNVA 1IGJA 5HGDA 1E6OH 4XVSH 4KDTC 3U9UA 1LO4H 2DBLL 5D2NB 2EC9T 5DWUL 5D7KD 1S5HA 5FYJE 2A6JB 2XICA 4XBGA 4I18A 4NOBA 1A6UH 3DV6A 3G6DL 4IM8A 4GLRI 3AUVA 4PJ5B 2ITDA 3I75B 3P4OA 5IFHL 1IBGH 2AJUL 1LD9B 3O3BB 4DGYH 1I7ZA 1ZHNB 3HHRB 2YPKB 4X6BA 3QDGD 3CFIC 3BDXA 1BFOA 4R26H 4YDIL 1F3JB 1FLRH 1NMCC 2EDKA 4ZUVA 2I9TA 4Y4FC 4MAYC 3C6SA 1FE8H 5LAXB 2P8PA 3FQNB 1RUPL 4V1DA 1G7IA 3UBXG 1EIBA 2JCCA 3QG6A 5ILTL 5BZDA 1U3ZA 1CLYL 3HI6H 1A5FL 2V17L 3QEGL 1AD0A 3INUH 2Y7QB 3B9AA 4H88H 4JY5L 1NEZA 1ACYH 4ZD3L 2YA0A 2W92A 2DTML 4K7PH 3ARSA 4MXQD 2XPGB 4NFCA 1H15B 3R1GH 1KJ3H 3RA7L 3ARDC 3MZGB 3MODH 2G60L 2DQUL 2FGZA 2DL9A 4WV1B 1SM3H 5E56A 3UYRH 1JGEB 2R2BA 3GSUB 3HE7B 3MOQA 2MCPL 3B6SA 3C08H 4UDUA 5C0AD 2JJTC 2V7NA 4QCIB 4PJAB 1BLNA 4MAYA 1OAUH 4LLQB 1JK8A 5I15L 4Z5RA 2EDFA 4MNQA 1QFUH 1VKXB 1Q9OA 4Z6AT 4JPVL 1HXYA 3EDDA 2HVJB 1MHHB 5CJBA 4OZFB 3RNQA 4MNGA 4CU7A 1YYML 5E8NA 1LEGA 4YGAB 3ARDA 4ONOA 4MYWB 2HT3C 4RWYH 3VXQA 2E9WA 5HYSG 3HLAA 1PW3A 1LMKA 3QPXH 1MJJA 3MUZ1 1MVUA 1MQ8A 3L3GB 3K1KC 4NO0D 5JW5A 4FQXB 1HH6B 5FGCE 3H0TB 5I74C 5SWZE 1XF2B 2BMKB 3O8XD 4PRHA 4JN2A 5EIQA 3U1SH 4ZSOB 1QOKA 1CBVL 4BUHA 3OKEA 5TF0A 4JZOB 5AAMA 3RWJA 1CTOA 4HMEA 3QUZB 3DGGB 1XGUB 2F53B 3N1QC 4HD9A 3A6BL 4NP4H 1HSBA 1MCOL 3DX9A 1RQ5A 4JDZA 3ARGB 4GBXD 1G9NH 5DQJB 1YQVH 3L95B 4N9OB 3A0OA 2HRPL 4GS7C 4UTBL 1FIGL 2J8UB 4YPJA 1MWAA 3WBDA 4FXKA 3HG1E 3O0RH 4B7LA 1H5BC 4HUVB 1GPOL 3QEQA 2CLRA 3U2SA 4NBXB 2XWTB 4UQ3B 2IANE 4GMSH 4K3DL 1R3IH 1RU9H 3ARTA 5IMLB 1OCWL 2OMNA 4U2ZA 5C2UB 5JDSB 1NLDH 3W2DL 1GGIH 3QJFB 4JPWL 3QIBC 1P7QA 1NUDA 3FQWB 2Q8AL 4E9LA 2XRAL 3FHAA 3ARBD 3MRPB 3K2MC 3L7FB 2GTWB 4KK6D 3L3KB 4RRPG 5DSCA 4AEHH 3DNKA 2FZ3A 5C0BB 5SWSE 1QRNB 4QTIH 1WWCA 2BOBB 2MFNA 2F5BH 1A0QL 1M71B 2DQIH 2DAVA 3MLWL 4FFZH 1LDPL 3GK8L 4W68A 3VXME 4DKEH 1RIVL 5EZIH 1YDPB 1AHWB 1JFQL 1IGIH 2VDOL 3W0WA 1IEBB 4FFWC 4QHMA 4MXWH 2B0SH 3MNZA 5FYKL 4Y16B 1NAKH 2OR9L 3ARVA 2DQEH 3Q3GA 3GBNH 5MHSD 3DXAB 4UOW1 3U9PL 1XGPB 4O5LL 5ICYA 5MENB 4TVSa 2O93L 5EORH 4WU7A 3IXAA 1J0KA 3A6CH 1Z5LA 3WL9A 3MLYH 5GGUA 4H26B 1U8LB 4FTVD 5FKAB 3V4UH 3RU8L 2NTFB 2APWA 3ECBA 4KKCC 4OCMC 4BZYA 4UINL 2B20A 3V5KB 4TNVF 2X7LA 5IF0A 1IAIH 5CD5C 2VWEE 3DETC 1MRDL 1XT5A 4KVNL 3ZTJG 2X9WA 1FYTA 1QZ1A 4H5SA 3DIFA 1JV5B 2MSPA 4QTHA 4OGAD 5KSBF 1I8MB 2P5WB 1EO8H 4CNIA 1CIUA 4RAHA 4JPIB 4HX1A 4HS8H 5CCKH 3QNYA 4O2FA 2HN7A 4BQ8A 3QI9D 3QA3A 3GUTB 1BD2B 1WT5A 2AJZB 4ELKB 4GKSB 5ERWA 3VXOA 5FO8B 3UX9B 1UWXK 3OXRB 2DLGA 1I1FA 3GIZL 4PRAA 3UTSB 3X13A 4J23A 1KCRH 1YEDB 4ZO7A 2CJUL 4OCRH 5E95B 1B0RB 4LDOB 5I19H 3B5GA 1TTUA 3CZJA 5B3JE 5L9DH 1NFAA 4KI1A 3LMJH 1F2QA 2QL1A 3THML 2QR0A 3IGAA 4IRJB 4F7TA 1I9RL 3TBVA 2ZCLL 1KLUA 3NN8A 5EZJB 2XWBA 4GKZA 3EJZC 4XVJH 4ZO6A 3T65B 4QHLA 5ALBL 5E5RB 5H35B 1IKNC 3DRQB 3KJ6L 2DQTL 1I4FA 1A7OL 2VLLA 4PGCB 1SQ2N 4RMVA 4QRPE 3RWGB 4YE4L 5D7IF 4WWKA 4BZ1L 3QEHA 5CJ8A 1QBML 3QISA 4HC1H 1TNNA 4CJ0A 4Z7VF 4OM1L 4WFGD 4HT1L 5D2NA 5KOVC 2ERJC 2J4WL 1TJGL 2A6JA 5IOPB 1WGOA 5L88H 3LEYH 2JIXB 1A3RL 1EEYA 5TQ0L 5HYJA 4PJ5A 1G9ML 1NDGA 1P53A 4OFYD 3I75A 1A1MB 1EVUA 3MOAH 3ZYZA 4YHOL 3O3BA 5E8DH 1ZHNA 2BY2A 2LAAA 1IKNA 2YPKA 3MA9L 1DANT 1OSPH 1F3JA 2GFBB 3OPZL 5LAXA 3EYUL 1D7FA 2UY7A 5T5NF 5ETUB 5GIRB 1YEHL 3AS0A 4UIKH 4AL8H 4U6VH 3GZKA 4LKXB 2ZG3A 3QPQC 1UCTA 3QWRA 3L1OL 4TOYL 2UZXB 3D85D 1NL0H 2H2PC 1SJVA 5JNYB 2XPGA 4G7YL 3EO1B 3NABL 3MRJB 2OCFD 5AUMA 4L3AA 2HKHH 1YY8A 5KVMC 3F65A 4WV1A 4HW6A 3VG0H 4NYLB 1JGEA 1BFTA 3GSUA 1KGCE 3HE7A 4XCCH 5B38A 1DUZB 3WFCL 4BFBD 2HT2C 5EPMB 1ZA6B 4F3FB 1S9KC 2NCMA 4QCIA 1KB5B 3J7HA 3F6LA 4LLQA 3HZMB 4HEME 5CINH 1M7XA 4LOUC 2N4IA 1VKXA 2GT9B 4PB0L 3MLSL 5ESAB 2ICES 1CTNA 3GHEH 4NM4L 4QY8B 2HVJA 1MHHA 3TVMB 2EE2A 1DSFH 1XFPA 4OZFA 1RULH 3RKDD 4KHTH 3VU2A 1IM9B 3ARGC 5DJ2B 1S9YB 3P4LA 3OR7A 4AEEA 2E6QA 1A66A 3VD5A 1QLEH 3GMLB 1HSAB 3L3GA 1EHNA 2F74B 1HH6A 5F44A 3H0TA 