1SVCP

Nfkb p50 homodimer bound to dna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
311
structure length
311
Chain Sequence
b'PYLQILEQPKQRGFRFRYVAEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the NF-kappa B p50 homodimer bound to DNA.
pubmed doi rcsb
molecule keywords DNA (5'-D(*AP*GP*AP*TP*GP*GP*GP*GP*AP*AP*TP*CP*CP*CP*CP*TP*A
source organism Homo sapiens
molecule tags Transcription/dna
total genus 60
structure length 311
sequence length 311
ec nomenclature
pdb deposition date 1995-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00554 RHD_DNA_bind Rel homology DNA-binding domain
P PF16179 RHD_dimer Rel homology dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1svcP02
2.60.40.340 Mainly Beta Sandwich Immunoglobulin-like Rel homology domain (RHD), DNA-binding domain 1svcP01
1D6VH 1CL7H 3IXAB 5LQBL 1CK0L 5KSBF 5DQDH 4WV1B 4X6DB 4BFIA 1NJ9A 5IM7A 2VAAA 4NNXA 4M9OA 4UB0H 2VLKB 2VMFA 4U05A 4EOWH 3IJYB 1RZJL 5BVJA 3O3BB 1YEHH 2OMBA 4PJCA 1L9MA 2X42A 1V3LA 3MREB 3RL2A 4CW1B 1FGVH 4P57B 3A67L 2ZSVA 4FQXD 4XVJL 3L6FA 4KVNH 3EDEA 4FXLA 4Q0XL 5CINL 5EPMA 3VDCA 1ZLUH 5JZ7D 1SEQH 1SJHB 3V0VB 3BE1H 4KJYA 1BZ7B 3I6KB 1G7MA 1MWAA 4U1LA 4JHZA 1F6AA 3O2DL 3P73B 3ARFC 4GLRI 2CIKB 4EUPH 1QYGL 3RUGA 1CFBA 2C9AA 4MVBD 4M3JA 4TUOA 4XNQA 1QLFB 4CN6A 2MFNA 1I1FA 2DIJA 4JM2F 4NZJA 5CEYA 4LLYB 4M4RA 5I8OL 2BVPA 2ARJA 1T83A 3HC3H 3I02A 3RL1A 3ARGB 1IEHA 3SDCA 3RU8H 2Y06L 4FTVD 4OZIA 4CVZB 1RK0B 2A9NH 3NFPA 2BMKB 3PV7A 2QQLL 4PYHA 3SDDD 2F53B 3RWIB 3K4ZA 4PG2C 2LV4A 4OI8A 1IM9A 1K85A 5CGYD 5JHLL 3KPRD 2HJLB 4NRXA 1YYML 2B1AH 4HPOL 4P5TD 1CDUA 2JIXA 2V9TA 4Y89A 3WO4C 2EDHA 3V6OA 4WFHE 1GGIL 3TCXA 4MAYA 3SDXF 4ISVA 1J1OH 3T2PA 3KPLB 4NWTL 2FO4B 4ZQKB 4K3EL 3C60D 4TVPL 3TO4A 1YPZB 5I30H 2A1WL 2CK0L 4P9ML 3QDAA 4U1SB 3T0AA 1UYWH 4YAQA 1JF6A 2UWEF 2W9DL 3OKEB 4ESKA 3TBYB 1BAFH 4EKXA 4PTUA 1IGJB 1I3VA 2R56L 1MWAH 1N64H 4KY1H 3QQ9D 4JR9L 5JW5A 1OGTB 3DX6A 2FEDD 4GQPH 4R8WL 1C5BL 4KZEL 1YEJH 1SVCP 2CDEA 2DQEH 2EE3A 4HEPG 4K7PY 1NUDA 4F3FA 2DQIL 2H8PA 5JOPD 5CJOH 3PIQA 5DRNB 1KXVC 3S35L 2XNAB 4APQB 2DIAA 3WNLA 1IFHH 3QUZA 5EZJA 2FWOA 1WISA 2GJZA 3KXFB 3WFHA 4JZJB 3FO1B 4NC2B 3X12B 3TA3A 1AQKH 2BOCA 2ICEA 3FFCE 4KKBC 3V8OA 1S9XA 2PTVA 4Z7VF 1FRGL 5IG7B 3WUWA 1L7TH 1IAKB 2LAAA 1CXKA 1LEGA 4ONGL 5CSBA 3QFDA 1S9WB 4YPJA 1OHQA 1NFIB 1V7NL 3HA0A 2ZUYA 5TQ0H 4ZD3H 1N6QH 1U9KA 2WV3A 3QDMA 5C0FB 1S7VA 4XPBL 4Q74A 4P4KC 4PJ7F 4NNYB 3EDFA 3REVA 3VXUA 4GAGL 1CXFA 5DVLA 4YQXL 4XVUD 1V3JA 3T1FB 4BSVA 2ZUQB 5E2WH 4QTIL 3L3KB 4IHOA 4MXVE 5CJQH 2W0FB 3HNVH 2VZVA 3T4YA 4JFDB 3VGAC 3ZYJA 2AEQL 3IXTB 5GIRA 3QXAA 3LQAC 1ZLUK 1RU9L 3MRKA 2JJVA 4GRWE 5CMAB 1CFVL 3VFGH 1C5CL 1NCBH 1ZHLA 2HVJB 3BXNA 3VGEA 1SVZA 3MJ7B 3ARZA 5K9QG 5T1LB 3DX8B 5D7IF 2PXYB 1JN6B 5FYLE 3DV6B 5H37G 3VXTB 1UJ3C 5I1DA 4NQXB 3QBTB 2H9GA 5GJSH 5AD0A 3ISWA 4I9WE 1MCNA 4YLQT 1MFDH 1BVKA 4WHDA 5D7JA 3BHBB 1DEEB 5L2JB 3BMVA 2IH1A 4U1IB 1A7BA 4P9HL 4ZUUA 3T8XB 5HD8D 3BKMH 4BZ2L 1CFSA 4XPHL 5DJ2A 5CFHA 3VWJB 4WY7H 3OBAA 5F7HA 1U3HA 3BP4B 3QCTL 4LRIC 5KZCD 3RVXC 3FQNB 3DBXA 4HUXA 5EBGA 2XWTA 4MNQB 4LP4A 2R0LL 3EYFB 2XN9D 3D0VB 4Y1AB 3BPLB 1UVQA 1FG2B 2LE9A 3P0GB 1YNLH 1O5DT 3VXQA 3VU2A 3MJGX 1CXIA 1N6VA 1YEDB 4J4PD 5JHDE 5AZ2H 5FM8A 5KW9L 3IFPB 2VQ1B 1SYVA 3C09C 5HHPB 4EVNB 3L9RA 2D7NA 2GCYA 1CGVA 4S1RH 1BD2D 3C9NA 4I0PD 3AS2A 5GGUA 2GI7A 3KPSA 4NBXB 3U0TB 3E8UH 1QFPA 4CVXB 4L4TB 4NFDA 5I1JL 3DMMD 4FQJL 4PJGF 1NC2D 3QIBD 1YMMA 4FQQA 3OTTA 1V3KA 4PJEF 3NGBB 4U1GB 4WO4A 2AGJL 5IJKC 4BFBD 2EH7H 3UC0H 3RRQA 3W2DL 4QHNA 1HKLH 4LEOA 1I7RA 1XMWA 5DUML 3G6JB 3DXAA 3BDYL 2CUMA 3R0MA 3THMH 4ERSH 4OZFB 3D69A 5C0IB 3UTZA 3K7UA 2QTEA 5DVOA 4CUCA 1P84K 2DQGL 3V5HA 1KCRL 2L7UA 2DM4A 4BH8B 3EO1B 2H32B 1MFBL 1W2KT 1EMTH 3FZUD 4YHYC 3HI5H 5DJXA 1J18A 5T1MA 2BSTB 4OFYA 4H25A 2P7TA 1S7RA 3N9GH 3G9AB 1DFBL 1WIPA 3WHXB 1F42A 2W60B 4DKEL 4LRNL 5F72S 4KROC 5KVEL 3DSNA 3P3YA 3AS0A 3G5ZB 4R97C 2F19H 3U46A 3MRLA 2JCCA 3B9AA 2R4SH 2CD0A 1KXQE 4LPXA 4YDVA 5B8CB 5C0NC 4WHTB 1NAMA 5DD1H 4DQOL 1WWWX 1XH3B 1FP5A 2VLKD 1UA6H 4YC2B 1WGOA 4CJ1A 1AE6L 1J8HE 2F8XC 1RZKH 1X5JA 2R23A 2XZQL 3FN3A 3UYRL 3DRTB 2FX7L 1S3KL 3HRZB 4PP1C 3BZEB 4X4ZA 3Q5TA 3IU3B 3PL6C 4MNGE 4O4YL 1A6ZA 3VXOA 1KGCE 5GGTL 5GS0C 1M6OB 3ILPA 3S3JA 5FO7A 5D7LE 1D5XB 2Y9RT 3BVNB 4GLRH 4KK5D 3TIDB 3VXMB 4D0CA 3MV8B 4NN6B 3L5HA 3DGGA 2Z4QB 5FKAB 3BP7A 4MJIE 1GH7A 3ARXA 5C0RL 1JNLH 1INDL 1GHFH 3TBVB 4RAVB 4MSWA 4R0LB 3UTQA 1FDLH 5BO1L 3ALPA 5EUOE 1UWGH 1MRCH 2WBJA 1B6DA 4OCXL 4PGZA 5IVOA 2BNQA 4F7MA 3ARGD 4IMKA 5C0AB 1V7MH 5CEXB 3QHTC 3QRGH 3IU4H 1VKXA 4Y19E 4MGXA 2A6KA 4NM4H 3BQUB 5CJXC 4FMFA 2EKJA 2F53D 4UTBH 2AI0L 2C4XA 4WI8A 1ZXQA 2Q86A 3K4DA 3KHOA 5T1DH 1SYSB 2HFFB 4HK0B 5IESL 2PYEE 1ZGLB 4N8CL 5E99H 4HAGA 4GQ9L 1NC4B 1NAMH 4IMLA 3I75B 1UXWB 3V7AE 1RUML 4NZDA 3T2NH 3VRJB 3V5DB 3QULA 1CBVL 1NDMA 1OSPL 1I8LC 4HIXL 3VMOA 4WGVB 5IB3A 5E08H 1A4JA 2DQJH 4B41A 3U4EA 4IJ3C 2XZCL 3LDBC 3TVMC 2YA2A 3VFPB 3LN5B 4ZUWB 3HHRB 3LV3B 1VGKA 1X9QA 4U6TA 3RVUC 4ZTOL 5CAYB 5TQ2H 1GYAA 4F57H 4WW2F 2DWEB 4XXCA 