1SVCP

Nfkb p50 homodimer bound to dna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
311
structure length
311
Chain Sequence
PYLQILEQPKQRGFRFRYVAEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*AP*GP*AP*TP*GP*GP*GP*GP*AP*AP*TP*CP*CP*CP*CP*TP*A
publication title Structure of the NF-kappa B p50 homodimer bound to DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 60
structure length 311
sequence length 311
ec nomenclature
pdb deposition date 1995-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00554 RHD_DNA_bind Rel homology DNA-binding domain
P PF16179 RHD_dimer Rel homology dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1svcP02
2.60.40.340 Mainly Beta Sandwich Immunoglobulin-like Rel homology domain (RHD), DNA-binding domain 1svcP01
4RISL 4KK6C 4QHNB 1JNLL 5EUOA 3OHXA 4YNYB 2YK1H 3VXTB 4J8RA 1U58A 1E28B 2BSRB 2D7TH 3I6GB 5IMLB 2H45A 2DTSA 5FYKE 3ARZA 1ZGLP 2YUVA 2XTJE 1LP9A 3KPQB 3CFBA 5EORL 4I3RH 1KCVL 1Q9LB 1DBKH 3LMJH 3OAUH 2PTTA 5EWIL 5DDHA 4RGNE 5AUMB 3U30B 4AMKH 4W6WB 1G7LB 5C0AD 3NIFE 4Z7NE 1MIEH 4NKMA 3KYMA 1F97A 1QKZH 1WWAX 4ZS7L 2K7QA 2WUCL 4LF3A 5EUKA 1VGKB 1I1AA 1VCAA 3GFUA 2FD6L 2H32A 1BFOA 4X9FA 3SE4A 2K3TA 3RWIA 3DNKA 4XNZC 4ZPVB 4TSBL 5I75B 4QRQA 3QUZA 3MCKB 3QZWA 1T5XA 4NZUH 2FATH 1KEGL 3FN0L 4LCCA 5E8EB 3TP4A 1TJGL 1TCRB 5HYJB 3KPTA 2VQ1A 4LAQL 2F74B 3UTTD 4X7DC 3QXAA 3CH8A 1HCFX 4BFIA 5JW4R 1F3JB 4OGXH 5I74B 2IMNA 5HDOA 2Z0BA 1JRHI 3HZMB 4HBCH 4M6OH 2F53D 5GGTA 3D0VB 4HLZG 1J86A 2NW2A 1BM3L 4X6CB 2AEIT 3SGDI 2E7MA 1YEEH 2A9NH 5DJXB 1TXKA 1MFDL 2AQ1A 1FH5H 1KCLA 1E27A 1QFHA 2H1PL 1FPTH 3H9SB 5IB3B 4WENB 3LEYH 3P0VL 3PGCA 2VKXA 4NP4H 1T3FB 3VXRD 4ZOBA 1EX0A 3W0WA 5B38A 2BNQE 