2SEBA 1XF2A 2BMKA 5JQ6L 2ATPB 3VI3F 2EXYD 1QHOA 3PHQB 4LHUD 3WO4C 4Q9RH 4ZSOA 3MGAA 4JZOA 5ISZD 2ZUYA 3QFJB 4IJ3C 4CGTA 1D6VH 4BH8B 2Y6SD 3OSKA 1T1XA 4P2OD 3IDYC 4G7VH 1CXFA 3QUZA 3ALPA 3DGGA 3SDAD 4X7TB 2F53A 1RVFL 1C5BL 5F9WB 4BSJA 4FFVC 2O26U 4ZO9A 3L5JA 4MB3A 3ARGA 3BZDA 1EEZA 3BIKB 3CFCH 1EMTH 5DQJA 3QDMD 1I9JL 4FQJH 2J8UA 1KN2H 5DJ6B 4AQ1B 3MUHL 4YWGH 3T3PF 4HV8B 4M02A 1YJDL 4ZFGH 5JIIA 4HUVA 4Y16C 1LEKB 1PEWA 2XWTA 3O4OB 4UQ3A 1XR9B 2OXGA 5IWLA 1T5XB 4KQ4H 4TNWF 3KLHD 4F58L 2JJUA 5IMLA 1KPRB 1CGSL 1MCWW 1FFQA 2DBLH 5JDSA 1I9IL 1J10A 1IAOB 1BJ8A 5F93C 5E5UB 3QJFA 1UJTA 4MJID 4KMTL 5FGBC 2HTKC 3MLPA 1JRHI 4XNUL 3FQWA 1NDMB 3G6DH 2APXA 3BH8B 4D9LL 3MRPA 5GQBA 1IILE 4G9FB 4TSCL 2AJUH 3L7FA 3L3KA 2DQDL 1J8HE 3PWUB 1F58L 1GOHA 2I5YL 5LQBL 3SGEH 2E5EA 5C0BA 4Z77A 3JV0A 4FHBD 1QRNA 3BGAA 4YDIH 4ALAL 2BOBA 1CD8A 3MBEB 2YD8A 3DROB 1M71A 1PFCA 2IALB 3KPRE 1ND0B 2OXHA 1RUPH 1YDPA 3IS0X 4JO1L 1IEBA 3UTPD 5IR1A 4Y4FD 5ILTH 4Y16A 1CLYH 1A5FH 5GRJL 2V17H 1ZGLB 3QEGH 4EI6B 3DXAA 3AU1B 1XGPA 3HMXH 4JY5H 4P5KB 5B8CC 3BRFA 5MENA 1HH9B 2DTMH 5TF1H 4OI7A 2AEWA 4OT1L 4JHBA 1A02N 3RA7H 1T1YB 4H26A 1U8LA 1UKTA 3DSFH 4HJ0C 5I76A 1JZ5A 5FGBA 2G60H 3QEUB 5FKAA 2DQUH 5HYIA 1ZTXL 2NTFA 1CWVA 4L4VD 4LLWB 4LSVL 4ZNEA 1RJYA 1MSPA 4I0PD 4K3JL 2KQMA 3SDXE 1RJCA 5IEHA 1MRCL 2MCPH 5F9AC 1XGTB 5TFSL 1TTFA 1JV5A 2YPLB 2VZ3A 4KAQL 3WN5C 1N0XL 1K3IA 2P5WA 1I8MA 4UB0L 4JPIA 4C4KO 5I15H 5C7XL 2E7HA 4Y2OA 5E6IC 1C16B 5I8OL 3LKQB 4NKIL 1P7KB 4ELKA 4XWOC 5FO8A 4JPVH 5AEAA 4UV7L 4EEEA 1K8IA 3RTQB 3AY4A 3OXRA 5C70A 1JTOA 3NCYP 3UTSA 1YYMH 1YEDA 1JF5A 2YEZB 2RB8A 4G8GD 2VZ1A 1JPST 1YECL 1GH7A 5KJRL 2VAAB 4K7FB 1JUFB 4YNYB 3CK0L 2NY2D 5FM8A 4IRJA 2UUDK 3BZFB 5EZJA 3T65A 1FVEA 3RAJL 4P9ML 3WN5A 5HVHC 1CBVH 4O2CB 5CILL 1N26A 5DRNB 5HSFA 4NNXB 3VXNB 4P2QE 4PJAF 4NQTA 4GXUM 4L3EB 5EU7C 4JM2B 1BFVL 3QQ3B 3O3AB 3SE3A 3EOBB 3RWGA 4O2EB 4WTZA 12E8L 3CLFH 3QRFM 3A6BH 4XCEB 3EDJA 3HPJB 3BOVA 1MCOH 1ORSB 4WEBL 3MREB 1A21A 4BQ9A 1BOGB 2HRPH 1J0ZA 4EIZC 4UTBH 1DQML 1GGCL 1U8HB 5D6DC 5IOPA 4OF5A 1U8NB 1UWGL 3MV9E 1GPOH 2OM5A 2CK2A 1A1MA 4PTTB 3AMLA 5KBNC 4C56E 4EDWL 1EFXD 4Y1AB 5CEYB 1ZGLM 4JZNB 1A7RL 3MV7B 1OCWH 2BFVL 2NXYB 1XIWB 3VJ6B 3AXLB 3W2DH 2GFBA 1NUFA 5DJXB 3IDUA 4KKLD 4JPWH 5DVLA 5I0DA 4JRXE 4KXZI 5ETUA 5GIRA 2Q8AH 2NQCA 4NCDA 4RGMB 2XRAH 2ICWJ 1IGFL 3QIBD 4R90L 2AK4D 4WFHE 1K2DB 2HYMA 4QRQB 5JXAH 4WI3A 3TBSB 2D7PA 2XYCA 3RUGF 4AIZB 5JNYA 3TNNB 3EO1A 1A0QH 4NJAL 3MLWH 5CSZB 3GK8H 3H8NA 1BF2A 5D6DA 1RIVH 2VDOH 1JFQH 1N6UA 4LEOA 4OZGB 5FYKH 4YO0B 2G75B 1BQHB 3OR6B 2OR9H 5HDLA 4NYLA 3VRLE 3T0EE 2UWEB 1AO7E 5E6ZA 3OB8A 1DUZA 4NRYB 4FFWD 3U9PH 2CMRL 4X8JB 4MD5B 1NGPL 3R0NA 5EPMA 2XG5A 3LEXA 4F3FA 1TPXB 3V0AC 3QRGL 4ODHL 5I30L 1KB5A 2AEIT 5DXWA 1S5IL 2YD9A 3RU8H 3K2UL 4TTGA 5EC1B 4K3HA 3AM8C 4ODUB 2VLRD 2G5BA 2GT9A 5ESAA 4IRSB 2W0LA 3VFNB 1A2YB 1MRDH 3S4SB 4GXVL 4QY8A 5D8JL 4KVNH 4LFHG 3MLTA 3ILQC 1SYVB 3DETD 2XI9A 7FABL 1EZVX 4HKJB 3EYFB 4R4BB 1D9KB 2LVCA 3FO9B 4P3CL 2NY3B 3GMLA 1HSAA 2FX7L 2F74A 2PR4L 1KTKE 2BVPA 3GIZH 2H8PB 4HPYL 5E00A 3C2SA 2CJUH 1FAIL 2DBJA 2YD4A 2N7BA 2EICA 1BJ1J 3VXRE 5J0BA 5T3XE 4LGSB 4PP1C 3ULUL 3QFJA 1UB6B 5TE4L 4BH8A 3DYOA 4MS8C 1NJ9B 1LWRA 3JWDC 3THMH 4NO3B 1I9RH 2PYED 4X7TA 2ZCLH 3IRPX 1FQ9C 4EUPA 5ALBH 3K4DA 4DW2L 3SEPA 3BIKA 3LS4L 3KJ6H 2A73B 3CAFA 4Z7QE 3O2DL 5IHZB 2DQTH 2W0PA 2VN7A 1A7OH 3V2AR 5DJ6A 4V2BA 5A16B 3G6JE 4S1DC 4HV8A 5IB1B 4YE4H 1LEKA 2DI9A 4LIQL 3GSVB 5JR1L 4LLYB 1XR9A 3VFSB 3QZWB 3EO0B 5CZXD 3T4YB 3TP4A 4BZ1H 3N1FC 1QBMH 1KPRA 4OM1H 5FYJL 4HT1H 1IAOA 2FJHB 4E41E 1TJGH 1CLOL 3AREB 2P5ED 4WJ5B 2Z8SA 1NDMA 3PL6D 5TQ0H 1S8DB 1G9MH 2WV3A 3TJHC 4YHYB 4G9FA 3GBLA 5HHME 1F02I 3NGBB 3PWUA 4HMDA 1ZLVH 3MA9H 3RGVC 5DA4A 5GZOD 1M7DB 5I8EA 3MBEA 1I3UA 3DROA 1I75A 1ND0A 2XXMB 3EYUH 2R0ZL 1WTLA 1YEHH 3HAEG 3UJIL 3NIGF 1PY4A 5C09B 3D3VE 3GBML 4GRLC 