1C5DA 3VMNA 2CDGA 5D93C 4G80A 3ZKND 3NPSC 3LPWA 3RWJA 5FUOL 1ZT1B 4TTDD 5EG6C 1IQDB 1CXHA 4KAQL 5HGGS 2PTTB 4J3UA 2R2EB 5E8OA 1SQ2N 4FXGA 3KNBA 4APQD 5SWSB 3CFIC 4P3CL 4Y5VC 3OL2A 3KXFD 4BUGA 1S5IL 2K9UA 3NN8B 5DHVA 3P9LB 1JTOA 2EDEA 4I2XB 2X4TB 3FL7A 3LB6D 2VABB 2XWBB 4MQ7B 4CVWA 3GSUB 1JNHA 3WDHA 2YPVL 1HHHB 3O9WC 5D2LB 5D1QB 1QO3A 4O00A 1JNJA 5IVZA 3QCUL 2F74A 3WFCL 5CLWA 4M43H 2DJUA 4QT5A 4UIMA 4LDEB 2HFGH 4GO6B 4P0DA 3F65A 4LAQH 1XF4A 1ZTXL 3QFJE 4PJBB 3BPCB 1VHPA 2EH8L 2COQA 1M7DB 2QSVA 2ICWJ 4M8QA 3NOIA 5FGCE 4J23A 4JFDD 5C70A 4R96A 1TJIL 2IH3B 5CHNA 3WLBB 1X5GA 5J4MA 3EO9H 3RJDA 5KAQG 2JF1A 1QFHA 4NQDA 1LP9E 1T7ZA 1KPUB 4OF8A 1MHEA 2X6MA 5K59E 1KENH 3H42H 4QHMA 1IVLA 5T1LD 1JVKA 3NCYS 5DF0A 1K8DA 5B38G 3OJDA 2PXYD 4E0RA 1KIPB 4X5LA 3RWEB 4LDLB 5M7QA 1QBLH 1RUPL 2YXMA 3O8XA 4OF3A 3WS6C 1QFWL 4EN3C 2BVUA 1RIHH 2WM0A 2ENSA 2AXJA 3L3JA 4QKXB 3QIUB 4I3SH 1T3FB 1TZGL 2XKUA 1QSEE 2HJFB 1W72L 1EPFA 5DEZA 5DHVH 3T0EA 3T0DA 3S98A 3MLRL 3F58H 4MJ5B 4ZFOB 4BK5A 1MEXL 3VWJD 1UADC 2J1KA 2V17H 3NABH 3BPNC 3UTPE 5IB1A 5I1LB 1BBJB 5DD3H 4Z7WF 1UUSA 4XNXL 4GAJL 3MOBH 2YPLA 1FAIL 1AGEB 4MNQD 4HG4J 4CADA 2D31B 4Y1AD 5IF0B 1YEGL 1YEEL 4XXDB 2XA8L 1NL0L 1ZT7B 3NPZB 3PWNB 1U8JB 1A0QL 2R15A 2H2PC 4FFWC 4GSDL 2GYSA 1C12A 4Z7QF 2CJUL 3CC5A 3VD7A 4ZODA 3QI9A 3SKOA 1KULA 3ULUC 4K55A 4P2QE 1W8OA 1KPRA 4S1QL 2VLJE 4LSQL 2UZYB 3G5VB 3PGFL 4DVBB 1JGVL 4PS4L 1JGEB 3HR5A 3H7LA 5LVEA 3MRJB 5ADOL 3WFBL 4C4KO 3IKKA 3WSQH 2HYMA 5FXCH 5BQ7A 4L4TD 3VCLA 4ZUTA 3ULVD 2SEBA 5DQJA 1X4YA 1IEAA 5FYKE 1I9RL 3F5WA 1FNLA 4QRSA 3OKMA 3KVQA 5D7KE 4ZDHA 3EAKA 3V0WH 1U3ZA 3V6BR 5J6GA 5BZWB 1AO7B 4OLWH 3JTSA 1IC5H 2ESVE 5D1ZC 4C4KT 1R3HB 5TFSH 5SV4A 3QA3B 5BS0A 1I1AA 2ZCHH 3SKJH 1DVFB 4WEBL 1GPOL 1AR2A 4PJIE 2IANB 5EC1B 4LCCA 2E5EA 2LVCA 1DE4A 1H3WM 2GSIA 3F7VA 5A2LH 2NXZC 3SGJA 4KFZC 1AXSB 3ARDB 4QTHB 4ZTPH 4C54A 5LWYL 1HHGB 4L3EE 3NCFB 3HFML 5CEZH 1IGTB 3QNYA 4OKDA 2XACC 3TT3L 3GSQA 4MNHB 1HYSC 3VG9C 3AAZB 4XNUH 4DGVL 3U0PA 2V9RA 4PJDE 2F58H 3B9KC 4GW1A 3ZLQC 2D7QA 3WXVH 3FJTA 5I2IA 2I5YH 2HTKD 2VC2H 2G75B 5KJRL 1IGIH 4XMPH 3GMMB 4XP6L 2FH6A 1VFOA 3EO0B 3OR7B 1RZJC 3JBG7 5I8CB 1NBVH 3SDAA 4Z76B 4KHTH 3CH1A 4JFEB 4K3DL 4J7RA 3ARFB 3WKML 3GJFA 5DTFA 5EWIH 1RJLA 2VLRB 2A77L 4NZTL 4NUGL 1U8LB 1XF5A 4RMWA 3NCMA 3Q5YA 4MAUL 5ALBH 4MB4A 5IHBA 4ELMF 4V2CB 4PP2B 4G6JH 1OTSD 1EFXB 4HLZH 1T1ZB 1IGFL 2C7UA 3MCLH 25C8H 4GW5B 2ZUWA 3VXRA 4EDWL 2EYTB 4QHKI 1W0VA 4JREB 3RAJL 2Y7QA 3FN0L 3H3PH 2CR3A 4D8PB 4G5ZH 5E4EC 3VXMD 1CFTB 3MV8D 4R4ND 4WHCA 2H45A 1IEBB 3V4PH 4PPTA 1VEPA 5FHBH 2EKSA 1RIUH 3NACL 4AMKH 1QRNA 1OLLA 1ZANL 3BKYL 5FIEA 3TBTA 1T2JA 5E6IA 1G7HB 4NJAH 5DRXB 4KU1A 5E94B 3LY6A 1U2CA 3O6FA 4Y8DC 1AP2A 3D9AH 2XV6B 1HOCB 1K8IB 4H8WH 4PJCE 4QRUB 1I7TB 5GS1A 2PO6A 2EE6A 4PLNC 3IS1X 4QXTB 5C0AD 3P9MA 3ARVA 4LQ1A 3OB0H 4HEME 4K8RL 2CIIB 1NCCL 4KC3B 4LCIL 2Q8BH 2V2TA 3BQUD 4YFEA 2Z8SA 1CICA 3L5XL 5GZOD 3R4DA 5BV7C 4P46C 2D7TH 3MRFB 1EBPA 1NMAH 1NGZB 4Q9QL 2VH5L 5JTWA 4K23H 1FNSH 4ZFFA 4ODHL 1KFAL 4ODWA 4BQ9A 3T08A 2VAJA 1NC4D 4PTTA 4RMSA 1KB5L 3GJFH 4ZS7L 1K4DB 4O2FB 3RVTD 4YGAB 1CE6B 1JK8B 3P11H 2FGWH 4OZIE 3GSNB 3TT1H 4X6FA 4LGSB 5FUZH 5JR1H 2CGRH 1A9EA 1WT5A 1MVFA 3P0VH 2VLMD 3WYRA 1HIMH 1GVIA 2ADIA 5DD5H 3IDUA 5GRUL 3WIIL 1CGXA 5IEHA 3SE4C 3S88H 3V6OE 1XCTA 1KG0B 2VXQH 3LN9A 2EDRA 2QR0B 2NY3C 5FYKU 1KEGH 2BSSB 3ZL4H 4Z5RB 1FGNL 3OQ3B 2WIIB 5F21B 3G6AB 4XBGA 3S4SA 2FHCA 4K7FA 5SWSD 3L7FB 2GK2A 3ROOA 5HHXL 2EE9A 4PREB 1R5VB 4HKZA 1AHWB 2D9CA 3L3DA 4UV4L 5BCAA 1RZ8B 2UWEB 3VXNA 4NOFA 4KH2A 1UB6B 3MOAL 3QYCA 2AJZB 4YBQC 4M7LL 4P5KA 3UBXI 1UWEL 4TPRL 1HNFA 2BVYA 3VXPA 1ZT4B 4J2XA 2JLLA 5JQHC 4MJ6A 2OYPA 5D1QD 4GG6A 2Y07H 2JB5L 3IDIA 4XP9H 4HMDA 3PWVA 2CLRB 3OAUH 3MNVA 4XPFH 2WAHA 4X5XB 3MRHB 3O11A 3BYTA 4MZ3A 1MAJA 1SJVA 2ATPA 4OV5A 4RWYL 4UUJB 4PV8B 1JPTH 3BW9A 1UJ3B 4IIQB 2HRLA 3MNWA 1UXSB 4IOFD 2HFEA 2FECL 3FQUB 3LN4A 2C3VA 1Q1JH 3O6KH 5HYSG 3R1GH 1QVOA 2CKBL 4N9OB 1UENA 1A7OH 2V5YA 4XT1C 1IAOA 3UTTA 1Q0XH 2WWMC 3M8OH 3VXUE 3WN5A 3VXSB 4CGTA 4LDOB 1FVCA 3QJHA 4X8XA 4JFOB 4GAYA 5MERA 4K3HA 1KN4L 2IADA 1H15A 4X7FC 3NCCB 4P9HC 1BPVA 4R90H 4A2LA 3HAEG 4PJAE 3F7YA 3MRNB 4PRAA 3QIUD 3U7WL 1AJ7H 3RY5A 3BOVA 3OB0K 5FV1L 4FP8L 4YEFA 5EIVA 2D4DA 4DVRL 3RHWK 2DQDL 4UILL 4Q9RH 1JGDA 1PSKH 3MYJB 1PG7X 3H3BC 3WBDA 5HGDA 2DMKA 3G5XA 1RZGA 4EI5C 1OP5K 1MNUH 3CSBA 4JRYA 3MODL 5FKPA 2ZCLH 3B4NA 3ZE0F 3PQYB 4LVHC 4X0KA 3VW3L 3ILQC 2D3VA 5D7IB 1E4WH 5GHWL 5F1IA 4G9FB 3GJFK 4KRNA 4MS8D 2BC4B 5DO2D 3MYZA 4PRPB 1MIEL 3OKOB 1HHKA 4ODXB 1N2RA 2R1XA 3GI9H 1KJMA 3P77B 5ACZB 3RI5F 3RA7L 2Q7NA 3SE8L 4J1UB 4PJFB 2IGFL 4LQFL 2I9LB 3T4AA 2QLVB 2NY1C 3VJ6B 4HUKB 4I18B 3FFDA 2DJSA 4WUUA 3MCKA 3G5YA 5D7SL 4JANB 1NGWA 2D2OA 3IKCA 4JEGB 1YUHA 4OD1H 4HW6A 4AEEA 3F6IA 4Y4FC 1RZ7H 4YHYB 4Z7NE 5ID0B 1EZVX 5I18H 4OLZL 4LHUB 4I77H 5IW1A 4KMTH 4XAKD 3X11B 3QPQC 2EDQA 1AO7D 4R9HA 5I8KL 5AYUL 3M45A 2J8UB 1DVFD 4JVUA 4KKAC 2IAND 5BW7C 1LNUA 4LASH 4UDTB 1MFCH 4R97B 3GMRB 3ARDD 1S7XB 3KPSE 4S0TD 4YPGA 5HGBA 4G9DB 3QEUB 4NZUL 2IFFH 3BRFA 2A6DA 5EU5A 1YMME 