2VLRE 4HX1A 4KJQD 4PJEB 1NFDF 2BDNH 4U2YA 5K93A 3TBTA 3BP7A 3PHOA 3LS5L 5DRWA 1DBJL 3KGRA 4X7EC 4QTHB 4ENED 1KC5L 2AK1L 5E5UB 3KXFA 1OW0A 1G9EA 1UT9A 2NPLX 4FQPA 4ZAKA 4Y1AD 3ZDZF 3BSZL 4MYWB 4FZ8H 5CP7B 1HHHB 1JF5A 1MRFH 2YXMA 1QYGH 3MFFA 3CFKB 5CJQH 4OZFG 4XVJH 3T04D 5D6DA 1EVTC 2G2RA 1VADA 3L95B 5JQ6H 2HG5B 4OLZL 2BK8A 4P5TB 4NN5B 4R4BB 4N9GA 3RA7H 1J1OH 5C0CD 5BS0D 5D1XA 1KXTB 2DQDH 1WISA 2DBJA 1NUNB 4L3AA 1BLNA 3QDHA 4QXGH 2G75A 1CE1L 3K2MC 1CU4H 4HG4K 1K8IA 4NN6B 1IE5A 5HDBE 2NYYC 4PJ9B 3EW3B 2AJ3B 3QWOA 2DMBA 5I1IL 2OI9B 5K59E 1XF4A 2Y36H 3QDAA 3LN5A 3MV9B 1CE6B 4WEUD 2FHCA 4OT1L 4RIRA 4HKXB 3RNQA 3NIGF 3ILQD 3KPSA 3QFDB 1JWMB 1Q1JL 4ELMF 1MOEA 4G42B 1X9QA 2Z9TA 4PRDA 3PWJA 4WWKA 2WV3A 3IYLW 5EU3A 1IGJB 1OAXL 3O4LD 4DKDC 2NR6C 2XN9B 3T0ED 2YOCA 3UXFA 3DRTA 1V3KA 4J6RL 1UZ6E 4KJPC 1KN2L 1QG3A 2AKRA 3PV6A 3QDMA 3QPQC 5IVOA 2E3VA 4LSPL 3UDWC 5FA3A 5FEBA 3QJFB 4LCIL 5DJ0B 5EU5B 1CFSB 1M05A 5DQDL 3WS3B 5CIPH 3X3FH 1A6TA 5JOEA 3T2NH 3FT3A 1FZMB 4Y7MA 1MVUA 4G6MH 3LPFA 3BPOC 3ARGB 3BI9X 3OG4B 4DW2H 5J0BA 2PYEB 3V2AR 3HE7B 1PAMA 4MA1C 1P7QB 2LTQC 4N5EC 4OZGF 2ID5A 5DF0A 3C5SB 1GIGL 5SWZD 3OZ9H 4YBQC 5JOFB 1V3MA 4LEXL 3BIBX 3F7RA 3O6FB 1G7JB 3U2SB 1S9VA 2X4OA 5K9OA 4JKPL 1VHPA 4WO4A 1PGRB 5KSBF 4ODWA 5IP4A 1JPFB 1T4KA 3MJGX 5KS9B 4N0UB 1INQB 2YPKA 2R0WH 3TT3H 4QXTB 1PFCA 1RIUL 3MMEB 4ZUTB 1EIBA 3CIQA 4G7YL 4CW1A 4XVUD 4NCDA 3FQWB 3CSGA 5INDB 3C60D 1FORL 1CK0L 1CLZL 3GJFK 2DS4A 1AY1H 1KJ3L 1U36A 1MCFA 1QSFE 3OR7B 1NCCH 3C5JA 2ARWA 5GGTL 1TPXC 4NQSB 5C0JB 4NNPH 4HUXA 1RHFA 3F62A 5DUBA 1AHWC 1HINH 4IRJB 2FL5A 3D85D 3C60C 3RWCA 3DO7A 5T1MA 2YZ8A 1LO2H 4D9QD 5JLZB 4ODBD 3HZYB 4LPUA 2O5YL 3BH8B 4LVHB 2CDGA 3SDXF 5T3XE 1U2CA 