1ZGLA 4PLOB 3L1OH 4TOYH 4NWUL 4PJGF 1JZ2A 3AU1A 3V8CA 2ADGB 1HH9A 5FYKU 4G7YH 5HVGB 2OYPA 5BRZE 1T1YA 3IS1X 3NABH 1IFHL 4N0FB 2H2PD 5FGCB 5SWZB 4Q9QL 5L6YL 1UFUA 2E9JA 4LLWA 4XNZC 4PJBE 1D3CA 4NRZA 4WCYL 1B9ZA 3QIUC 3WKML 3WFCH 5F21B 3N1GC 1XGTA 4I0CC 1F6FB 4DEPC 1GVIA 3FQUB 1A4JB 2YPLA 4E0RA 2WAHA 4ZS6C 2GITB 5J11C 2COQA 3SKMB 2XTJD 4YXHL 1U91B 5DFTA 3QBTB 5CP7B 4HIEA 1C16A 3WIIL 3LKQA 1P7KA 2AXJA 4PB0H 4GRLA 1S78C 5T1LD 2D3VA 4NM4H 1NQBA 3SKUD 1CF8L 1T0MA 3MUJA 1GZPB 2BVEA 3FT3B 3SDCC 4HG4K 3ZO0A 5A2KH 2YEZA 3MCG1 1AY1L 4LP5A 4PD4J 3X3FL 1UACL 1MFNA 5GGSY 1PZ5B 2IANB 4WNQB 5KVDL 2VAAA 3WUZA 1TZHB 4K7FA 1JUFA 4YNYA 1TDQA 2XZCL 2LU4A 5C08E 3LDBB 5D96B 3VG9B 5JQ6H 1OGAA 1NKRA 1FZJB 1NCAL 1GCFA 1PLGL 4IDLA 9CGTA 2NXYC 4O2CA 5DRNA 2ED8A 4YZFF 4EXKA 1N3NB 1MCKA 1V3KA 4QXTB 2DYPB 2W0FB 4L3EA 2BJML 4JM2A 3QQ3A 1C5DB 5KSUA 3ZKXC 3O3AA 5I1JL 4PS4L 4RGMC 3HKFA 3EOBA 5EC2A 4O2EA 4XMKL 4ELMF 1RVFH 1QSFD 1C5BH 4XCEA 1FCCA 2AJXL 4YFLI 2DLTA 3HPJA 3VXMB 1A64A 3UROR 1X4YA 3GSWA 1ORSA 1IAKB 3C60C 4P46C 4QLRA 2DQFB 3MREA 3O81A 3LQAC 2PXYB 1I9JH 1U8HA 3ESUF 2EDHA 5HGAA 2FSEA 5AG8A 1U8NA 4WEUD 5E8PA 2PYFB 4LSRL 3EYVB 4MSWA 4PTTA 1IC5L 5BO1L 2WBKA 1G0XA 1JTTA 4Y1AA 3BMWA 4F58H 2F8OA 5CEYA 1BBDL 1CFQA 4JZNA 1CGSH 3MV7A 3VFOB 3VJ6A 1HINL 3AXLA 3ZTJH 2AP2A 1I9IH 2EXWD 5DJXA 1IKFL 4KMTH 4E5XB 1RUML 4XNUH 3BKYL 3QWOB 4D9LH 4IRSC 3WS3B 4TSCH 4YC2B 2DQDH 4C58B 4IDJL 1F58H 1K2DA 2I5YH 4QRQA 4C57C 5CGMA 5LQBH 3TBSA 4M7ZB 1KXVC 3TNNA 4ALAH 4NZRH 1JF1B 5CSZA 4QNPE 4JO1H 4OZGA 2AERT 3WJJC 4YO0A 2G75A 1BQHA 3F7VB 3OR6A 5ADPL 5GRJH 5E8OB 2DD8L 5JO5B 2NY4C 4JREC 4X8JA 2QBWA 4MD5A 3L9RA 3CZFB 3EJJX 3LQZB 3BP5B 3HNVL 4FQQB 2D7MA 4X6CF 3A6OA 1A6VL 5J12B 4LL9A 4BK5A 1P4IL 1ZTXH 4D9RE 2VLJE 4LKCB 5EC1A 1ZAGA 4LSVH 2MMXA 4M6OL 4ODUA 4HJ0D 5F8QC 3RWDB 4IRSA 4K3JH 2E7LA 3G6AB 4JG0L 3VFNA 5D1ZB 2ZKHL 3QB7C 1MRCH 1RIUL 3S4SA 5I73B 3FFDB 4Q2ZB 2A74B 4F9LA 3QXAB 5DHVB 5TFSH 4LVNC 4PJ8B 1CDIA 3MNWB 1SYVA 1BIHA 1JF6A 3O2DA 4GMTL 1N0XH 4QRPB 4HKJA 3EYFA 4UB0H 4R4BA 4Y5YC 5TDOB 1SEBB 5C7XH 1D9KA 5BVPL 2BY1A 3FO9A 5I8OH 2EYTB 4NKIH 3WJJA 4WTXA 2OTWB 2D31B 1F2XK 4XNYL 4UV7H 4YJZL 5E6ID 1FZOB 4S11A 4EI5B 4ODXB 4XWOD 2QKIA 3VD7A 2H8PA 2V2WB 1UH3A 4N5UA 3HI5L 4M9OA 5MERB 4WUKL 1KC5L 2FLRT 5E9DE 4JFDE 1YUHB 3FOLB 1YECH 5J4MA 2P48B 4HF5L 5IVZB 1J1OL 3NFPB 4GG6F 5KJRH 4G6KL 2DOCA 4W4OC 3CK0H 5DVKA 3KPTA 1CQKA 5KS9E 1JP5A 4NO3A 1WEJL 3T3MF 2GK0A 3OKLB 3QULB 1WFUA 4YHYC 5C0JB 1ZT4B 2X4SA 3NGBC 4Y4KC 5HGHB 5DFVC 3RAJH 1AKJD 2VR9A 4PY8I 1CXIA 4ORZC 2A73A 4U1KB 4NUJB 3ALXA 4PJDF 5F7DB 5IHZA 5CILH 3K8LA 4NFDA 4U6HB 4U1HB 3O6FC 1KACB 1DBAL 1BFVH 3DBXB 5T5FL 4JRYE 3MRRB 4UBDC 4GT7A 1GIGL 1J0YA 12E8H 5I0ZA 3GSVA 4LLYA 1JNLL 5DUML 5CS7A 3ET9F 3VFSA 3QZWA 3EO0A 3T4YA 1BOYA 5E08L 2IC2A 2B1AL 2QV2A 4WEBH 4PJCF 3RIFF 3G5XB 3VWKB 4XPHL 1YPZE 4Y0GA 2FJHA 5ALCL 2L7UA 5LGJB 1A47A 1OARL 1DQMH 1GGCH 1SHMA 5D93C 1N2RB 2RCSL 3AREA 5FAAA 4PRNB 1UWGH 2ADFH 4W4OA 1X5KA 1S8DA 5DUPL 4FNLL 4YDKL 1S7WB 3M1BB 1R3LB 1KV3A 4EDWH 3HUJE 1AGBB 1DR9A 1A7RH 2BFVH 4Y88A 4YDLB 2HKFL 1M7DA 5DURD 2C9AA 4OSUL 3VMNA 3CH8A 2HMID 2H2SC 3RZCB 1U0QA 3IAGC 3BX7C 3W11C 2Q7YB 1BQUA 3S3JA 1IM3B 1IGFH 4ENED 4OGYL 2E9IA 1I8IA 4R90H 3D48R 5E2UL 3MRHB 2NY1D 2ADGA 1UXWB 4AG4H 2Z0BA 4JGJA 3HE6B 4NQCD 5D7KE 4OCWH 4NJAH 4XMLL 1EO7A 2QQKL 4N0FA 5SWZA 1QPXA 4JFPB 3CC5B 1OQOA 5F7YC 4LSUL 4LAQL 2FJFA 3V5DB 3MX0A 4D0CA 2CMRH 3LDBC 3QDGE 4KROD 5D70L 4EDXB 1NGPH 3FQUA 1A4JA 2FDBP 1WAAE 1FZKB 3QRGH 4ODHH 4HJGB 4M6ML 1B2WL 2GITA 4K8RL 1S5IH 1K9TA 4X9GA 3SKMA 5C71A 4LGRB 1U91A 3K2UH 5CP7A 3FB5B 3BRDA 4I4WB 4G6ML 4TQEL 3SPVB 1E4XI 2HH0L 4RRPA 3STZB 1F4XL 4RNRB 5EBGA 1CGVA 1ZLWH 4GXVH 4KU1A 5D8JH 5DUBB 2NR6D 1U58B 1GZPA 3FT3A 4HSQA 3HG1A 2CH8A 3LB6C 7FABH 5BXFB 2X4PB 2PXYC 3S98A 3GB7A 5F8RC 1PZ5A 2IANA 4WNQA 3JUYA 1FIEA 4P3CH 1K3ZA 1TZHA 3MPCA 1NBZB 5CSBA 4DQOL 