4XCYA 1D6VL 1CL7L 4OBSA 3PDOA 3ES6B 1MIMH 3RWCB 2AJ3B 5DQDL 3T0XA 3IJHB 1HQRB 1VGEL 4Z0BH 4Z6AT 5ICYA 4RFNC 2HJKA 2NW3A 1V3MA 5EU6E 1KJ2B 3DXAE 5DA4A 1MCWW 5ILTH 4MXWH 1YEHL 4DOHB 5FCUH 4QCIA 1P53A 2A83A 4NO5A 4AIOA 4ODBD 1R5IB 4YXLH 5DFVC 1FGVL 1KCVH 2VERN 1HYRC 3VG0H 1DANU 4R7DB 1JZ4A 5L88H 1QSFB 1SEQL 3BE1L 4JFED 1PD6A 3ARFD 1J05B 4H1LB 3D39B 2VLRD 3GMLA 5D9SA 1ZEAH 4JFHD 4PGBA 5J1AA 5F3BB 5AUMB 3MLSL 4FFZH 3M1BA 5BJTA 3NCBB 4OLYH 1F4WH 4M48H 5KSAC 1EFXD 1P7QA 4JFYB 4RQQA 3LKQA 3P4OB 3EOAA 4KQ3H 3HC3L 3RBGA 4MXQD 4MA3A 3NFNB 1N6UA 4L3CA 2JCCE 4QWWD 2X4RA 3VFWA 4PV9B 1GGCL 3CJJA 3GSWA 1KT2B 1D7FA 3VFTB 2A9NL 1AXIB 1JRHI 5AEAA 3CDCA 3MJ9A 2XKSA 3BO8A 3MGOA 1S78D 4MMZC 4DTGH 4ODUA 2YSSA 1UCBH 1A7NH 1CIUA 1IARB 3HZKB 5EIIA 2Z0BA 1HHJB 5JXEC 2JJTA 4PGCA 1WTGT 2DDQH 2A9MH 5EZLA 3BP6B 5GGRA 2GFBB 2X1PA 2JK5B 3BD3A 5A2IH 4JDVB 3QO1A 4P2RA 1J1OL 3KLDA 4P2OB 1NBZA 2P8LB 5I30L 1IGYB 4HKBA 1Y0LA 3U9UB 3TZVC 3F7PC 1UYWL 3O3DA 3HZVB 4G8FA 3S34L 3T3PF 1C08A 3T65B 2PUQT 3ALXA 4POYA 3H0TA 5ELIA 1HK6A 2BY1A 2BNQE 3MXVH 4FQ2H 1MWAL 1N64L 4KY1L 4HFWB 3PHOA 5B3NA 1A1OB 1I8IA 1GCFA 1YEJL 1MCCA 3ZTJH 5IKCB 5EU7C 2DQEL 4XWGL 2YC1B 4K9EH 1A6VH 4HBCH 1N8ZB 2AJXH 1OTTD 5GGSA 3PNWA 4ZPVA 1UACL 1BREA 3RJQB 5LXGH 3QQ4B 3DARA 1JWMB 4M7LT 1WBYB 3MUGB 4JKPL 3FO2A 5C0GB 1AQKL 3STLA 2AJVH 3OPZL 5I0DA 3MJ9H 1BOYA 4HWBA 4JAMB 4U6YA 4MD5B 3OX8B 1L7TL 2FEEI 1FORH 4YO0B 4OI9A 1JHTA 3UBXG 4J3OC 4ZD3L 1KLUA 5TQ0L 1PG7H 4Q6YA 4JRWA 4X7TB 1LD9B 4PIRF 2Y36H 3DNKA 2W92A 5FHAH 4G43A 2YK1H 1RMFH 5ERWB 4FTVA 2CR6A 2OJEB 2DBJA 1FHGA 3D85B 5E2WL 1WIUA 4I5BB 2DWDB 4MB5A 2EDFA 3HNVL 4Y88A 4NHCL 1VFAB 2AEPL 4MDIB 2KH2B 1A4KB 3FO0H 3B3IA 3Q1SH 1MH5A 3BWAB 2HT3D 3KPRA 3EW3B 3LH2H 3EOBA 3PXHA 2VRAA 1WBXA 3G08A 5CWSA 4P23B 1NCBL 2MWCA 5CP3A 1K2DB 1DUYB 2VZUA 5D8JH 5F93C 2YHGA 2N7AA 1SY6L 3CXDH 4JFQA 4H0GA 4OI7A 2R4RH 2VWEC 5GJSL 3UXFA 3AREC 1MFDL 5I1IH 5DWUH 5EOQL 2BVTA 2CUIA 1QUNA 3V5KA 1Z6JT 3VXSD 3HMXL 4HWBH 3BPNB 4FFVC 4AM0A 4HGMA 3HCVA 5K9OB 1AD0B 4X6BB 1UC6A 3WEXA 3OKLA 3PUCA 2EICA 5SWQB 1XF1A 5IP4A 4KI5F 4RA3A 3LCYA 1WFNA 2J88L 4F7EB 3HE6C 1PLGL 3PWJB 4AIZA 4RNRB 4KJWC 3RWFA 1YNLL 2OCFD 1YJDH 32C2B 2XQYG 4P3DB 2X9WA 5FGBC 3CVHB 4LRIA 4NZRH 43C9B 4NQDE 1TCRA 5KSUB 3S36L 3QCVH 3C6SB 3OKNA 2EXWC 3MZTA 4NQVA 3CSGA 1KB9J 4TNWK 4LPVA 2Y5TA 4CDHA 1WC7B 4S1RL 5HHOB 3VDBA 4U3XA 1EAPB 3PQYD 1PKQA 1WV7T 2NW2B 4LLMA 4HDIA 4JKMA 3E8UL 1BHGA 4Y5XA 4G9FD 5HDQL 4HLJA 1ZHNA 4PRPD 3RZCB 1CU4H 4N0FA 1YYLH 2BCKA 5CP3H 3KPQA 2EH7L 3UC0L 4YNYA 4N0CC 4N68A 1OLZA 3DHMA 2E7BA 1V8HA 5TE4H 1N26A 3GZKA 4KPHH 1SBBA 2R69H 4L8CA 3QWRA 5CEZE 4ERSL 2Z35B 3UPRA 2ATKA 1UWXH 3TEUA 4BSJA 2YPLE 4NT6A 5C2BL 5KS9A 4CU6A 3LRGA 4NKOB 2DQHH 4NQSB 3HN3A 4LHUD 5CP7A 5ICZA 2B20A 1I4FB 4RGMC 5GGRY 3VRLF 3VG9B 3W82A 2GTZA 2VDML 5MENA 1BLNB 4WWKC 3N9GL 5F89A 4BA8A 1Z9LA 5SV3A 3C8KB 1MCPH 1OP9A 3TWCL 5C08A 3BPOC 4AL8L 4E41A 1BQHA 4WNQA 4XBPA 1YY9D 3UO1L 4QO1A 1P4BH 1A66A 3H9YA 5ISZE 1B3JA 2R4SL 1F11A 1B0RA 3KYAA 2AABH 4DZBB 1IGCH 4R4FH 4EXPX 4YWGH 5DD1L 5C0DA 2BDNH 3KPOB 1KIQB 5D72H 1UA6L 1EZVY 2FJGA 3KYNA 2EIZA 1BM3L 5GGSY 2VLLA 1G9NH 5BS0E 3WNPA 3VGHA 1KTLA 2X7LA 4X5WA 4LSUH 3FB7A 3B2UC 1TZIA 1QSFD 4HZLB 3O3AB 1G1YA 4DEPB 1QRKA 3D39D 4I0PA 4OCMC 1H3VA 4RAUB 4F9PA 5E03A 4L9LA 1GHFL 4NKDB 1VFMA 4XCCH 2BHYA 1JPFA 3EBAA 3QIBA 1UWGL 1EEZB 1MRCL 2AXGA 2VIRA 5CZXC 1T1XA 2FNBA 3IDMB 1JF5A 1F3JB 4UT7L 1V7ML 5EOCJ 1LO4H 1LO0H 1LE9B 5DJAB 3CZFB 1VEMA 4O02H 2FGZA 3I2CH 3QRGL 1EO8L 5FF6A 2YUZA 4F58L 5D1XB 1I7UB 2RHEA 3F7QA 1CFQB 3NIFF 4NM4L 3TYGH 1MREH 4FG6D 2X4QA 3ZE1F 1M71A 3S37H 2VZ1A 5T3ZD 3EYUL 3I3EA 2VL5B 4K8RC 4JO1H 1JMXA 4DGYH 5T1DL 3O2VH 2X1OA 3HPJB 2AJSL 3JUZA 1XGRA 1S7TB 4HWNA 4ELKB 3SY0A 5FV2A 3KPPA 4ELMB 4AT6A 3VXRE 4PY8I 1F3RB 1KYOJ 3X17A 3RY6C 2UVEA 4GRMB 1SHMA 4QGTA 1T4KB 3T2NL 1ZHBB 5HHME 1BFTA 3MTRA 5TDOA 4P2OD 3VFNA 4ZFZA 5IW3A 5E08L 4D9LH 1KF9B 2DQJL 1AIFA 3H9HA 1LO2H 4JJ5A 4HUWB 1QRNE 4XI5D 3RNQB 1T22B 1IM3B 5FK9B 2UZIL 1AGDA 4PGEA 1Y6NR 3IXAA 3RVUD 1QEWB 2OI9B 3MRCB 4WV1A 4HIHA 4HUUB 4UU9B 1UWXK 4XTRD 1NMBH 2VLKA 4F57L 2ENYA 3TVMA 1FZJA 2VISA 3O3BA 1N3NA 5CZKA 5ESAB 3MREA 4CW1A 2MKWA 2F5AH 1E4JA 4P57A 2HN7B 4Z18A 3HNTH 3KWWB 3D25B 3T1WA 2Q87A 4NKMB 5JW3H 1NFDE 5F9OH 3KR3H 3TFKC 4PFEA 3AS1A 5I16A 4YHZH 1KPVA 3P73A 5SX5H 3TYFA 4HF5H 3UAJD 5I75C 3GSRA 3MV7B 1XGQB 2DICA 5F7WC 2Q6WB 4F7TB 5FB8A 2ZZUT 4X4YA 2LQRA 2Q76B 1CXLA 1G0DA 4GKZB 4TSCH 5BRZB 4KMLB 1J11A 1AY1H 4F80A 2X10A 4M43L 3O41B 4HXAL 5EH1A 2QSTA 4Y5YC 4FZ8L 4WVRA 3V6FB 3D85D 1I85C 2Z93A 1KJVB 3FHAA 3O9WA 2QHLA 5C2UB 3GO1H 1K6QH 1VENA 4TRPH 2K7QA 3SO5A 4P2CG 1BJ1H 1PFCA 4W6WB 1P4IH 3C8HA 5JOEA 4WHYH 3QNZB 4E42B 3BH8B 1YEKH 3VGBA 1VFBA 3BEVB 3ZYIA 1WLHA 3CX5J 4M5ZL 3V8CA 1H0DA 2VTFA 5IBTH 4P23D 1U2HA 1KENL 3H42L 2HKFH 4JFXB 3NH7H 5M95B 2B1HL 1N0LA 2FO4A 5MEPB 4Z8FL 1QBLL 4X98A 4UV7H 4KDVA 1RIHL 1Q0YL 5FA3A 4I3SL 3TBYA 4PR5B 3EFFB 2D03L 1VDGA 2OK0L 5J56B 1IGJA 4G8GB 4GG6E 3UDWC 4XHQA 3DUSB 1OGTA 3DECA 2V17L 3BIAX 3NABL 2XY1A 4M5YH 1DLFL 5DD3L 2ZOKB 1KBGH 1T2XA 1R3IH 1WZ1H 4GKOA 1ZMYA 