2CLRB 4S2SB 4M7LL 4P2OB 5GRJL 4YK4B 3AS0A 2Z35A 3GSOB 4NO3B 1UH2A 1D5IH 4LCYA 1ZV5A 5E6IA 3BRDA 3NCMA 3RWEB 4Y19A 1SEQL 3QCTH 1TVDA 2YPVH 1GGIL 3QNYB 3DJ9A 1FV1B 3BRFA 4GLRH 2EKSB 2FSEA 4MNQA 4WUUD 4IDLA 2EEAA 4NQXB 2UWEE 4FQ1L 1K6QL 4YXKL 4XWGL 4UINH 3MV01 5IB1B 2IC2A 4OI9A 1I1FA 3V7MA 4P3DA 1HIML 3MUGA 3TO4B 1MF2L 3H0TA 2QBWA 3A67H 5E24E 3VFWA 4B53A 4GRWB 1ADQA 3PP3K 4LCUA 1F3DJ 5DJAB 1Q9WA 3PWPD 3BXNB 2NLJB 4B0MM 3B4NA 2QKIB 3MODL 5BO1L 1CZ8L 4X8JA 2A38A 4M8QA 1GZPA 4EBQH 2OYPA 3MV7E 1ND0B 3WIHA 1BD2A 1BJMA 1LEGA 2JJTA 2QHRL 4P3CH 5H37H 4Y4HA 5D96B 4LLQB 3QHFH 1AH1A 1D7FA 1H3XA 3OXRA 4P57B 3TBVB 2ARJB 1YEHL 3E3QC 1KCRH 2BHZA 5SWSB 1IILE 1HHGA 4NHUA 3MRBB 3VRJA 1LE9A 4BH8A 3KYKL 4FQLL 2IPKA 3AB0C 3UTSB 3MPCA 4G8EB 3V6OA 1GC1H 3AS3A 3QHZH 3V5HA 2FBOJ 4ZTOL 1S7TA 4DUWA 4J2XA 1G7QB 2NY0B 4XAKE 3BE1L 4XB7A 5F3HB 1U8OB 1EHAA 2ORBH 2RCSL 3KHOA 3NVQA 4ZNEA 5M7QA 2J6EA 4E9LA 1I8LA 4OUUA 1SYSB 3V7AE 1I4FB 3AS2A 4Z76A 3IRZA 4HBQA 4JPVH 2C4FT 1N6QH 1LEKB 2R0KH 3QISA 4JZOA 4A6YA 1T1ZA 1NDMB 2W91A 2GFBB 5C92A 2FBJL 2EXYD 1LE5B 4KDTC 5ISZE 4DTGL 5HGAA 1XGRA 1GJIA 5IEKA 1MRCL 3BUYB 1YN7A 3QO1A 4M1GH 3CGTA 3VXUB 4GKSA 2MHAA 5DS8B 3IVKA 2CDEA 4M1CD 2O5ZL 4X6EA 3V6BR 1XCQA 1U41A 2V2TA 2GEEA 2HRPH 1NGZB 3VXQA 1RZ8A 1DJSA 3TT1L 1BEYL 1W0YT 2D9CA 2EXYC 4C58B 1J05B 4HK0A 1WC7B 5ILTH 2VE6A 5ALBL 3JWDC 4GW1B 5C71A 4OZIF 1S9WB 1GAFH 1DFBH 2CLVB 4M1CC 1C12B 4U6TA 3RY6A 2WP3T 3ARED 5I8KH 1OSZB 5GRYA 1NMCB 3OJVC 2Z8RA 2E9JA 4MMXC 4TSAL 4X7FC 4K2UL 3U9PL 5IJVA 3LB6D 4HPYH 4DEPB 4TOYL 3W9EA 3TJHD 2CXKA 5B3JE 1CT8B 1A2YB 1IM9A 1N64L 2ATKA 4JG1H 3RZWA 5BXFB 1Z9SA 2VISB 4NQEB 5EU4A 3THML 4KMLB 2VLMD 4MB5A 5ENWB 3P30L 2R56H 4YDIL 3LB6C 1CFTA 1RZJC 