5KTEL 3ULVD 4A6YA 3R8BB 2VC2L 5C0AE 3I3DA 4U7SA 5EUOF 2UWEF 4GOSA 4XPGL 3QCVL 1Z9OA 3KYNB 1FZJA 4HPYH 4TNWK 1Q1JL 4ZDHB 4AEIL 3PQYD 1FAIH 1F6LL 1N3NA 2F58L 4F57L 5FOJA 4QXTA 3JV4B 2X9YA 2W0FA 4I2XE 3ULUH 1J8HB 5C0DB 4JFFD 5DJYB 5CD3B 3RVXC 4PGEB 3ULUF 1C5DA 5SWSA 3I50L 2Q20A 5F7UA 4N5EC 3B9EA 2B4CL 3KPRB 3VXMA 1QRKA 1IAKA 4MS8D 4BKLB 1ZWIB 2HFTA 2HLAB 3UDWA 4DW2H 3LS4H 4OAWB 1EHAA 3O2DH 2PXYA 5ITFB 3WLWC 1G1CA 4QHUB 4CDGC 1OL0A 3TYGL 2QLVB 1CDBA 2EDDA 4MAUL 1E4KC 2PYFA 4UU9B 3WIFA 4LIQH 4ZPTB 5JR1H 2DMCA 3KPQB 3G08B 2LU7A 3V52L 4S1DD 3VD4A 4CN6A 1MAKA 1U9KA 3VFOA 5FYJH 3EFFB 1QYGL 2OLDA 2PW2B 2ENYA 2H3NB 5J12C 3SDXB 3MFGB 1CLOH 3QUXB 3QWQB 4E5XA 2PO6D 4XMPL 3PDGA 3D87B 3WHE0 3QWOA 5EZLB 3WXVL 4XHJC 3UJTL 1VSCA 3WS3A 3EYQC 3E1F1 2YN3A 4UAOC 2BRQA 1BJ1H 3TZVC 5I75B 4KPHL 3TJHD 4JCMA 1WF5A 1KF9B 1PD6A 5IV2A 1JF1A 3LD8C 3VXTB 3RGVD 3QH3B 2R0ZH 4IIQC 5AYUL 1F4YL 3CVHL 3UJIH 1Y6MR 4HCRL 4UT6L 3F7VA 3GBMH 1LK3L 5E8OA 3NAAL 3JV6B 4NWUH 3P4NB 4EI5C 3BPOB 4S0SD 4LCWD 1N6VA 1W0WA 3CZFA 1OVZA 1YEGL 3LQZA 3BP5A 4FQQA 4PJ7E 4OD2B 4Z7NF 4PJFF 4N0CC 5I71C 4MHHI 4JFED 4OKVB 2Z93B 2ESVE 5C6PB 1WC7B 4HULB 4LKCA 5L6YH 2X2YA 3E3QC 4MZ3A 3DRTB 5E2VL 4RFNC 3RWDA 8FABA 15C8L 5D1ZA 3TA3C 5AZ2L 2EIZB 3WKMH 3FFDA 3VD9A 2A74A 4WW2B 3QXAA 1NGXB 4P2QB 1PBYA 1SYSB 5D5MF 4MJ4A 3MNWA 3QIUD 4QRPA 1OPGL 4G6FD 5DO2C 1NMAL 4YXHH 1SEBA 3REWA 2RBLA 2N56A 4M5ZL 5BMFL 2EYTA 1O7VA 5TQ2L 4ZS6D 4ZNCD 5MHSE 2Y5EA 2D31A 3T8XB 3MACL 3SJVD 2Z91B 4EI5A 4P9HC 1QFPA 4OKDA 2CRIA 2V2WA 1S78D 3C6LB 3MV9B 1Q9KB 2EIEA 5MERA 2IADB 1AY1H 1OP9A 4FTVE 5F1KC 1VFMA 1DEEB 2J8OA 3X3FH 2AKRB 1YUHA 2KDGA 1UACH 3FOLA 3MRCA 4NO2B 7CGTA 1PG7W 3SDCD 5IVZA 4C56B 3NFPA 4KJPD 5KVDH 2ATKB 1L0QA 1UB5B 4P3WA 1QSZA 2XZCH 1JI1A 5JTWA 3TA3A 4PTUA 3OKLA 4JFHD 4U49A 3QULA 5C0JA 1KJ2L 1ZT4A 4ONHB 5HGHA 1NCAH 1UCBL 4JRXB 1PLGH 1K4CB 3L5HA 3DHJA 4U1KA 4OLZL 3LN9A 4NUJA 2VDKL 3LV3B 3V0WL 5F7DA 5F71A 3ZE0E 4U6HA 3BP4B 4U1HA 1CVSC 4U3XA 2BJMH 1FFRA 4PREB 5I1JH 4PS4H 3MRRA 3OKMB 4XMKH 1KJVB 1PVHA 2AJXH 4GRWE 5DMKB 2O5YL 1WZLA 3PJSA 3VWKA 4R97C 4Q0XL 1XF3B 4LEXL 2OL3B 3WNLA 3T0EB 5A3ID 5LGJA 1AO7B 4HH9B 3C60D 1N2RA 4P46D 4LQ1A 4M93B 4PRNA 3V6BR 3ZTNL 2D9CA 4U1GB 5IFAL 4EKXA 3RZWA 5C0CD 5FYJU 2NPLX 4LSRH 5GGSB 5CEZL 1IC5H 4PY7B 4FABL 5BO1H 1S7WA 1SMOA 3H2WA 3M1BA 1R3LA 3IDJB 4KRNA 5DQ9B 1AGBA 1BBDH 2FJGB 2MNUA 5KZCB 1QBLL 1HINH 4ZXBC 4M6AA 4HLJA 1ZEAL 1IKFH 3J8F7 2A9ML 4P5TB 2DJSA 1AP2B 1RUMH 3HRPA 3BKYH 4JO4L 2VXTL 2WQ8A 1IM3A 1BFSA 2Y36L 4LP4A 1C1EL 2BVTA 2JLLA 3MRHA 4WFGE 1UXWA 5I16B 3O6KL 1M6OA 2BY3A 1MCJA 3C8HA 1CFNB 2VDLL 1R3HB 3SGDI 1CGXA 4KQ3L 4JFPA 3CC5A 2YSSB 1KYOJ 5ADPH 3UAJC 4Z7UE 2DD8H 3V5DA 3VXRB 4AMKL 4U1SB 3HNVH 2NY4D 1FZKA 4HJGA 1A6VH 2DKSA 4RMQA 1T5WB 5DTFB 1P4IH 2Y4SA 5B21A 3D18B 4I4WA 4M6OH 4DFIA 3SPVA 1F3DJ 3STZA 4RNRA 4JG0H 3CDYA 2ZKHH 1RIUH 1MVFA 5EBWA 5DUBA 1TJIL 5L8LB 1U58A 1OAQL 2YUZA 5EU6D 4FXGA 3G6JB 4GMTH 3DV4B 4YHIA 3ARXA 4MCZB 3S3PA 5BXFA 3WUWB 3UPRB 5BVPH 2GK2A 3MRGA 1NBZA 4WHCA 3MJ6A 4XNYH 3QHFL 3DMMB 4TTDC 3UTZB 5FA3B 4E41B 3D5OF 3H3BC 4AT6B 3KYNA 4HBQA 4Z9KB 3ARFB 5T3XL 3O11B 1QVOA 1KC5H 4ZDHA 4NIKB 4F2MB 1P9MC 5HPMB 4DUXA 5I1DB 5DJ0B 5HHMB 2FHCA 4HF5H 1J1OH 1J8HA 5C0DA 3QUXC 4G6KH 5DJYA 2YS4A 3CFEB 4PGEA 1GZQB 2W9EL 5ECJE 3TYFB 3U4BL 2C7UB 3KPRA 3EDKA 4TULL 5JZ7D 2G9HB 4BKLA 1ZWIA 2WW8A 3Q6FB 3RIAK 5DHVH 1DVFD 4OAWA 1ZLVK 3D3VB 2QTEA 4Y4KD 5ITFA 5DFVD 4TSBL 4F7EB 4QHUA 4HCRA 1DBAH 2BXYA 3KPOB 5HVWA 1JPSL 3DO3A 1X5IA 5T3ZL 3OG4B 3RPIB 5MI0B 4UU9A 3VH8B 3O6FD 4ZPTA 3TFKC 1JNLH 5DUMH 5BRZB 1AGDA 3G08A 1D5XB 3WS6C 3QSKB 5E08H 3T4AB 2B1AH 4RQQA 4UBDD 2YD5A 1P9MA 4XPHH 3EFFA 4PJBB 5ISZE 2PW2A 1P69B 1OARH 2H3NA 3MXVL 3UXFA 2RCSH 3QUXA 5GGTA 1GRWA 3KJ4B 3OBAA 5JPMB 1G0DA 5DUPH 3RX5A 2VDRL 4FNLH 1QFHA 1R5VB 2VRAA 1VA9A 4YDKH 3VI4E 1X5GA 2EDQA 1T3FB 4RAUB 3BFOA 2XN9D 4X6FB 3VFUB 4ODBD 3QDME 3LN4B 