2APXA 2X4NB 1DLHA 4XAWH 4K94L 4MJ2A 2XNAA 1GOHA 4APQA 5E1AB 4WFEE 3DROA 3ULUD 1FVDA 3KXFA 2HVKB 5E2UH 4JZJA 4QLRA 3FO1A 4O51B 3W9DB 3LHPL 2D0FA 4QY8A 5ALCH 1JZ7A 4LEXL 2W0PA 3QUXB 1HWGB 2AV7A 1FL5B 2NY1B 3K3QA 1S9WA 4G3YL 5HHOD 1NFIA 1AGCA 1CVSC 1RZFL 1JJUA 4IRSB 3D1MC 4Y4FB 3RZCD 3L3OB 1G6RB 1D5MA 4WW2C 3H9ZA 1XZ0B 3L3KA 4MQXC 4HMEA 1OF2B 4NGHL 4OLWL 1MF2L 1IC5L 5L7XH 5JDJA 1OPGH 3EZ8A 4MCYB 3IXTA 5HI5C 2ZCHL 1ZLVH 1PZUB 3V95A 1NQBA 1WSST 4JRYE 3BH9A 3TBSB 5JPMB 5CMAA 3CIQA 4PJHF 5SX5K 1CDGA 4ZTPL 4JB9H 3MJ7A 1MPAH 4OM1H 4XHJC 4ZYKA 4I4WB 5T1LA 3DX8A 3IFNH 5LGKA 2XQBH 2PXYA 3S35X 4IDJL 1AGFA 4RFNB 4XNUL 4OF5A 4NQXA 3VE0A 4M1GH 1BOGA 2VQUA 5E1HB 3WXVL 4IDLA 5ANMA 2I5YL 2IBZX 1Z3GH 2VC2L 4PB9H 5C0BB 5HVHB 2YD6A 1WIOA 3BHBA 4LGPB 3BN9C 4RGNB 4HV8A 2FIKA 3T8XA 1Z2KA 3IVKB 3C08L 3PV6A 1KTRL 3B9KA 1G6VK 3BP4A 2XZAH 4KHTL 1ONQB 3KS0J 5F7EH 4OFIA 1MRDH 3HUJF 4MNQA 4AIXA 2UY6A 5T3XD 3RWGB 4Y1AA 1OQOA 5ALBL 4YHIB 5A2JH 3ARBB 5KSAB 2MOVA 3HI6H 1VEOA 3HC0B 4LCWA 1YEDA 4Z78B 1FFNA 4HT1L 4JQIH 4JPKH 3IFPA 4UIKL 25C8L 3LAFA 3E6FA 1A9BA 2R1YB 4ODSL 5HHPA 3JWOH 4RWHA 2WUBL 1TQCC 3GSVB 4NRYA 3TBWA 2PW2B 5I15H 1EHLH 5GS2D 4G5ZL 1D5BA 5IFAH 3P4LA 3IETB 3ZDZE 3V4PL 3VFVB 5IVNA 2BRRH 5I17B 1WJ3A 5FHBL 1XGPB 15C8H 1RIUL 3MV9A 4FRWA 4OTXL 4B50A 2NXYC 1MELA 4P59H 4B7IA 4CVXA 1K3ZA 4L4TA 4LSVL 4X9IA 1X6NA 4C58B 3R8QA 4JO3H 3REWB 2NYYD 2DMCA 3ZE2E 1FIGH 5C0CA 2DYPA 4H8WL 2V2XA 4YZFE 1B0GB 4XCNB 2C1OB 1GGBH 2VXTH 1Y6KR 3S3PA 3F12A 4XBEL 1MCIA 4I0KA 3SOBH 5D1XD 2HLAA 4UAOC 4X6CE 4OZFA 3DI2B 4CNIB 3ZDXE 3LEXB 1F02I 3RKDD 3EYSH 1CGYA 2D7TL 4BH8A 3QQ3B 4OD2B 2EZ0C 1FNSL 5H2BA 1FZMB 1XF2A 2BSTA 2R0ZH 4NQEA 3MFGB 5LQBH 1T5WA 3B9DA 3P11L 4RX4A 1NEZB 2W60A 4K71B 1RZJH 3HPLA 3VWKB 3BMWA 1HSBB 2XKNB 2QADC 1PYWB 5FUZL 1AGBA 5JR1L 3HZMA 3UZVB 5IEKB 4LPWA 3P0VL 3H9SA 4KGLA 2DOCA 5B8CA 3NMEA 4WHTA 2XOTA 2VITB 5HPMB 1U8PA 2Q7YA 1ZLVK 1XH3A 5ETUB 1FG9C 3JWNC 1T83C 1AXTL 1QACA 1G9EA 2XIDA 1TLKA 2VXQL 3SDCC 3FRPG 1D5IL 5F96H 1D9KB 2XPGB 3ULVH 2JE8A 4P2RE 1KEGL 3BZEA 1OVZA 4M61A 3IU3A 1CR9H 3ZL4L 3VFOB 1KLGB 3BD4A 2ADGB 2ED9A 1U3YA 3KYOB 3TIDA 1D5XA 3BVNA 2Y06H 1FE8L 3VXMA 3MV8A 4OZFH 5DDHB 2Z4QA 2BVQB 3HMWL 3MV7D 5FKAA 3UPCA 2QQLH 3DV4B 5F7YC 4NQCB 1P84J 3GGWA 2OX5A 2BRQA 3JVGA 4MAYC 1T20A 1T1WA 3VH8A 5BRZD 3NA9H 4MA1C 2OLDA 2Y07L 4ODVL 1U8NB 4GRLB 1PY9A 5DEFB 3OAUL 1OAQL 5CEXA 4XPFL 4ZS6D 4HGWB 5JW4N 5CILH 5J1SC 1ES0B 2G5BB 4BKLA 5INDA 4AENB 4PJAF 3R8BB 4W81A 3WDJA 4NWTH 4GKNA 1CLZL 2CK0H 4P9MH 1JUFB 2HFFA 4HK0A 2ZOLB 5LJYH 3WV0A 2VZSA 2W9DH 3O6KL 1ZGLA 5IFJB 5EFIA 1IC7L 1NC4A 1UXWA 3LSOA 1A7OL 3U36B 2GSGA 3M8OL 4PG9B 3ZTNH 1C5BH 3QUZC 4F9LA 2IQ9H 1A5FL 4Q2ZB 5DZOA 5F7FA 3DETC 3TA3C 4NO0A 3MOQA 1CDHA 1CQKA 2A74A 4R90L 2FD6H 4OGAD 1HWHB 2FBJH 3HI1B 1AJ7L 1PZ5A 3KPRE 4G8GD 2R9HD 1MVUB 3MA7A 1INQB 4XP1L 4Q9RL 1PSKL 3RTQB 1DP0A 1CGSH 1FRGH 2RQ8A 1B2WL 1IZJA 1MNUL 1ZT1A 4DAGL 1A3RH 3ILQD 2ORBH 3EDJA 4BSWA 2YPKB 1V7NH 1ZS8A 2PTTA 2R2EA 1KUMA 2RFXA 3GKWL 3IAPA 4XPBH 2OZ4L 1E4WL 5F7MC 4GAGH 3FO9B 3NN8A 4EI5A 1ZE3C 4I2XA 1JWSB 5I6XC 2X4TA 4M6MH 3X14B 3QQNA 4MQ7A 3GI9L 4QTIH 3QUXD 5IWLA 3GSUA 2PYFB 2NY1D 2B0SH 7CGTA 1HHHA 3NA4A 5D1QA 5DUBB 2G5RA 5KVDH 5K9KA 3GUTB 1HEZB 4IRSD 1RU9H 5JOPE 2BXZA 1VADB 4Y4FD 3P4MB 1CFNB 5D70H 5F70A 5IFHL 4PJBA 3BPCA 2RAMA 1M7DA 4WI9A 1TNNA 1CF8L 4L8SA 4YHLH 4NSKB 3TPKA 3FHQA 1GL4B 1Z0NA 2XXMB 3F8UB 5D7JC 2XTJC 4JDZA 4G42B 4KKAD 4FMKA 5C0EB 2YN5A 2IH3A 4IS6B 5C09E 5D2NC 4UNVA 4DUWA 4H5SA 4LASL 4ZAKB 1MFCL 1PKQE 1KPUA 5CJ8A 3PHQB 3NIDF 1LK3L 1B0WA 2EYSB 4P9HH 4PRDA 3AU1B 4XPHH 1FZOA 2X09A 5IJVB 3WJLA 5F1NB 1KIPA 3QCTH 1EHNA 5MP6H 3RWEA 2RR3A 4WEUD 2V5SA 4Z0BL 1T1YB 1ZWIB 2R0LH 2GITB 1B4JH 2B8OT 3W0WE 1H3XA 4DUVA 3CSYB 3H7BB 3SCMB 1T3FA 3N1PC 5FCUL 5HI3D 2HJFA 2XWJB 2Z9TA 4NQTA 4RGND 4YXLL 1KCVL 3D18B 4MJ5A 4ZFOA 1RZKC 2NTSP 5L88L 1C16A 1A1NA 1RVFL 4AH2A 1AGEA 1IAII 4M93C 3CFJA 3DYOA 5IF0A 2VXVL 1ZT7A 3ARBD 3PWNA 4Y2DB 5MENE 1J8HB 5KSAD 1L0QA 2LVEA 3OHXB 1F4WL 4M48L 5C08E 5I1JH 4JFPB 4ACPA 4E41E 3E0GA 4X6DF 3BKCH 4KQ3L 3QUML 1DBML 1QP1A 2HP4A 1BZ9B 4DVBA 1JGEA 3W2DH 2GEEA 5GGTA 1OAZH 1QBAA 2IBZY 3ARTA 5DUMH 5J11B 5D7LB 2GQHA 3GIVA 3JWDH 5A3ID 2C26A 3IS0X 4ETYA 4MJIB 2DQGH 1NBQA 4YXHH 1KCRH 4G6KH 1FNEB 1UCBL 3QZWA 5JXED 4NC0B 3TNMB 1MFBH 3RPKA 3S6CA 5FYJE 3DURB 2X9XA 7FABL 4OQ1A 3QO0A 4QRQA 2IC2A 4F15C 2E7MA 4XH2B 4KWUA 3CVIH 1U91A 3ELAT 1G9MH 1DVFA 3RIAF 4Y19B 5EC1A 4Y4KB 5DLML 4DN3L 4U7MA 4DKEH 4LRNH 1PKOA 4MD0A 3R06B 2DLIA 1AXSA 3ARDA 4QTHA 2YA1A 1JZ6A 4HHAB 1FJ1B 3QXVA 2AEIT 3TN0C 1TFHA 1IGTA 2IPKB 2OSLB 5HYQB 3MXVL 4MNHA 2B2XH 1AH1A 4DQOH 1NSNL 3TZVA 3CFCL 4WU7B 5L6YH 1MFNA 3OJVC 4N0UB 3CGTA 3U83A 3VWKD 4K9EL 4WJ5B 3U1SL 1A6VL 4X6EA 4YHMH 2FX7H 1RHHA 4NKIL 3BYYA 2C3WA 4PJXE 5LXGL 4O4YH 4AEIL 4Z76A 5LAXB 1ND0B 1YPZF 4HS3A 2WBJC 2AJVL 1T5XB 2L7JA 1S9YA 1L6XA 1IKFL 1U8LA 3BIKB 2PF6A 4C55A 1I3GL 4IMKC 5E00B 3TLRA 1D9KD 2H41A 3OKKA 3PWLA 1DBKH 1EUUA 3LKOB 3O81A 2EYTA 1J1XL 2N7BA 5D5MF 3GM8A 1ITBB 5GGVL 2Y36L 5JO5B 4Y5YB 2N1KA 4DJMA 4D8PA 4UT9L 3EGSB 1CFTA 1VPOL 2ZSWA 5GJTL 3ZDYE 