1FIEA 4JE4B 1YC8A 4GBXD 4AL8H 4WEBH 1DUZA 3TJHC 3RZCA 1C16A 1TETH 3UC0L 2RIKA 5IJKC 3MRGA 4MA3B 5DYOB 4I18C 2D7NA 5D1QA 1J5OL 4MVBC 1UB6B 1QLEH 1NCWL 4MQXD 2NCMA 5CJOL 2P5EB 2VDRL 2NY1D 4M43H 3QIWA 1FG2B 1JI2A 5HY9B 5FOBA 1MLCA 1EGJL 4S1SH 2ZWLT 3QFJA 5FGBC 5IVZB 3RU8L 4RMTA 4GAYA 5C0GB 1MCOH 3RPIB 3RNKB 3QDGD 1J7VR 3GI9L 3LQAL 4XHQA 5MHSE 1EJ6A 5F7MC 1ONQB 3S88L 4J3XA 1ADQL 1YMMA 3PWLA 1N7MH 1H15A 4U7SA 2ZUQC 5C08D 1QBAA 3U7WH 3O2DL 2VB5A 5DEFA 1TIUA 2BSSB 3NOIA 3V0VB 1BIIA 2YHGA 4UT7L 4ALAL 3HC4H 4TUKL 3PL6C 4CJ1A 1AD0A 1TQBC 1FL6A 5DO2C 3J8F7 3WIHL 5L7XL 5I15H 4FQQA 4MDIB 1Q0YH 5FGSA 4L4VE 5EA0H 1UH4A 1AP2A 4YXLH 4LIQL 4WV1C 5C6TL 1OGTB 4FQXD 3VFSA 1MREL 4S1RH 2K9UA 5GISL 4XNYL 4PJBF 4ZO6A 2D7OA 4KK9D 3QCUL 5I66A 1NBZA 1OAQH 2WWKO 5J6GA 3IKCA 3Q6FA 4CRPA 3TVMC 4WTWA 4OB5H 2YUZA 2NZ9C 1T2XA 3H9ZA 4JFDE 2UVEA 3MXVL 1HHIA 4FQXC 5BCAA 2J6EL 4U7KA 4C54A 3ARFD 3OKMA 1O7VA 1RULL 5HHNB 3OTTA 1ZA6B 4KK9C 1FL3B 1HWGB 4R90L 4YDVA 2VAAB 5IMMA 3UBXI 1BX2B 3MGOB 5DSCB 3WHXA 1DUYB 2YZ1A 4JLRA 2J2ZA 2P7TB 3BT2H 3HUJF 4PB0H 3V0WH 2NXYD 5F7UA 4PJHA 5CSBA 1PG7H 2W0FA 4MZ3A 1JL8A 4D9LH 5C0AE 4HKZB 1HKLL 3MLRH 4PTUB 4APQD 5GJTL 1ACYH 4HPOH 2Q86A 2OXGA 4Y4FA 3BGFB 4DGYH 3QUMB 5IF0B 4EXKA 2ZCKL 1MELA 5E56A 1EH9A 5EBLB 1BZ9A 1CQKA 4WFED 1JWUA 3I6LD 4LLVA 1OM3L 2XNAB 3OKEA 1XMWA 3C8DA 2FECI 1KJ2B 3FOMB 2Z31A 4K94L 5GJSH 3VFTA 1FZOB 3ULVD 4L8BA 1QA9B 1R3KB 3BEVA 4XAWL 3C08H 3KPRB 2YD1A 4GS7B 5CCKH 3QEQE 4Y2DD 1SJHB 5BQ7A 5KG9B 2VXVL 3IJYB 1A4KB 4PUBL 2EECA 1MQ8A 3MO1B 3DX6B 1PQZA 5FYJD 4LBEA 2DKSA 4ODUB 4ZXBA 5LQBH 2VLJE 3ULVC 1K8DA 2AP2A 3S34H 3A6BL 5GS0L 1T22A 2NY4D 5I0ZA 5KVMC 1UJ3B 2VJXA 1UJTA 1F2QA 5I73B 5I19H 1VGEH 5A2FA 2PTUA 1JWSB 