3CVIL 2HKFH 1N8ZB 1YC8A 2R2CA 1TTGA 3OAYH 1NFDF 1G7MA 4OSUH 3QH3A 4YDJB 5T1DL 1MCRA 2VABB 1HDMB 3F7RA 3O6LL 4J3UA 3S6CA 5DR5H 4HKBB 4V1DE 4XAKD 4R4FH 3FO1B 4OGYH 2JCCE 3JV6A 3WS6A 1PG7X 2EC9U 3P4NA 3V0VB 5E2UH 8CGTA 2NXZC 2VERN 3W11D 2Y5TB 3QG7H 3I02A 3EDEA 4DCQB 1P2CB 4OD2A 3O2WL 4MJIE 3RJDA 3VWJD 4XMLH 2QQKH 5C08B 1JNHB 4OKVA 3VGDA 2Z93A 1CFSB 1WC7A 2BSSA 3DRTA 4LSUH 1S9XB 4LAQH 2HFGL 4JM4L 3QCUL 4YFEA 5D70H 3VE0B 4P2QA 1NGXA 1R3JB 3GO1H 4GH7B 1SYSA 4L8SC 1G1YA 4PLJD 3DX6B 5F7WC 1HYRC 4M6MH 5E4EC 1B2WH 3T1FA 3VDCA 4LNRA 1B4RA 4H1LG 3FFCA 3UTPE 5DFWH 4G6MH 4TQEH 3WIHL 5CBEB 1O0VA 2HH0H 1DQTA 4RCAA 5D2LE 1F4XH 3PGDB 5J13B 4KKAC 1KTDB 2Z91A 1FC1A 3C5ZD 2YZ8A 1UZ6E 1N0LA 3CX2A 1G7LB 1F13A 1M4KA 3C6LA 3MV9A 1Q9KA 3OMZA 2IADA 3R4DA 2CDEB 2VQ1B 5D7SL 2OMBA 1DEEA 4KKBC 4P4KC 2AKRA 4L4VE 4NO2A 3T0EC 4XX1G 4C56A 2XQBL 1MFDL 2ATKA 4DQOH 1UB5A 5KTEH 2NZ9D 1BWMA 4L5FL 2VC2H 4U05A 3L3DB 1PGRB 4ONHA 4XPGH 3QCVH 4L8SA 1HE7A 4JRXA 2NX5D 1K4CA 3QIWB 1CXEA 1II4E 3IU4L 4HS6B 5EOQL 1Q1JH 2ZUQB 4AEIH 3IDGB 3LV3A 4HJJL 2ITCB 4XP6L 3BP4A 2F58H 2DIBA 4F57H 4WWID 2Q3ZA 4P5TC 5BW7C 3JSSA 4JFXA 4PREA 1RURL 4DAGL 3I50H 2DMBA 3OKMA 1SJEB 4OUUB 3GJEB 4K71B 5HYEA 3JVGA 2B4CH 4HKXB 3RVXD 2HJFB 4OLWL 4N8PA 5DMKA 4Y2DD 1JHTA 4UOJA 1K8DB 3OX8B 4LGPB 4N5ED 2OL3A 3PDOB 3T0EA 2VLKD 5GHWH 1AO7A 2YZ1A 4HH9A 1IC1A 3TYGH 4OF8A 1A9EB 5I2IB 3D6GA 5GGSA 3WLWD 1RZKL 4PY7A 3NPSC 3HRZB 3V52H 4ODWB 2CIIB 3QAZB 2E6PA 2R39A 3D2UB 5ICXA 1MJUL 1QYGH 2Q6WB 4PRPA 5DJZB 1FO0B 4FZEL 4P5TA 5BW7A 4XMPH 1AP2A 1EAJA 5IBLC 4CL7A 2X41A 1HNFA 1FNEB 4HFWA 5JIPA 4OCXL 1OTTC 4KPHH 5I16A 5KSAB 2WUCL 4D8PB 2XZAL 5L2KD 2NY0C 4JQXA 3SOBL 3TZVD 1CFNA 1R3HA 5HDBE 1ZLUH 3LRHA 3NIDF 3DHMA 5AYUH 3CVHH 1IRAY 2YSSA 4UT6H 2WP3O 4XNQB 1LK3H 4FQPA 2I9LB 3PWLB 3NAAH 1MCLA 4HKZB 5E9DB 4JFDB 1ZHBA 1I7UB 2N1KA 3VXRA 2YWYA 4L4TD 4U1SA 5TDPB 1YEGH 2J1KA 2NYYC 4KJWD 1OOAA 3FB7A 1T5WA 5DTFA 3D18A 4JY4A 5DMIL 4POZC 4RX4D 3SDXF 5E2VH 3TC9A 4N0CD 4HPOL 2AK4E 15C8H 1YNLL 5EU3B 5FXCH 5AZ2H 5B22A 2P47B 1CGUA 3VA6A 3NFSH 1OT2A 3G6JA 3DV4A 1JRHL 1OPGH 4JRYB 2FGWL 1NMAH 4GLRH 1CYGA 3EHBC 3WUWA 5BMFH 3CSPA 4M5ZH 1DUYB 2IFGA 5TQ2H 2WBJB 4MCYB 2EKSB 3T0XA 1YPZB 5MI0C 4WTWA 1XF4A 3TO4B 3UTZA 1T6VN 2V6HA 5FA3A 4P99A 4E41A 4WO4B 1NCBL 5C8JA 4AT6A 1T0NB 3ARFA 3O11A 4QHNB 1NKOA 4GXUN 1Q0YL 4F2MA 4PV9B 5HPMA 3RIFK 5I1DA 1BBJB 5DJ0A 4BSVB 3OGCB 4DKAA 2UZIL 2VLRE 1FLTX 5HHNB 4H1LB 5CAYB 5ID0B 3HUJB 3GNML 3MV8D 1FN4B 3TYFA 3LAFA 1KJ2H 2B8OT 2C7UA 1ITCA 3AC0A 3P30L 2G9HA 1UCBH 1T66C 3MFFB 5JW4M 3Q6FA 3Q0HA 4WW2F 1Q94A 2NY6B 4OLZH 5ENWB 2VDKH 3F58L 1T7XA 4YAQB 3D3VA 3V0WH 5GJTL 5SX4I 1L4IA 1QP1A 4F7EA 4JKKA 3IAPA 5JORB 1ZE3C 3KPOA 2OTUB 2WIIB 1SY6H 3RPIA 1CQYA 3VH8A 1V05A 5BRZA 1NC4A 3TIDB 1SVZA 5FDWB 1D5XA 3PXHA 3T4AA 4I3SL 2O5YH 1JL8A 4Q0XH 3S34L 2VXSL 1F3RB 4LEXH 4PJBA 1FG9C 3RL2B 3VXSD 4M03A 3VW3L 1JHLL 3IKCB 3QDGB 4ZYKA 3FRUB 4Y5VC 3ZTNH 1O5DT 5IFAH 4FQXD 2PYEE 5JPMA 3Q6GL 1ZVHA 4NHUB 1R5VA 2QSVA 1Z9MA 2KBGA 5CEZH 2LU3A 4FABH 4LPWA 3GSXB 1T3FA 5HYJE 4RAUA 4X6FA 1YYLL 4MA7H 1QBLH 1NMBL 2X6MA 5DQDL 3LN4A 4XRCB 1N8ZA 1EV2E 4AJ0A 4LSQL 4L9LB 1ZEAH 5F72S 4YHML 3UTTD 4IOFD 2DM2A 4NQVA 2A9MH 4JZJB 4YDJA 4ZXBD 1C5CL 3EOYG 1HDMA 2DM7A 3G9VA 3O6ML 4PJHE 5J13C 2Y36H 3FO1A 3NCJL 4ZFZB 4X4YB 5J6HA 2XKSA 5IESL 4X4XB 5H37H 1ZLWK 2Y5TA 1FFNB 5CZVL 1YN6A 1FDLL 5FYKD 4DCQA 1P2CA 5E6YA 3RWCB 2AV7B 4KRLB 2VDLH 3X11B 5C08A 2P5EE 5C0AB 1JNHA 3T0WA 2XT1B 3GSNH 2I25N 3W39B 1HXMA 1DANU 2J88L 1GHFL 1TVDA 3S3SA 32C2B 4UUJB 3VE0A 4AMKH 1HKLL 1R3JA 4XCFL 4I2XB 3DX6A 3UAJD 2QADC 5B4MC 4IMKC 2RGSA 5FHAL 2FECI 2EE9A 1P4BL 5GSRB 5CBEA 4OZHF 5C0FB 3BPCB 4LQFL 3PGDA 1KTDA 3RVTC 4M9PA 1ZOXA 2C1PA 2XKNB 1TJIH 1Z9SA 1G7LA 1OAQH 4QO1A 2YC1B 4YUEL 4NO0B 2CDEA 2VQ1A 4U6XB 2IBZX 1UM5L 3O8XB 1MAML 4OFVA 5DD1L 1WICA 4PGDB 4QT5B 5GGRY 1VFUA 4NC0B 2LVEA 4GSDL 5JMOC 1RZGB 2G2RB 