4RFEB 5EBMB 4GBXC 4J3VA 2AI0H 5KVFL 4NQCD 1G7HA 5KSBA 5DJYA 4UI2A 2JELH 1F2QA 1FYTA 1BFSA 3HTLX 1HOCA 3LH2L 1I7TA 2NY4C 3UTOA 2CXKA 4GRLD 4QXTA 4N8CH 4GQ9H 4Y16C 4ORGB 4PRBB 2E3VA 4HKJB 2HWZH 3QFJB 3FQTA 2J7LA 1CBVH 2PETA 4UBDC 1NKOA 5FGCB 5D8JL 3MRFA 1NGZA 3SKUD 5C7XH 2DQFB 3CXDL 4FZEH 2XZCH 3CZJA 12E8L 4XXCC 2DQCL 3GMNB 3BEWB 5HGHB 4WFFD 4M00A 1LP9B 1MCBA 2OXGA 5CIPB 5C3LD 1WZMA 3G04A 1J7VR 4JM2A 1NANI 3GNMH 5CCKL 4O2FA 1OB1B 1JK8A 1DTUA 5DRZB 4F7CB 1VSCA 1QQDB 5HTSA 4ZO7A 3FQXA 4YK4C 5FYLD 3FB8B 2YBRB 2MTPA 1KCKA 4KAQH 1T2QL 2E6JA 5EA0H 3MUZ1 4KUZH 1CN4A 4Q58C 4LCUB 5CD3B 2GW5A 5TJWK 4PGDB 4P3CH 4I9WD 3MRBB 2MHAB 4NO3B 3N06B 1YJDL 1QSEB 1W72A 4NZRL 2R1WA 4XGZB 4OFVA 2P24A 3RTQD 4K94C 3QCVL 4JFZL 2EDWA 3RPIB 3HE6A 4WTZA 3DO7B 1DUZB 4KDTC 2VUYA 4Z77B 1QBMH 1PJ9A 1EAJA 5A1AA 2YPVH 2BSSA 5FYJU 1QLRB 3SDXA 2BSRA 3L7FA 3QCUH 3WFCH 1HH6A 1KIRB 4PD4K 2NQCA 4PREA 2A6IB 1YYLL 2MQ0A 2UWEA 5FFLA 4P2QB 1ZTXH 1TNMA 2VLJB 2MCPH 4AK1A 4H26B 4YHOL 1ZT4A 5TE4L 1H5BB 5BXFB 3IGAB 2WP3O 3LKNA 2R69L 5J6HB 5JW4Q 4QF1A 1EEYB 3KPNA 3RWHB 1DDHA 2CDFA 1TJIH 4HJGA 3UROR 4AQOA 4PRIB 5GZND 3GSXB 3U6RA 4KK6D 1R5WA 4TOYH 2CLRA 3CXHK 5C1MB 4OZGF 2DQHL 3O8XC 4WW1A 3KXFE 4JVWA 5F8QC 1F4XH 4UUJA 4N1CA 2V2WB 2NNAA 2WP3T 3T0EC 1M05B 2E9JA 3ULVF 1UXSA 4JQXC 2Z92B 4O2CA 5HY9A 5DQ9B 2ESVB 4B53A 1Q72L 5ID1B 3FQUA 1MCPL 3E2HB 1RUPH 2PW1B 3HG1B 4JE4B 4XMKH 5F1SA 4Z7VA 4LLWB 4ZAKD 5HVGB 4G8EB 1TZGH 4P48A 1T0NA 1W72H 5IHLB 3G6JF 5HDLA 5JLZB 4MD4A 3MLRH 1Z5LA 1J0JA 1FFOA 5A43C 3VXSA 4L3EB 3ZKXC 1MEXH 1IGCL 4PJ7A 4ZO6A 4R4FL 1M7IB 4JFOA 4YWGL 3QI9C 1U92A 4N9GB 2RBLA 2BDNL 4OGZA 2BVEA 3PGCB 5TH2A 4LVEA 5D72L 2NX5B 1EA9C 5CLTA 2GAZB 3MRNA 2APWA 4PJDB 3SCMD 2NZ9C 1NL0H 3ZKSD 5CSZB 3MRQA 5MI0B 1C8PA 4LSUL 2R0KL 5I76B 1T03L 2BXYA 1NBYA 3MYJA 4S1QH 4QRRA 4ZNEA 3ECBB 3LS5H 3QDJB 3QEGH 1SJEA 3LD8B 4LNRB 4F8TA 4LVOC 3U30C 5LGJB 4HUVB 1H8NA 5ADOH 2ERJB 3WFBH 3ABZA 2AQ2A 1FO0B 2IMMA 4Y2DD 1O7SA 1T04B 1J8HD 5D7IA 4X4MA 4G9FA 1REIA 4U6HB 4XCCL 2BC4A 4PRPA 1DEDA 5ANME 3OKOA 2L4OA 4OD3H 4YHKH 4D0BB 1V5JA 4LCCC 3P77A 3EHBC 1KGCD 4KI5C 1LO4L 1LO0L 1JRHL 2C1PA 4LPCA 5D7LD 4O02L 3MGAA 1U58A 4UAOB 4LSPL 4I18A 4O2EB 4H8WC 1UZ6E 5ITBL 5EO1A 1MREL 4BK4A 5L8JB 4MJID 4Y4HA 2D0GA 3BIBX 4MNQE 4WI2A 3S37L 4BFIB 2FSEA 4NNXB 2FH8A 4DGYL 3O2VL 4GMSH 5ID0A 5FUCE 5BVJB 5H35A 4LHUA 1F45A 4LCWE 5D6DA 4XWOD 1MQKL 4CAGA 4PJCB 5J13C 3EYVB 2QHRH 4PRHB 1KC5L 3TT3H 2ZPKH 2O61B 2AQ1A 4Y19D 4Y4KD 2EE2A 4KJYB 4P49A 4OCSH 3SDAC 3I6GB 4UDTA 8FABA 3GMRA 1F6AB 5CGTA 4A2MA 5KJRH 1U3JA 3MV9E 1LO2L 4G9DA 4XP6H 5JQ6L 3QEUA 1WITA 2PYED 2ZUVA 4XNQB 4TUOB 5CD5C 4OCYL 1BVOA 5CEYB 5C0CE 4Z0XA 2BVPB 1P4LA 3ES6A 3RWCA 2ARJB 1KB5A 2AJ3A 2DKMA 1MLBA 2MPAH 3Q6FA 4K3DH 4LGRB 1NMBL 2HT4C 4JY6A 4NZTH 4NUGH 4MAUH 4OZIB 4JPVL 5CKGA 3O45A 3GFUA 3V52H 5B3JF 4GXUN 2F5AL 1IGFH 2JB6A 4EDWH 1XGUB 1P69B 4JHAH 2J5LB 2NY0C 3RAJH 5JW3L 5F9OL 1IM9B 4N5ED 2OR9H 3KGRA 3O4OC 1J05A 4NRXB 3O6FC 4JPWH 4H1LA 4NQEE 4HF5L 2FEEL 4HJJL 4LP5A 2JIXB 3I9GH 3PHSA 1CDCA 4GOSA 3C5JA 1ZANH 2P42B 2LTQC 3BKYH 4JFYA 4MA1B 3ARYA 2DTMH 4ISVB 3U4AA 4HS8H 4PJ8A 4TSCL 4GS7B 3CK0L 4IEFB 4TVPE 3TO4B 4R2GC 1AY1L 1CICC 1HINL 4K7PX 4R4BB 3H9SE 3FONB 3VFTA 4XNYH 3GO1L 1K6QL 3E6HA 4KHXL 4TRPL 4PTUB 1P4IL 3L5XH 1QR1B 4GG8A 3MXWL 1S9KC 2YD8A 5DR5L 1R0AH 3DX6B 3HZKA 2VH5H 1HHJA 1YEKL 1U41A 3OJMB 1I85A 3VRIB 1Q9OB 4ODHH 1E4KA 5IBTL 1TETH 3PIQB 4HWUA 3QIWA 2VE6A 1KB5H 1MAMH 1MHPH 3WLWC 3BP6A 4ZS7H 1WT5C 4JDVA 3QFJD 5D2LF 5EZJB 1RIVL 1TITA 3A6BL 1UCTA 3TIEA 1NDGB 2FWOB 2GJZB 3NH7L 5IT2L 3WFHB 3VXME 4P2OA 3TA3B 2ICEB 1IGYA 2FHFA 4X4XA 2WSKA 2O5YH 4PLKD 1TPXC 3U9UA 1S9XB 3LKRB 4LMQI 1TDQA 4WI3A 3HZVA 4LLVB 4UV7L 1JZ2A 3T65A 4OUUA 4YIQA 3EFDH 1NANH 1T89A 2CKBA 1D6EB 4H1LH 3SBWC 1UURA 4XC1L 5DJ8A 3VXUB 5KVMC 2VSDA 5IKCA 4KTEH 3WE6B 4M5YL 2YC1A 1KBGL 4BSVB 1M4KA 3CAFA 4IRJC 3DSFH 1FGNH 4XAWL 3QQ4A 4X7SH 3MC0A 4PJAB 1JWMA 3I6LD 3BISA 1WBYA 1QSED 5E2UL 5HHXH 1DANT 1TZHA 5FOBA 5C0GA 4UV4H 2B4CH 1VESA 3MRKB 3QUYA 5ALCL 1RJZB 4JAMA 1FL6A 4M7LH 1ZSDA 3UYPA 3OX8A 1UWEH 2Y6SC 4ZUSB 3UTPD 1ZHLB 2R2HA 4CJ0A 3BXNB 2X1XR 4YO0A 1FAKT 3JV4B 2Y72A 3UP1A 3MBEA 4Z95L 3RWDA 3BJ91 1GZQA 3NFSH 5FM5O 5TE7H 4X7TA 1LD9A 2JB5H 1WBZB 5I1DB 3HB3D 3MLTB 2H9GB 2OJEA 2VLME 4HK3J 4Z7OF 4P2QD 4MQXD 5AD0B 2VNCA 4I5BA 2VLJD 5JXAH 1JWUA 2JTDA 3DVFA 5E8NB 4MDIA 3WNKA 1OPGL 2I24N 4GUPA 1N4XH 3BWAA 5DJ2B 1A7RL 1HH9A 3WN5C 4G8IA 4WTXA 5FA4A 1U3HB 3ZKMD 2H2SC 3D0LA 4PRID 2C5DC 2NZIA 1UQSB 4HUXB 5DFTA 4BJLA 2CKBH 4XNMA 1A6PA 2XWTB 5L2KA 5I73C 4KMQA 2NR6D 4P23A 1NGYB 3QH3A 5K9QI 5FYKD 4JB9L 4XHJD 4L4JA 1Q9WB 3QXTA 4OM1L 5D7KD 1K2DA 1MHCA 3IFNL 3KJ6H 2UVFA 2XQBL 4EQ3A 5IHUH 5JW4M 1DUYA 1KN4H 4RMQA 5HHNA 1ZOXA 2ESVD 3L9RB 3HG1D 1A3LL 3OAZH 5DJZA 1R24A 5IK3B 3MRIA 1Z3GL 3MLWH 4JZNB 3C9NB 3U7WH 4OM0H 4FP8H 2YMXL 2YWYA 2DQDH 4KRMB 5DUPL 1RV6X 3ARUA 4L3ED 1FL3B 4XX1G 1TQBB 4PJBE 4X6BA 1YMMB 5F7EL 4WO4B 3IF1B 1MRDL 4M93B 2NX5D 5AG9A 4F7EA 2VKXA 4LEOB 3VW3H 2GJJA 4RNRA 5EU6B 2ZUSA 4M7ZB 2X89A 32C2A 5GISH 2P5EA 1CVRA 3CVHA 43C9A 4JPKL 5KSUA 3ESVF 1MIEH 3FQRB 4CKVX 4HIEA 