2M2DA 3QHFH 2VSDA 4XP9L 4RMTA 3L3DA 1UZ8B 3MMEB 3WD5L 1A3QA 5F1SA 2AXHA 3ZMRA 4F7MB 3QIWA 4RIRB 4HS6A 5T3XH 1CU4L 4WDIB 4IMKA 2XTJE 1WZ1L 1XGRB 3IDGA 2ITCA 4P2RD 2GHWB 4Y4HC 2EZ0D 5K9KB 1SVCP 5D72L 1I85A 1FVCB 4GBXB 3WCYA 2W9EH 4OUUA 3GJEA 2FR4B 1QBAA 3U4BH 4HKXA 4N0YH 2HJFA 4TULH 5CBAB 1Y0LB 4M1CC 1F3DH 4JLRB 1K8DA 3TH3T 1BD2D 3PDOA 2M1KA 3GMNA 4TSBH 3EW3B 3GFUA 4BUGA 1A9EA 5I2IA 1JPSH 4G80B 5T3ZH 5DGQA 5JPNA 1GC1C 3KLDA 3QUYB 4P5MB 4PJ7B 5BOZG 1YMMD 2R2HA 1GJIA 3KYMB 3HRZA 3DTXB 5FIEA 3ARYA 4ODWA 5IW1B 2CIIA 3WDJA 2DLFL 2ESVB 2VLJA 3D2UA 4NN5B 1ZA3B 3U0PB 3TFKD 3WFBL 1ORQB 3ARBB 4LMQI 4BQBA 2Q6WA 3BD4A 4Y4HA 3MXVH 5DJZA 4WIQA 1FO0A 4LU5L 2J3SA 5E24E 1Y6NR 2B5IB 1QSFE 1OAYL 2EDYA 4JJ5A 1T03L 4FQ2L 1EGJA 3MJ9L 3BN9C 3ZDZF 3CFJB 3FO0L 1WBXB 4D8PA 2NMSA 1KBGL 3CVIH 3S5LB 2D4FA 1E28A 4M4PA 1U3HC 2R9HC 5HDOA 3ZE1E 5T1DH 4X99B 3O6LH 2AEPL 4XNQA 4CADB 2WIMA 2I9LA 1S9WB 3PWLA 4N68A 4X6EB 3NFNB 1XCTA 4FTVB 1L7IL 3CDFA 2R23B 3OKYA 4HKZA 5E9DA 4HZLB 4JFDA 1I7UA 1A7QL 4WO4C 2EEAA 5TDPA 1U41A 4L3CB 3O2WH 2JIXD 5KS9A 5FB8B 1AGCB 2ZG1A 4PGZA 1RMFL 5BS0D 5MP6L 3SDDC 3RVWC 2Z31B 5JW4R 1QBBA 1Z6JT 1MLCB 2HFGH 4H20L 4JM4H 5EU3A 4UT7L 3QCUH 3P2TA 3QI9B 1INQB 5FECB 3CGTA 1IZJA 2VE6A 1WUNT 4WHYH 3O2VL 2CKBA 3IJHB 1NCCL 4JRYA 5IVXE 5JOFB 3ISWA 2XFXB 1X5XA 4JKWA 1QO3B 3CFKB 1BMGA 1AC0A 1DUYA 2OI9B 2OJEB 4GRWB 5EFIB 3WIHH 1A4KA 2WBJA 4MCYA 2EKSA 3BJ91 5LGHL 5FV2A 1G0YR 3QFDB 3TO4A 4QYOA 4WO4A 4XCYA 4JANB 1BP3B 1T0NA 1MREL 5B3NA 2AS5M 4U6YB 4PV9A 5D7SH 1JYVA 1BBJA 4Z7WA 1H8NA 5IM7B 1KEMH 3OGCA 1LO3L 3N85L 1N5YL 2XQBH 3TCXA 5HHNA 1MFDH 4WI9A 5ID0A 3HUJA 4CVZB 1T2XA 1MFBL 3IF1B 1NEZG 4KKBD 4P4KD 4L5FH 1FN4A 3PWNB 1Z0MA 2HFFB 2IPTL 2R69L 1DQQB 1XGQA 2DQJL 1NCWH 3I6GA 3MFFA 4PD4K 5ENWA 3PNWB 4HXAL 1EHXA 4O4YL 3VA2C 2OBGA 4NN7C 4HJJH 4ODVL 4YAQA 4XP6H 2J12B 3TT1L 3UCRA 4GAGL 4YHNB 1RURH 3TVMD 4DAGH 2OTUA 2WIIA 1AH1A 1JPFA 1UWEL 1IM9D 5JOPD 3TIDA 2IPUK 5A2FA 3OG6B 4OLWH 2EE3A 2MKLC 3V95A 5F9DC 4D0DB 3LSOB 4GW4A 3PWPD 4Z7UB 5DD3L 5TE6L 4MD0A 3LKNB 3SE9L 3DVFA 3OF6D 1P1ZB 2ZZUT 3QDGA 1BM3L 3FRUA 4NHUA 1OT1A 1CICC 2BVUA 1RZKH 4S1SL 4OGZA 3GSXA 3IFLL 1NGQL 3BZ4B 4LLMB 5K33A 2FIKB 1TQBC 2HA1A 1MJUH 3GJFB 4L9LA 3D85B 1LP9F 4FZEH 3ZDYE 2DQCL 4JZJA 4G8EB 4OQTL 5C6TL 2AK1L 5EU7E 4HS3B 4X7FC 4ZFZA 4X4YA 3LKOB 1YEEL 4X4XA 5IBLD 2AW2A 3CLEL 1OAKL 4S10A 2ZNXA 3NZ8B 1FFNA 2WUCH 4OZIE 1AR1D 5IKCB 2XZAH 2YRPA 1KEGH 3RWCA 2AV7A 2NLJB 4K9EL 3SOBH 2A9NL 2AQ1A 4G8FB 1OTTD 3X11A 5C0AA 4X83A 4J3TA 1PDKA 2NY0D 5IK3B 2AI0L 3W39A 4ZTPH 3VRIB 5ACLA 3FN0L 5GRVL 4JB9L 32C2A 5C0RL 4UUJA 3QXDB 4I2XA 4KK9D 5BV7B 3IDXL 3ALWA 2BNRD 3CMOL 1TVHB 4OV6F 5GSRA 2V5MA 5DMIH 2WP3T 1DZBA 5C0FA 4EBQL 3BPCA 2NYYD 5DF0A 3F12B 4HPOH 1A6PA 1YNLH 2DWDB 3NACL 2XKNA 3UPCA 4IBLT 4KRPB 4NQCE 2YC1A 1F45A 4ZOCA 5ACZB 1JRHH 2PTTB 2XG4A 3PF2A 4H8WC 1AQDB 2FGWH 4OTXL 4NO0A 4U6XA 4NOFA 3DVGB 4Y19D 3F8UB 4CMHC 3O8XA 5DRWB 4NQSB 4APQD 1H3PL 4PGDA 1UXSB 2BNQD 3AROA 2BSTB 1RZGA 2G2RA 3EHBD 1MCPL 2AJYL 1HN1A 4JVUA 4YLQT 1UZ8A 1S7QB 1NCBH 4P2OB 3BDYL 4RIRA 3S36X 3VFWB 3SDAB 1Q0YH 2CDFB 4NN5C 5LG1A 1LQSR 5BV7L 3LH2L 1XMWA 5K9KA 2UZIH 1T4KB 5IHUL 4OLXL 1FVCA 3GNMH 4GBXA 4FP8L 3QDMB 5HHPB 4YIQA 3BT2L 3HNSL 2FR4A 1FL6B 1AXTL 2IH3B 3P30H 2X1OA 1Y0LA 3NCEB 2OR7A 2XY2A 3F58H 4V1DB 5GJTH 3FCTA 1G7IB 2ZUTA 3E6FB 3O9WC 2JCCB 2EEBA 3OAYK 2WWKO 3QUKB 3ZE2E 2BOCB 3ULVE 1TZGL 4MMXC 3RTQD 4G80A 4BJLA 3WFZA 4PP2B 4P5MA 4PJ7A 4X6DF 1NEZB 5HGBB 3KYMA 1VCAA 1FV1B 3DTXA 1CVRA 5IW1A 1YPZF 4I3SH 2IAMC 5JUEL 3PQYE 2FEEI 4OF6A 3U0PA 3S34H 1IL1B 2VXSH 3KAAA 3ARBA 3B9KC 4RWHA 4HDIB 2YUWA 5I18H 5LXGL 3LKRB 4JFFE 2EKJA 3VW3H 1JHLH 5GS0C 5DEFB 2I07B 3W82A 1EXUB 3Q6GH 4H1LH 1AGFB 4I5BB 2FX9L 3T1WA 1U42A 1ZVSA 3KPPB 3MYZA 4PG9A 2V7NB 1NMCB 3SKJL 1WBXA 1YYLH 4Y4FB 4MAYB 1NMBH 3CSGA 4L4JA 1U92B 5DQDH 2M26A 3K8MA 3SQOL 2VUYA 2J8HA 3S5LA 1L6ZA 4MB5A 5D2LB 4L8DB 