3QDJD 4M1CD 3JWOL 3C6SA 3RA7H 5L0QC 5I15L 4LQFH 1WC7A 2YUXA 4LIQH 4ZXBB 2X05A 5HHOA 5I9QB 3IDNB 4JKKA 5T1MB 2BRRL 1VFUA 2DQUH 2HKHL 3IFOB 15C8L 4H25B 2P7TB 2X4UA 1OGAE 3TH2T 1ZA3B 2X1QA 6CGTA 5EBLB 2NLJA 2J6EA 4JO3L 1ZVSB 1WAAF 1FIGL 4OLZH 4QNPE 1F90L 1LE5B 4DN4L 1ZLSH 4OZHE 2ZP0T 5I8KH 4I3RH 1A6TB 4Q6IC 2Z35A 2FDBP 5DJ0A 1NAMB 4U0QB 3RQ3A 4Z7WA 3EYSL 1HN1A 3CX5K 4MDJB 1BVLA 1K5NA 3FTGA 3GB7B 2X4PB 4TTGA 3FMGL 4EQ2A 3DYPA 3K1KC 3EYOB 5FDWA 4RDQG 4NZUH 5TE6L 5I74C 3C5SA 3C2SA 2R0ZL 2X5PA 4PRHD 1RHFA 4RCAA 1BLNA 4U2YA 3GRWA 3GSOA 1A6ZB 3BJLA 1VGEH 3ARSA 3ILPB 4HX1B 5FO7B 2JJSA 1BQSA 3QEQA 4YHNA 1S7UA 3CVHH 3KLSA 3DGGB 3KJ4C 1JPGA 2WW8A 3VDAA 2O5ZH 4QEGA 4DZBA 3UTQB 5E2JA 4K9EC 2MQCA 4JN1L 1NAKL 4OZ4B 1OAYH 2BNQB 5E4IA 2ED8A 1BIIA 4YDLB 3AY4A 3LS4L 3OG4B 1TVBB 3MLSH 5F96L 3FT3B 1WCBB 3ULVL 1VKXB 1FV1A 2J6EH 1CR9L 4MMXC 3DX9B 3MA9L 4I0CC 3TM6A 2Q86B 1IM9D 4PJ5E 3O3AA 2E9WA 1GGCH 1EK3A 3OAZK 2E9BA 2JJTC 4KXZH 2JIXD 4JJHA 4JG0H 4NKDA 2JKXA 4LARH 2CKNA 4KJQC 4POZC 5EBWB 3QULB 3CD4A 2NY4B 1EEZA 4UQ3B 3NA9L 3TO4D 5JPNB 5IB3B 2C4FU 2X70A 2E7CA 3U9PH 3TJHC 5I1AB 3FOLA 2BHUA 4LSTL 4Y8AA 3U4EB 3ZZ1A 4YBLC 2GT9A 1LE9A 2CH8A 5CILL 3CZFA 3SQOH 5ENWB 3GRWH 3RDTC 5EU7E 5D1XA 1CFQA 1HNGA 2IPUK 1J9CT 5HI4C 1VGKB 1U8HB 3NZHH 1FNGB 1JZ8A 1IE5A 5F6IB 2H6PA 2PCPB 1C5DB 2DAVA 3HPJA 3S34H 3AROA 4G80B 4M6OL 5EN2A 3RWJB 4FHBD 4ELKA 4KK9C 4ELMA 4R26L 1L6ZA 1Y6MR 3PWPA 1MCDA 1T4KA 5E8OB 1MOEA 4FXGB 5DMGD 3C5ZA 3HE7B 4FQXC 4EXKA 5T3XH 4V2BA 3JTTA 3ZTNL 5D5MB 4PLJC 5KG9A 2AK1H 2IQ9L 3DETD 3E3QE 3TA3D 5IMMA 4XWGH 2D7OA 3ARWA 3GBLA 4YX2L 2FD6L 1C7TA 1SY6A 5DJCB 5FECA 1UACH 5KSBE 2FBJL 4JGUA 4MVBC 1FYTE 1QEWA 1QO3B 4JKPH 5GS2H 3MRCA 5IVZB 4UU9A 2F74B 4FQLL 5DI8A 3OPZH 3VXUD 4H0IA 3WFEL 5TPWH 4QT5B 3HMXA 4I13B 4UIMB 1CGSL 1QD0A 4LVNC 1YJDC 1NCUA 1P1ZB 3EOTH 4L4VB 5ESAA 1IBGL 5J7CC 1A3RL 1WK0A 3Q48A 3SJVA 2ORBL 4M8QB 1PGRB 1GAFH 1ZLWH 1ZHKA 2VZTA 5F9JA 2NTFA 1MUJA 1LO5A 3SDDC 5FGRA 3IAGC 4D9RD 4X9FA 5I8EA 5EIQA 1QNZH 4FQ1L 3EJZD 1HCVA 4M6ML 1MHHB 5CGYC 4KK8D 1G7IA 1FNAA 5IOPA 2QKIA 3OF6D 1MHEB 1QSVA 1XF3A 2B0SL 4NHCH 2AEPH 5EU3B 4EI6B 5C9JB 4F7TA 2VWEE 1K8DB 1G0XA 3OJDB 5KSVB 5IW6B 5KVDL 4O58L 2I26N 4E0RB 3E1F1 3O41A 4TYUA 3IDGA 3OGOE 4NIKB 4U0RC 4HJ0D 5D70L 3UTSA 3L3JB 1KJVA 1RULH 4YHLL 1OM3L 3Q0HA 1HZHH 2KQMA 2Q1EA 1WZKA 4BYHA 3STZA 3D5OF 1JF1A 4YFDB 4E42A 1SY6H 1U3HD 4L3AA 1TTFA 1HXMB 5L9DL 3DX7A 1HQ4B 4HSQA 4PJFF 1U8OB 4R3SB 5J12C 3SDXE 4NCC1 5EOQH 5H37H 1C12B 3HMXH 5HYFA 3CC5B 5D2NA 5EORL 2UWEE 1EHAA 1X3DA 1BEYL 4R6UA 5MP6L 1KPRB 3MRPB 4OGXH 1UG9A 5F6HJ 2FJFB 4BQ6A 2J88H 1B4JL 3HR5B 1PLGH 3SPVB 4OB5L 3CUPA 4PR5A 4J6RH 2VDNL 1XIWA 1S5HB 2AV1A 5ISZB 2J8UF 3S36H 5BQ7B 1NCDH 3VA6A 1XAUA 4Y5XC 1G9NC 3WL9A 3MJ6A 1YMMD 3F5WB 4XVUC 2VDKL 4JPIB 5F9WC 2ZOKA 4WO4D 4QRSB 3OKMB 4OZGB 4KKCD 3W81A 2VUOA 2X4NA 4UT6H 3C8DA 5J6GB 4PUBH 4GJTB 5E1AA 3NIGF 5EU6D 4TQEL 2I9TA 5HDQH 2HVKA 1I1AB 5BS0B 4Z7VE 1E28B 4O51A 3BKCL 3K8LA 5DMJB 4FOMA 1DE4B 3F7VB 4MYWB 1J12A 4D3CH 4Q7DA 1OAZL 3WHE1 4IOSD 3VXSE 3BN3B 4ZXBD 3BUYB 4PJ7E 1JV5A 3JWDL 1JZ5A 3QNYB 1RPQA 2UYLA 4IRSA 5C2BH 2YUVA 2AJUL 4YXHL 5EUKA 4G6KL 3FAWA 1G6RA 2PTUA 3QDGB 1P9MA 3K8KA 4GW1B 1EGJL 1GZPB 4YUEL 5DC4B 2DM3A 3IJSB 3LVEA 4LSSL 2MQ3A 1YC7A 1OF2A 3B8YA 3KLHD 3BP5A 5GRZA 4NUJB 2KUTA 4QRRE 4ZNEE 2VDMH 3CVIL 1ZLWK 4MCYA 4WENB 4I48A 1G9ML 3TWCH 4PJXF 3TBSA 4GXVL 1MFAH 4AL8H 5DTFB 1X7QA 3S9DB 1RJLB 4F33B 3UO1H 1BJ8A 4ZO8A 4XMLH 2R2BB 1XF5B 2IPTH 4M8VA 4KV5F 5D7IE 1PW3A 5HYJA 4X4ME 1X5AA 4G9FE 3ALWA 4ZFOL 1UEYA 3IDJB 3AB0C 3QUKA 4PRPE 3GMPB 1NGXA 2DS4A 2C7UB 3T0BA 3V79C 5TF1L 4XNZC 3VXRB 2B2XL 4J4PC 1W0VB 2B5IB 1A1MB 1MI5A 2QQQA 5L6YL 2Y7QB 5HHMB 2DI9A 4D9QE 1YEFL 3TN0A 3MNZB 4YDKH 5C0BA 1BM3H 1BWWA 5EC2A 3DRQA 4YHML 4I0PC 3QAZB 3RGVA 3VI4F 4CBPA 1QRNB 1RUAH 2YOCA 3IVKA 5J0BA 4F9PC 5INCB 5DS8B 4L9LC 5E6IB 4F7PB 4OLVH 3DMMC 2PR4H 1ONQA 5CZVH 2BNQD 3QIBC 4X9HA 5GS1B 3MSPA 2CLZB 2PO6B 4NN7C 4ONHB 3X13A 3ROLB 2Z8VC 2OL3B 3ARBA 4MCZB 1KSRA 3HC0A 4PJ9B 3PGDB 2V2TB 1G6RH 1DBKL 4U1NB 1X6LA 2ZKHL 3HR6A 3RIFF 4UDUA 2R1YA 2PW2A 1NFDB 4UT7H 2OQJB 1UB5A 4OCWH 2D4FA 2AP2A 2KL6A 3KYKH 3IETA 1EO8H 2DJ4A 3VFVA 4F58H 1T21A 4PTTB 4PJGE 2P5WA 1FVEA 5GRVL 4PJEE 4JFFB 1OD9A 3EYUH 2JELL 2FYYA 1BQUA 3MGTA 2NY4D 1I3RA 1RURL 4X6FB 2AJSH 2YUWA 3A0OA 4RISH 1MCWM 1JYXA 4XCNA 2CXGA 4OCRH 4GBXA 5IVXF 5CBEA 1DQJA 2HWZL 4C56B 1RFDL 1WCQA 2BHZA 4Q97A 1EBAA 2ITCB 5MEOA 2DMBA 1OT2A 3MRDA 5GRJL 1U6AL 2WLZA 4WV1C 5IEHB 3QQ3A 5C7XL 1Y18A 4FZEL 4Y16A 4EEEA 1CZ8H 2YD7A 1LVEA 2UZIH 4U6XA 3CFKB 1BJ1J 3C6LB 4XBGB 3S97C 3S4SB 3GNML 3JV5A 3HE7D 1FSKB 4RRPG 5A16B 1QA9B 4HKZB 2VZ3A 2BY0A 3VWKA 1HSBA 2EDYA 4KK5C 3VXNB 2ZNXA 1PYWA 4P5KB 3DUUA 4YEEA 4HWZB 2UY7A 5EA0L 5IEKA 1G84A 4KUZL 2Z31B 4GKSB 5FCSH 5B38A 5E6ZA 1NCWL 2VITA 4GG6B 3AC0A 1A3QA 3IDIB 2BY2A 3PWVB 2V7NB 5C6PB 3ARGC 1AR1D 3O11B 4L4VD 3CFBA 1D9KA 2LFGA 4MQTB 2XPGA 5E6YA 3U7AA 1QBML 3D3VA 5FAAA 4OV5B 3S5LG 4H20H 1T7WA 1KLGA 2X44D 4X99A 3O6MH 4F8QA 3QWOB 4HXAH 4KDTA 3MRGA 4LHJB 3W9EA 3LN4B 4GXUM 2C3VB 2C3GA 4FZ8H 2O93L 2P4AB 5IMKA 1QVOB 4NFCA 5DDHA 1PBYA 4A6YL 3WDIA 3MRRA 2MCPL 4RDQF 4YFLF 1IAOB 3DV4A 3ULUF 1VERA 4NQCA 3WN5B 1R3JB 2FRGP 1FVCB 4ZSOB 5E70A 4ZPTB 3FT4A 5MERB 1NEZG 1E4XI 2IADB 5IMOB 4M5ZH 1QFWM 1H15B 1ORSA 1U8NA 4GRLA 5I73B 5EZOH 3ZO0A 4TOYL 4QHUB 5E2VH 2P1YA 1G7LA 3WCYA 4FN0A 3F7YB 2GJ6A 3DTXB 1A6UH 1JHLL 2IBBA 1F4XL 1OD7A 5HYEA 1ETZA 4AENA 1HHIB 3GSNL 2B1HH 1ZA6B 2HTLC 3CU1A 1BFOB 4HC1A 1JGDB 1XR9B 1F8TH 1SM3H 4Z8FH 3CLFH 2XI9A 2QEJA 2F15A 5CEZD 5HGDB 2ZOLA 4AYFA 4XMKL 4JRYB 3ZKNC 1Q0YH 2A38A 5FKPB 2J8HA 2D03H 2OK0H 1R3LB 1DBAH 4KZDH 4RMTA 4JQXA 4P2YA 3D87B 1DQTA 5ICXA 4MHHI 4APQC 4PG9A 4Q2ZA 4JZJC 1DLFH 1HHKB 5IB5B 2R1XB 2BX5A 5AG8A 3LB6C 1KJMB 4Z7UF 3EYQC 1NPUA 4K94H 3T4AB 4LIQE 3HI1A 3MRMA 4R7NA 3FFDB 5HSFA 1MVUA 4LF3A 3MCKB 5ISZD 1K3IA 3RI5K 3LHPH 3RTQA 4LAJH 5L2KE 3IKCB 4PY7A 1YUHB 3LS5L 3QEGL 5L0QB 4LEXH 2G9HB 1FC1A 2BZDA 2I27N 1IAIL 1JI2A 1DBBH 1GOGA 2CO6B 1I9IH 2I07B 4HH9A 2ZUQC 4G3YH 2O5XL 1BQLH 5EO0A 5IW1B 3AVEA 3IDXL 3JWOC 5HDBF 4UOW1 1RZFH 1U8KB 1OWRM 5BS0D 1CYGA 1I1AD 1JWSA 1FLRL 1LNUB 4O9HL 4OD3L 4YHKL 2YRLA 4FQCH 3KG5A 1IAMA 1FCGA 1F58H 3MZGB 2PYFA 1EO5A 5HGBB 3W11D 4HC1H 4NGHH 5IBLC 1MF2H 3D6GA 4OCNC 5GSRA 4XPTL 2A6DB 4PB0H 1BJMA 2EIDA 4XCYB 2IAMA 5H94A 4HXBH 2PXYC 5F7DB 4CU8A 1OARL 3LKPA 5JUEH 2VDOL 4U7KA 3S96A 5K9JH 3QDGD 5ICYB 4F37F 4GMSL 3KDMB 1I7ZA 2M2DA 4L8DB 2P5EE 4QCIB 2A83B 4NO5B 4HUMB 2QHRL 1J8KA 1U8IA 5FYLH 4IDJH 2ZPKL 5DT1L 4JN2B 3TP4A 4OAWB 2NY2C 4X6CB 2EC9T 3VWJC 4OCSL 5HHOE 1LEIA 3K2MC 4ZAKA 1RUQL 1UKSA 3GMLB 3T0WA 5ABDE 3KJ4B 4PGBB 1YDPA 3GIZH 3BPLC 2EYSA 5CD5D 3I3DA 5J1TC 1OP3H 3C08H 5FUCC 1P7QB 1XT5A 5F1NA 4J12A 3VXRD 2MPAL 5DRWA 5JORA 4MA3B 1T1YA 2ICCA 4L3CB 1ZWIA 3KHQA 2GITA 2X4RB 5HHMD 5DYOB 5C07E 5GS3A 4F2MB 4PY8J 4HS6B 3U82B 3GSWB 5D71L 1YNTA 5E8EB 3T3MF 1AKJA 3V52L 4H0HB 4HT1H 4HULB 2P48B 3D18A 4HH8A 1QRND 4UIKH 4Z7WE 4ODSH 5E6ID 3LKSA 4JHAL 4KJPC 4ODUB 4P4RA 2WUBH 1VACB 5CGMA 2OR9L 3O6FD 5EIIB 2FJHB 3ULVC 4TUKL 2PNDA 3IDYC 4JPWL 3SKNB 4PGCB 2PO6D 5I66B 1SMAA 3NGBC 4Z7QE 3SN6N 2UV3A 3Q2CA 1JYWA 3CCHA 3I9GL 2AW2A 1J8HA 4OTXH 4U6VH 5EZLB 5GGRB 4PJ9D 4LSVH 4KVCH 3GK8L 3QNXA 3MPCA 4P2RB 2DTML 3L3IA 4HS8L 5GGQL 5MHSE 1X5HA 3QEQE 1QLEL 4U49A 3UJTH 4NCC2 3WO4B 1LO3H 1B4RA 2ARJQ 5C71A 3BZ4A 4Q9BA 4XBEH 3H0TB 4XNYL 2QSCH 4RGOH 5F9DC 2GK0A 2DLTA 4A6YB 2M8XA 1EO7A 4FQHA 4JFFD 5FO8A 2V5RA 1FNEA 1R0AL 3HNSH 5IROA 3RUGE 2OTUB 4FNLH 2E7LA 3M17B 2HTKC 3WIFB 5GGSB 3WLWD 3PNWB 4L29B 1TETL 4ZPVB 5HJ3A 4XH2A 1G7QB 1MAML 1MHPL 2GTWA 3OKDA 4C56D 1A6WH 2YRZA 4N8VG 4RAHA 4X83A 5KOVC 1KJ2L 4DK3A 3FO2B 5B8CC 2YD3A 4EIZC 2YN3A 3CDGB 1KIUA 2Z8RA 3R06A 2O5YL 2HLFC 4PBWD 4RIRA 5EOCH 4RFOL 2IPKA 3EFDL 2BVOA 1KLUB 1OW0C 4OF0A 3C6LD 1FZKA 2DI8A 2DLFL 5J9PA 4MWFA 3N1GC 1AXTH 4ZG1A 1E6JL 5TDNA 3UCRA 4FFYH 4KTEL 3SGEI 5HYSA 4N0UA 5ESVA 5FO9A 5JNYB 1N5YL 2XG5A 1D5IH 4ENED 1BGXH 3FOMA 4R4NC 3DSFL 3N1MC 1OTUD 4OF6A 3FB5A 2Z31D 3SBWA 4P4KB 4X7SL 5BZDA 1XGTB 1R3KB 1MH5B 4R0LC 3RVVD 1ZK9A 3JVGC 1FE8H 2B4CL 1N0XH 1T5XA 4ELME 4IRJA 5KN5A 3PWPE 3QG6B 3G08B 3HAEA 3HMWH 5E00A 4FABH 5EB9A 3VGAB 4YR6B 5E9DA 5T3ZL 3FRUB 3OAYH 2VR4A 3NFSL 3NZ8A 1OP3K 3QHFL 4M6NH 5TE7L 3SO3C 3VFRA 1A64A 1HKFA 3TPUB 4ODVH 4WFED 2OZ4A 5GZOC 1FPTL 2J12B 4JFQB 3PP3H 1OAQH 3DIFB 3EGSA 2DL2A 4KDWA 5CJBA 4GH7B 2R39A 5JXAL 2X4SB 5GRXG 4RFEA 3VGFA 4S1DC 3V5KB 4B5EA 1CLZH 1I8MB 3V7AG 1E4XH 1N4XL 3RVTC 2FIRT 4F9LC 1OOAA 4G7VH 3WEXB 2UZXB 3SJVE 4XPAL 3MLVL 1IC7H 5IIEA 4LLQB 5JIPA 1LEKA 3QDME 2OTPA 3DI3B 4XCFH 3QXDA 4HKJA 4KKLD 3OR6B 1IC4L 2A0LC 3KJ6L 1JYNA 1A5FH 3NAAH 4MB3A 4YHPB 5IHUL 5AYQA 4MHHG 2W38A 1F3DH 3MFFB 3OKNB 5IMLB 2WQRA 3RFZC 3BEWA 4NQVB 4JRYD 1FIEA 5C09B 2Y5TB 3B6SA 2Z91A 5HGHA 3VI3F 4NOBA 3MLWL 5SWZA 1CD8A 1T0MA 5CIPA 4OM0L 1PKQB 1B90A 4LLMB 1OB1A 3C09B 4XP1H 3CPLB 1QQDA 3HAEH 3UTSE 3K46A 5IQ7L 2GUOA 1B2WH 2BCKB 3PWUB 3FB8A 3INUH 2YBRA 4DAGH 4OQTL 2YD9A 1FBIL 2FLRT 4OLXL 5IWLC 4M1DH 2FCBA 3GKWH 2ZUTA 3EJYD 3W0WB 3BDXA 2CK2A 2OZ4H 4NO3A 5LCVL 4L8CB 4NBYB 5GISL 5B39G 2F54B 4KI1A 5D1QC 1RUKL 2ATKB 3HC4L 3VFSB 2OP4L 1SEBA 1KOAA 2XTJE 1CE1H 4JVPA 4Z77A 2G60L 4QRPB 4LIQL 1MRFH 5D2NE 4YDJB 1QLRA 2DQUL 4L8SC 3K8MA 3IRZA 2GTZB 1KIRA 5MENB 1K4CB 5C08B 2KZWA 4IOFC 3JWDC 3PF2A 1MY5A 1U95B 1BQHB 2R29H 4E41B 5IFHH 1N5AB 4NNPL 4WNQB 2EDKA 2VLJA 1CF8H 3QUMA 5E5MB 1ZLSL 1JGLH 4H26A 4J8RA 1F11B 4I3RL 1B0RB 6FABH 4XCEA 5JMRA 4LLAA 1OY3B 1FFPA 4PRIA 3WJLC 4KROB 5C0DB 3GSXA 5C6TH 2DQTH 1UM4H 5CIPH 2W0LA 3MMEB 4P3WA 2H26A 2A6JB 1G9MC 3V6ZB 1BFVH 1LK3H 3KYNB 3OXRA 2EIZB 3AXLA 2VLLB 1DN0A 4Q6IA 1J5OH 3QIUC 3U0WH 3MJ8B 1KTLB 4U1HA 4X5WB 3OAYK 1M05A 4W4NA 2W91A 2Z92A 3FB7B 2ESVA 2GY5A 3FCTA 4OIIL 2XICA 2PW1A 1LWRA 3HG1A 3OGCB 1UM5H 2W9EH 1VCAA 4G8EA 3ULUL 3NCEB 3CVHL 2MMXA 3PL6B 2YD5A 5JLZA 5DEGA 1CGTA 1KCSH 3H8NA 5TF0A 1Z9SA 2O5ZL 4PBXA 1P7QD 3A6OA 3L95A 2VXSH 1JPFB 2AKRB 4LLUB 2W0KA 3CU7A 2ED7A 3GBMH 4MS8C 2ZWLT 5DO2C 2AXGB 4NN7B 1RVFH 1OAYL 3PGCA 4NP4H 3QRFM 5DVKA 1MCKA 2NX5A 2EDJA 3EIFA 2VXVH 4YDIH 3BZFA 5CSZA 4OCLC 3P4NB 4PD4J 1DBJH 2J6EL 2A73B 1M71B 4U1KB 4BFEA 3QDJA 4PJXB 5F8RC 3PJSB 3QUMH 4ZFGH 1DBMH 4LNRA 1EJOL 5HYJE 