1U3JA 4LSQH 4YHMH 4PJEE 2OI9C 4X99A 1C5CH 4JFYB 3E6HB 4R9HA 4CADA 1S9WA 3O6MH 4QHKI 4X6EA 3NFNA 4FTVA 3M8OL 5IESH 2R23A 4HZLA 1LK2A 1QLRA 4L4VB 1TQCC 5CZVH 4I0PB 4P23C 1T21B 4OBRA 1BIIB 3WNOA 3ARDB 1FDLH 4PIRF 3G04B 4L3CA 3VXQB 5FB8A 3HLAB 4MZ2A 1DN0A 4W4NA 4KTEH 3EFDL 5EN2B 3CIQA 4TUJA 2Z31A 2AQ2A 1MLCA 2YK1L 5K59F 2J88H 1K4DB 1GHFH 4OCSH 1XIWD 1UEYA 1WAAF 5KSVA 3QI9A 4R3SB 5FECA 1HKLH 4XCFH 1GGUA 1KNOB 3IJHA 4FA8A 4RGNC 5JOFA 5KW9L 5FHAH 1QO3A 3CFKA 2R1YA 5D1XD 1P4BH 2ADIA 2KKQA 2WINB 2OJEA 5B4MD 5EFIA 4AM0A 4LQFH 4HWUA 3TJEL 1VPOL 3WJLC 3LHPL 3BZEB 3QFDA 4LCWE 4JANA 2YD3A 4V2CB 2NY2B 4FZ8L 4JQIH 3RVTD 1TMCB 4YUEH 4KXZH 4U6YA 2CLVB 5IB4B 4JFEE 1QSED 3AS2A 1UM5H 5IM7A 1MAMH 2VXUL 5J1AB 2CLRB 3TIEB 3PV6B 3U2SB 4CVZA 4GSDH 5I74B 4XPAL 1W0YT 4QXUL 3PWNA 3WDHA 2HFFA 4MMZC 4XP9H 1DQQA 4ZMAT 3GKZA 4FQ1L 3WD5H 1QG3A 1MJ7L 3ULUD 4NC1C 2IF7A 3WNKA 1CU4H 1WZ1H 3PNWA 1OGAE 3TV3L 1F4WL 2D0GA 5D72H 1PSKH 3STLA 1OAXL 5B38G 5CUSH 3SJVE 2VIRB 4YHNA 1QR4A 3MR9B 2FATL 5ANME 4KMLB 1IMHC 4MXVF 3JTTB 4LCYB 4OFYA 1MCIA 4D0DA 1RZJC 4H0IA 1E4XL 4Z7UA 1MWAL 1EFXB 1H5BB 2IPKB 4X7SL 1P1ZA 3O4LD 3Q3GB 5DK0B 5F70A 1ZLUK 4U1JB 4OZFG 3IB4A 4JFHE 3V7AE 5JLZB 3RNKB 4NZJA 1T20B 3QXWA 3BZ4A 4WU7B 1MY5A 4LLMA 4M43L 3LY6A 2DLFH 5AWNH 2AJ3B 2FIKA 4WVRA 3WFBH 3H9ZA 3QIBB 3GJFA 2FWOB 4NM8L 2AK4B 3ECBB 4LU5H 3D85A 3FHQA 2YPVL 4QKXB 3V4VL 1N6QL 3RKDC 3WLBA 4YHLH 1X6LA 5ELIA 1KXTB 3CXHJ 5IF0B 3RX7A 1HWHB 1OAYH 4HS3A 1T03H 4FQ2H 3I6KB 4K94C 1L9MA 3MJ9H 2JB6B 4JFQB 3BKCL 3FO0H 4YBQC 3T2NL 3NZ8A 3GEWB 5DHXB 5IKCA 2O61B 1KBGH 4G5ZL 4HX1B 2NLJA 4G8FA 5D1QC 4LLDB 5A40E 3FOMB 1MRFL 3H9HB 2MQ3A 4HH8A 5GRXG 5C0CE 3L3IB 5ERWB 3VXOB 2EXYC 5IK3A 1GGYA 4PV8B 2AEPH 3VRIA 2YD6A 1E4WL 1L7IH 1U3HD 2R9HD 3X13B 1U2HA 1WK0A 3QXDA 5IUSA 4Y7MA 2VLRB 3F7YB 3I6LE 2Y6SC 4MWFB 1YY9D 1TVHA 3WFEL 1DE4B 1S3KL 1OP5H 3WNPA 3RWIB 5MP6H 4F7TB 2QR0B 3KYOB 4Z76B 3F12A 1JHKL 1B6DA 4H20H 2J6EA 4PB9H 1KB9J 2C3HA 5AAWA 1D6EB 1CIDA 3SDDD 3RVWD 2OK0L 4DUVA 4NDMB 3T0BA 3O2VH 2OP4L 1JGDB 5ACZA 2PTTA 1NCCH 3Q5OA 4LMQE 3L5WB 1AQDA 3UBXI 1CT8B 3DVGA 5DS8B 1FRGL 4LARL 5C09D 5DRWA 4NQSA 1UXSA 2DQGL 1RIHL 4LHUA 2BSTA 2FNBA 3IU3B 3UPAA 5LGHH 1AI1L 2XA8L 4RFEB 4WHDA 3OJ2C 3U48A 5ISZA 4JDVB 3FL7A 1S7QA 5IEKB 5EWIL 4P2OA 2VR4A 5HJ3A 2KZ1B 3VFWA 1MREH 1TITA 1MF2L 3SDAA 2CDFA 2PYEB 2FO4B 3SE4A 3TN0C 1G9EA 4U6TA 4PJIF 1MCWM 5GGVH 4PJXF 3IFPB 1LO3H 3N85H 1N5YH 1EEYB 1T4KA 3DPBA 5HYJB 4I3RL 5KSBE 1NDGB 3C5SA 4JGMA 2DIJA 3QDMA 1OTUD 4G6AC 5HHPA 3I84A 4K7PY 1FL6A 2R69H 1LE9B 2IH3A 2NZIA 5EU6E 4PR5A 4I1NB 1TVBB 1FFPB 1FNSL 4ODVH 5B39B 2R4SL 2X70B 3OXSB 1I1AC 3TT1H 1YN7B 4PJHB 3E6FA 4MVBC 5LVEA 3S96B 3QUKA 4GAGH 1UC6A 2BOCA 1T83A 2UVFA 3MUGB 4GRWH 5KAQG 3RGHA 4GRWF 5TE7L 1UWEH 4PP2A 2E7BA 4MJIA 5HGBA 1U95A 4KDTA 1FV1A 3VGHA 3BESR 2P5EB 2ERJB 2WANA 1IJ9A 4LVEA 3DUHA 4I0PC 1IL1A 4HDIA 1CDCA 5AUMB 5D6CB 5DD3H 5TE6H 3LKRA 1MLBB 1YY8B 3JXAA 3SE9H 3EOTL 4P57B 3GMMB 1BM3H 5DEFA 2I07A 5D7JC 4EN3C 1EXUA 2F8VA 3SO5A 5B38B 1FZMA 1AGFA 5FM4A 2XNAA 4I5BA 1XCQB 4XPFL 4LFHD 2VQUA 5DZOA 4S1SH 4ZUWB 3IFLH 1NGQH 2NTSP 1KJMA 3KPPA 3NPZB 5CJQL 1R0AL 1HK6A 3HPLB 1CICD 4Y4FA 3TH2T 5D7IE 1U92A 4QOKD 2BSRB 1AIFB 2DYPD 3DI3B 4OFKA 5D2LA 5A2IH 4L8DA 1DJSA 4CVXB 2FEDD 2DQCH 2ZUSA 4OQTH 1DTUA 3FZUD 1JGVL 2AK1H 4JFYA 4JDTL 5DVNA 3E6HA 1OWRM 3K1DA 4FFYL 4OD1H 1IGML 1YEEH 2VZVA 4L4VA 3CLEH 1C7TA 1OAKH 2XZQL 4GRMB 3SGKC 4I0PA 1FL5A 1T21A 1BIIA 2NY2C 4HUUB 3G04A 3OR7B 5FKPB 3OHXB 4WTZG 3RDTC 3UMTA 3KPNB 5EN2A 3PV7A 2N7AA 4YFLF 3FN0H 2XTJB 2SEBB 1K4DA 1E27B 1JMZA 2DB8A 2JJTA 4JB9H 5C0RH 4R3SA 3WHE1 3SN6N 3JWOL 1J7VR 3SCMC 3QQ9D 4LPUA 1KNOA 3IDXH 4KK5C 3RL1B 3LVEA 1KYOK 4DFHA 3FMGL 1BZ9B 2WINA 1T1XB 5IFJB 3P0YL 5CMAB 3MLZL 1H9VA 4EBQH 4G8GA 4PJ9C 5DVMA 3BZEA 1Z9LA 3NACH 2Z8WC 3SGKA 4U1IB 5FCUL 1EEZB 4HGMA 1ADQL 5C07D 1B88A 1DN2A 5EOCJ 3BHBB 4OTXH 2CLVA 2VQTA 1LILA 