5KAQF 5CKAA 3ZE0E 1A6AB 4PJHA 1QPXA 4YH6A 1XGRB 1E6OH 3SY0B 3KPPB 3BESR 4AT6B 1FO0A 5F9AC 1TJHH 3L3HA 1T04A 8CGTA 5GSVB 4JG0L 4YXKH 1MI5E 4LARL 4P2RD 5FYKH 5EU4A 1DVFC 5C0BE 4E5XB 3VFNB 4LU5L 4UINH 3CXHJ 1J86A 3U9PL 7FABH 2QL1A 4RGNE 1AIFB 3H9HB 4JJ5B 3ARDC 1ORQA 4M62H 3SQOL 1LK2B 3O3EA 3UBXA 2VZOA 3GRWL 4O2EA 4ZUVA 4HK3N 1UJTA 1QTYT 4P5MB 5DLMH 2DLHA 4DN3H 4HIHB 2ID5A 2J4WH 3MACL 3NZHL 4LBEA 1IKNA 4IJ3B 5C8JA 3LDBB 3TVMB 1FZJB 3HUJA 2VISB 4KK9D 1N3NB 3RDTA 1HDMA 3EJJX 4K2UH 5IQ9A 2G2RA 3EYVA 4KQ4H 4PRHA 2BNRA 3WJJA 3WUZA 4EUPG 2P49B 1JYVA 4LPTA 1NSNH 1TJGL 2O61A 4PLJD 1ED3B 3CFCH 5T3XL 4JG1H 2AK1L 5D93B 3NPSB 5I16B 3I6GA 3SGKC 1A22B 3HZYA 4OFDA 5B22A 5K93A 5TGBA 5ADPL 1KPVB 2AK4B 3TYFB 3U1SH 2P5WE 3NTCL 3GSRB 4NKIH 3Q3GB 3QHZL 4D2NA 4Y5VB 4FQXA 3MLUL 3PABA 4AEIH 4HWEL 4MLSA 4MXVF 4X4YB 5FB8B 3TNNB 4KKBD 1I8KB 2ICWB 2ITDA 1MCOH 4J3WA 4X7CC 3SGEH 4JREC 5TPWL 4CDGC 4MXQC 1IKFH 1FO0H 1QSZA 5DMKB 1I3GH 4URTB 4QWWC 3EOTL 5IV2A 2NY7H 4GRWF 3JV6A 2Z93B 4N1HB 3O9WB 3E3QC 5IVXB 1T7YA 2ADJB 1UZ8B 1GAFL 3BSZH 3BGFC 4P4KD 1SMOA 1XGUA 5I19H 1J1XH 2BFVH 3BGMA 1P5UA 4DUXA 5GGVH 1S78C 5DC9B 1VFBB 1QNZL 4XRCB 4UT9H 3CH8A 3S37X 1CDBA 1OCWL 1DQLH 1H0DB 1HILB 4BH7A 2ZCKH 1URLA 1VPOH 1AQDA 1E27A 4UMGA 3SKMA 5BV7L 1M1SA 5ESQA 5GJTH 3SDDA 1HSAA 4M3KB 5KVFH 4HKXB 2EDNA 1QR4A 4R4BA 3RVWC 1I1YA 1MCRA 1RJYA 4X98B 4YGVA 4P5TA 3FONA 1MCJA 5FA3B 1RULL 1HZHL 1T66C 1QR1A 4JM2C 2RCSL 3C60A 1IJ9A 2CLVB 3GMOA 3P0YL 4JDTH 1F5WA 2FX9H 4NQUA 1DQQB 4JGJA 3CX2A 3ZT7A 4LCYB 4EN3B 1EXUB 12E8H 3VRIA 2ZUUA 1Q9OA 2DQCH 3D3VE 2VDRH 2D0HA 1OWWA 1G7JA 3Q5OA 4DGIL 1MLCA 1EVUA 2MNUA 1TENA 1OTTC 1DLHB 2F8OA 5CCKH 4D94A 1DL7H 3B8SA 1NDGA 3DROB 1FVDB 3O6LL 3IT8D 3UJIL 1M7XA 1ZV5A 3RVXD 3T3PE 1Q94B 5DHYA 4RMUA 4OGXL 4QY8B 2IMNA 3LKRA 4N0YL 4ODTH 1X5YA 4LLVA 2IWGA 4RZCB 4V1DB 1T2QH 2AV7B 5C09D 1MQ8A 4G6AC 2ZG2A 4NQCE 1W0WA 3L7EA 4J6RL 1CLYH 1D6EA 4WI6A 3TO2B 1MJ8H 5IR1A 1AGCB 2YD2A 1JFQH 1F4AA 4JLRB 4TULH 1NCDL 4JFZH 2BOBB 4S10A 3WIHL 1MSPA 5JOFA 3WE6A 2GJ6E 2V5TA 1D5MB 1AHWC 2E9IA 5T5FL 4DCQA 4UT6L 1J0KA 5L8KB 1J0IA 4PUBL 4HIIB 5DK2A 3W0WD 4PJAA 3K81A 3QWRD 5F1KC 2DM7A 4LOUC 3C2AH 4JY4B 4X9GA 2F54D 3N1QC 3RNKB 5E5UB 4WU5B 3BH9B 2HT3C 4OFPA 2GKIA 4WFFE 1RJZA 4NRZA 1TTUA 2H3NA 3T0EE 4D3CL 4ZUSA 4OLUL 3OF6A 1XCQB 1CDYA 3S8WA 4G6FB 4OF7A 3JV4A 4QRPD 4YHOH 2FX8L 5D1ZB 1AD9A 4ZYKB 2X40A 2EYRA 4KUCD 1S9VB 4LSRL 5MEND 5GRYA 1F2XK 2NXZB 1AGFB 1WBZA 4IIQC 5DSCA 5C08D 3VE0B 2P44B 3MLTA 4QXGH 1BOGB 4WCYL 4E41D 4Z7UB 3WUWG 4X80H 5ANMB 5GGVY 2K1MA 4ORZC 1KXTB 3AM8A 5E8PA 5E8NA 1P7HL 4HV8B 1ZVHA 2FIKB 1GOFA 4ONFH 2NY2B 3PV6B 1Q72H 3B9KB 4NM8L 5D6CB 1CD1B 1UM6H 4KROD 1MFAL 5EZIH 1UQSA 1YY8B 1EEQA 3MROA 2P8PB 1NGYA 4XMLL 2IPTL 2VDLH 1Q9WA 3OSKA 3UZEA 4C83A 5FYJD 4LCWB 3FT2A 5C0ND 1FFNB 4QOKB 1JL8A 3E6FB 3HS0B 1A9BB 3B43A 4NRYB 3L1OL 3TBWB 3V7MA 5EUOF 2XN9A 5IK3A 1D5BB 4YDKL 4JZNA 4JO2L 4PP1D 1ZGLP 3PL6D 3FQWA 3MV9B 5BOZG 4J4PA 5DC0A 2R0KH 2DIBA 1CT8B 3MR9B 1RUAL 4JZOA 4NC1E 1FL3A 4LPUA 1T03H 5GS0D 5DK0A 4KI5E 4L8BB 1L7IH 1S8DA 4OLVL 3IDYB 1Q9LB 2PR4L 3QP3A 5E4EB 5E2TH 5CZVL 3IF1A 3O2WL 5C0CB 2DYPB 1BF8A 2V2XB 2EO1A 5BMFL 3CNKA 1BD2A 3K0WA 3JSSA 1B88A 3GHEL 4XB7A 5EU6A 5EDXA 3F12B 1NCAL 4TNVF 2HLAB 3DMMA 1G6RL 4I18C 1NC2A 2HT2C 3FQRA 3GJEB 2AEWA 4EZMA 4Y4HC 5I1HL 1S7WB 2DRUA 1BZQK 1H3GA 1JRHH 1QZ1A 4OCWL 4ZXBA 1BP3B 2E6PA 5H2BB 3IDNA 3KYKL 5JA9A 4LSPH 2LU7A 4BUHA 1YQVH 1XF2B 4J3SA 5D6DC 2V9QA 1HI6A 3IFOA 4NQEB 3LZFL 5ITBH 1PQZA 1T5WB 2FL5A 1GIGL 5BV7B 2I60L 2Q3ZA 1P5VA 1ZA3A 4P46B 2BNUB 5EBLA 4AG4L 4NN5C 2X4OA 1ZVSA 3SQBA 3HPLB 3RBSA 5T1KB 1F4YL 2NY6C 2N56A 4RISL 1LE5A 1S7QA 1MQKH 4AQ1B 4EDXB 1YY9C 1AGBB 2XQYK 3HZMB 4OCRL 1X44A 1YN6A 1KC5H 3H9SB 1A6TA 5JDSA 1BX2A 4WWID 2NPLX 1RJCA 1U8PB 2Q7YB 1GXEA 1D3CA 3WKNA 4BZ1L 5ITFA 1GGTA 3TVMD 2B39A 1N59B 4MDJA 3GB7A 3VRLE 2X4PA 1CZ8L 3EYOA 2C3XA 4JQVA 2WZPD 5EO9B 5JQ6H 1LQSR 1RZIB 4M61B 2EIEA 4OCYH 1EERB 4X6DA 1NUGA 4HX1A 3IJYA 1IGMH 2D7MA 2NY3B 4JPVH 3MUHL 2AK4D 1RAMA 4OSUL 3GEWB 3SHSA 4OBRA 1YN7B 1P7KB 3MBXL 4OGYL 3GGWB 4OZ4A 1JHKL 1T20B 1T1WB 1SJHA 3V0VA 3VH8B 1BZ7A 3I6KA 2OM5A 5CBAB 3O4LB 4PJ8C 1A2YB 2HRPL 2CIKA 4HJJH 2X41A 1FC2D 1J88A 1TVBA 3FT3A 1WCBA 3JV0A 3PDDA 1LP9F 1QLFA 3O9WD 1NH6A 5F7LB 2B4CC 4BKLB 5INDB 4H20L 3DX9A 4LLYA 5K59F 4FG6C 3SO3B 3DVNB 3CK0H 4GKNB 1ZVYA 3O6ML 1HINH 3ARGA 1RK1B 2E6QA 4CVZA 5EFIB 1RK0A 2FZ3B 1CWVA 2BMKA 5AZEH 35C8L 1E4KC 4KHXH 3LSOB 2GSGB 2F53A 3QIWC 3RWIA 3KLAB 4S11A 3MXWH 1U93B 5DR5H 4N0UE 5EBWA 3PP4L 4UQ3A 2HJLA 5JPNA 3ZHKA 4P2OC 5I1AA 5EZOL 4NO0B 2A74B 3NIFE 4JM4H 5E2VL 3V4UL 1X5IA 3CSPA 1P6FA 5ENWA 4XI5C 2YD4A 2RB8A 3ZE1E 1A6UL 3MO1B 2KZ1B 1PZ5B 2HTLD 1RIVH 5IT2H 3A6BH 2LABA 1HE7A 1T89C 3V4VH 1UEMA 4LHQB 3LEYH 3LRHA 1X4ZA 3KPLA 3MA7B 4ZQKA 1U8HA 4AJ0A 1FNGA 1F8TL 1SM3L 1YPZA 3CLFL 3NCYP 2PCPA 4U1SA 4GW4B 4XTRC 4EN3D 3SE9H 3OKEA 5E9DE 5I1GL 5C0JB 1U8MB 1CDIA 2CPCA 1BIHA 4BSWB 4CVUA 1ZS8B 1DBAL 2RFXB 3WXWL 4KZDL 4S1SH 1OAUH 5J57B 1A7PH 3HE7A 4XC1H 1GGYA 5D5MA 4EI5B 1BVZA 1WWBX 3QUYC 3EYQD 3KPMB 4LVHB 2RIKA 4V1DD 5DJCA 3UAJC 5DRNA 2VXUL 2H2PD