4YK4B 5IB4A 1Z0NA 1V3MA 5J1AA 2OSLB 1H3PH 3RWEB 5C9JB 1EHLH 3TIEA 3PV6A 4P49A 3B5TA 1MCPH 1MQKL 2AJYH 4JG1L 4KKLC 3VFPB 4U7MA 4LPYA 3WO4B 1UG9A 4KV5E 2CPCA 3BDYH 2LE9A 2F54D 4I3GA 4P48A 4IJ3B 5BV7H 1J5OH 3LH2H 3IDYB 3T77B 4OLXH 3DX7B 3W5NA 5J57B 2V5TA 2VIRA 3MR9A 4FP8H 5IBUB 2HAZA 4MA8L 4PJ8D 3BT2H 3FONA 3HNSH 1AXTH 4JFOB 4Z77B 1Y6KR 1EBAA 4F15C 4OF3A 3JTTA 2ICEB 4LCYA 4AIXA 2RR3A 3BMVA 1EFXA 1H5BA 2IPKA 1IQWL 5IR1B 4LRNL 1MH5B 1LO0L 3U7YL 1TZGH 5DK0A 1DDHB 4I9WD 1FGNL 3KG5A 4U1JA 1J0HA 5JLZA 2ZUUA 5EOCL 3O9WD 3RNKA 1T20A 3BPLC 2NX5E 1DBJL 3B2UD 5GSVB 1BREA 4J4PC 2V7HA 1HEZA 1PAMA 2AJ3A 2VL4A 4J12A 3DYPA 5I76B 3DOSA 2QQQA 1VHPA 2GJ6D 3QIBA 2FWOA 1L6XA 3BXNB 2AK4A 2IAMD 5LXGH 1YNKL 1RJYB 1ZKAA 5MEOB 3IXTA 3B9KD 3VI4F 3IFNL 4YH6A 5IEHB 3P73B 4F80A 3AS1A 2FX9H 1QFWM 5IVXB 4YXKL 4G6JL 3I6KA 5GS0D 3T3PE 2JB6A 4JFQA 4YEEA 2DI8A 3SKJH 3NA9L 4NBZB 2O61A 3SQOH 2VLKE 2B1HL 3FB6B 3RVVD 4LLDA 1T22B 3FOMA 4G9DB 3H9HA 4Q6IC 4XAWL 1RUKL 3KPMB 3L3IA 4DVRL 2MPAL 4EUPG 2JCCF 4PV8A 3TBWB 5IW6B 1K8IB 5B8CB 3M8OH 2E9BA 2IQ9L 2VLRA 3F7YA 4AEFA 1PG7H 4MWFA 2EIBA 3LIZL 35C8L 3H9SD 2HFEA 2XACC 1DE4A 2Y1VA 5J1TC 3IJSB 4P23D 3RWIA 4CU6A 3X3GL 3EFDH 1NLBL 3KYOA 4Z76A 5ADOL 3BJLA 2YK1H 1FVEB 5IROC 2X89D 1D6EA 3CUPA 2A6DB 1T7YA 5L2JB 2YUXA 3WN5B 5L2KE 3QO1A 4NDMA 2CRMA 1JGDA 5FUCC 4OI9A 3RZCD 5E6IB 1W72B 2A6IB 3L5WA 3MRMA 5KW9H 1CT8A 1JYXA 5BOPA 5DS8A 5IJVB 4X4ME 5CZXC 3M17B 3TM6A 4RGND 1N7ML 3JTSB 1VPOH 1JZ6A 2EC8A 3IU3A 1JI2A 3MZTA 3I2CL 3LHPH 1BECA 4RFEA 3HE6D 2WLZA 4L4TE 4JDVA 1AFVL 5IEKA 5F6IC 2LQRA 4FZ8H 5DI8B 3PL6C 2PYEA 2FO4A 3EYOB 4M48L 3IFPA 3K8KA 2VXUH 4ZAKC 1AKJB 5FM5O 4ETQB 2L4OA 1F90L 1OY3B 5GZOC 3BISA 4QXUH 1W0VB 5E4IA 5IROA 2Z8RA 3E3QE 4YHPB 2VTFA 4FQ1H 1LE9A 5HVHB 1MJ7H 2IG2L 1ZSDB 4RMWA 1AD9B 3BH9A 1FH5L 1TVBA 1FFPA 5B39A 3TV3H 1ZS8A 3OXSA 2X70A 3PHOB 1W72L 1YN7A 4PJHA 2R29L 1F4WH 2DIAA 3QUMB 3S96A 5IGXL 2BCKB 4MGXA 1OAXH 2EDBA 5HD8D 3MUGA 3ARQA 4OZIB 2FATH 1J18A 4A2MA 2B7DT 4U1LB 4YQXL 3QDJD 4ESKA 2P5EA 2AEQL 4RZCB 2C4FU 3PL6A 4L8CB 4M62H 1LEIB 1E4XH 5FUOL 1INEL 5D6CA 3V4PL 1MWAH 4LEOB 1MLBA 4U31A 4X7SH 5C3TA 4P57A 3MV8E 3GMMA 3KWWB 5DVOA 5GRWA 5DURB 3MO1B 1D5BB 1XCQA 1U6AL 4ZUWA 2XTJC 3C8DA 4M4RA 4UT9L 3LEXB 2XKUA 4M43H 3HPLA 5GS3A 3D9AL 2BSRA 1AIFA 3U82B 1EA9C 2R8SL 2BX5A 3KYAA 4NM8H 4CVXA 4OQ1A 1E6JL 2NY1B 2YPVH 3V4VH 1N6QH 4IOIB 1HQ4B 2G5BB 3VFRB 1U2CA 1RZ8B 3QUML 4NQCB 1QUNA 5T1KD 1BAFL 2Y06L 3MLTB 1BF8A 1GGBL 3VXUD 2B2XL 1ADQA 3BKCH 4OCNC 3ULSB 3T2NH 4GRMA 2ENSA 3HC3L 3MTRA 3VXSE 1AJ7L 4HUUA 2X44D 4YK4C 4YBQD 5FKPA 1MRFH 3OHXA 1O7SA 1UYWL 4K2UL 1VFAA 3KPNA 2NW3B 3MRDA 1HHGA 3JWNC 5D1QD 1QR1B 5L0QC 1Q9LB 1E4WH 1E27A 5TGBB 1KLGB 2PN5A 2BVPB 2D2OA 5AZEL 5E00B 3R06A 5T1LA 5EULV 3UTTE 1KB5L 4XH2B 4KKNA 5E1AB 3RL1A 4WGWB 2FYYB 3ARRA 1S3KH 3WFEH 4NWTL 3RUGE 5IFJA 1BZ9A 3H6JA 5CMAA 3MSPA 4PBWD 4U0QB 4NZTL 3ABZA 4PBVC 4EUPB 1ITBB 4KI5F 5BQ7A 2JJVA 2DRUA 3MRFB 2OK0H 4U1IA 2X4UA 1FNHA 2KQNA 5FYKE 2OP4H 2Q86B 1S7VB 5KOMC 3BHBA 4ZUUA 4DVBB 1FYHB 1DBBL 1FRGH 4LARH 5DYOB 5HVFB 4LSTL 1DCLA 3D39D 2OSLA 5C9JA 1MFEL 1FGVL 1ODAA 3RWEA 4TRPL 2DQGH 1RIHH 3S88H 4NC2B 3PQYB 4Z8FH 2WWMD 2EXWC 2XA8H 4LVHB 5JW4N 1G7HB 3VFPA 3MRQA 5IJKC 1P5UA 4GQ9L 4XNXL 5DWUH 3DVNB 4U0RC 1FSKC 1QSFA 2VZUA 1GSMA 1BQHG 2H26B 3E8UL 3S36L 3PGCA 4LCIL 1A14L 1IEHA 4NKQB 4I3RH 3T77A 3DX7A 3TN0D 3BDBA 1UH4A 5IFHH 5JQHC 1JWMB 4KK8C 4L8BA 4Y8AA 4XPBL 4JFOA 3WDIA 4PJEB 4POUB 2P7TA 4IMLB 4R2GC 2ICEA 4G6AD 4YX2L 1CCZA 5I8EB 2R2EB 1MCBA 1YC7A 2R4SH 3M07A 2DLHA 5E03A 3RY6C 2D4DA 1MH5A 2QQLL 3S4SG 2GSIA 1DDHA 2X05A 1A6ZA 3B83A 1I1AD 4MVBD 4D3CL 4ZD3H 3WSQL 5IJKA 4OF0A 5GSVA 2ZWLT 5HTSA 4D2NA 1AXIB 1HI6A 1X5AA 4P2RE 2GJZB 3UO1L 4WI2A 5CEZD 3BXNA 3Q5YA 1W2KT 3QP3A 5MEOA 1H0DB 3MC0A 1WWBX 3JWDL 4NRZB 4GAJL 3P73A 4U1MB 4YXLL 4XPFH 1MCFA 5IVXA 5CJXC 3RGVB 4LPVA 2P1YA 5CJQH 5D7JD 1IVLA 4EN3D 4E0RB 4J6RL