3GBNL 4LCWB 4YHZH 3VG9C 3OPZL 4G8GA 4L4TD 5IHBA 2DBLH 5HYQB 2BJMH 4N5UA 4CU8A 2NY4C 2ATPB 2CRZA 4XP6H 1J8HA 2D2OA 2RFXB 5AZEL 4YGAB 1NLBL 1OD9A 3C09C 4KK5D 1OAKL 3ARDD 3E0GA 3MRKB 5HYIA 1DQJA 3GSRB 4M7ZB 1UB5A 4MQSB 3L9RA 3O11A 4Y1AE 5F7YC 3SE9L 3QEUA 1U8IA 2XRAH 5EC1B 5IB5A 4Q6IA 2DD8H 4H1LA 4LSRH 2L7UA 5DJCB 4PJDE 5I30H 4NO0A 4NRZB 2LE9A 1KIRB 3BHBB 5C0CE 5BS0E 2YK1L 4LLYA 3ARDC 5CIPA 4FFWD 2YN3A 3SDAB 4EDXA 5DJDB 5CZXC 2GJ6B 4ZTPH 1AD9B 1A14H 1JZ7A 3VD3A 1ZHLA 1X6NA 2WIIB 3MRCA 4I3RL 1DBKL 1AGDA 3LMJL 3OAUL 3C9NA 5E94B 1P1ZB 4RFNB 2GITA 1NFDA 1ITCA 2ADGA 1H3GA 4AMKL 5I8EA 4XBPB 9CGTA 4NQVB 1KJVB 5EU6E 3GNMH 2C3XA 4NC1C 4FFWC 2VH5H 1QKZL 1RJZA 1UWEL 3MLXH 3D1MC 5IW3A 4AEHH 1BBJB 2HJFB 3Q5TA 3QULB 4PTTA 4WHYG 2F54A 1FLTX 1Q94A 4U1LB 3ZHDA 2CIKA 1FQ9C 1G7PA 5C09E 4GG6F 2BVEA 2OR7A 3RWJA 5JHDA 4NZUL 4PGBA 5D7JC 2FATL 1FO0B 2M26A 4IHOB 1GGCH 3T0EE 3L3GB 3RY5A 3TNNA 4Y4KC 3RJDA 3NA9H 2AEQH 4OCNC 4OM1H 5DJZA 3MBEB 2A6DA 4OGXL 5D5ME 5I1DA 2QQNH 2A0LD 1KLGB 4YHPA 4IIQB 2Y23A 1DVFB 3MRPB 1TLKA 4HMCA 1BJ1H 5J1AA 1YEEL 2A9NL 2VQUA 4ODXB 1FH5L 4X4ME 1YNTB 3O2VH 4LQFH 4G5ZH 4E0RB 2D7QA 2WM0A 1IRAY 5FO7B 1A7QH 1FPTL 3O9WC 2IH3B 3LEYL 5IEHB 1FNSH 4Z95H 3L5WA 4V1DA 1XGTB 4NP4L 2A0LC 1A47A 4QCIA 4QY8A 4Z77B 3M45A 4JN1H 4ELMA 1Z2KA 1OCWH 4JFEB 3ZKXC 2EC9U 2ADFH 2BDNL 4P23B 3H8NA 5CBEA 1BVLB 1KT2A 3SQBA 3P11H 3NIDF 4JZJC 4ZSOE 4CADB 1DTUA 5JZ7D 1OVZA 4YC2C 2YD9A 1AI1L 3QIBC 1RZFH 2VR9A 4K3HA 3T1FA 3IDNB 5KSAB 4J3WA 1MAMH 4OZGB 3RY4A 1U8QB 5DHXB 4MXQD 1N8ZA 2VDQH 2FRGP 1ZA3B 3DXAA 1IKNA 1MCBA 3DV6A 4I4WB 2IH1A 3E8UL 4FZ8L 4OCLC 4GFTB 1MRFL 4KDVA 5JZ7C 1QYGL 4YIQB 3BJ91 1HXMB 4CAGA 1H3WM 5CJQL 4XVJL 5D2LE 5KSBB 4RQQA 1F4HA 3JXAA 5JQ6L 4YBLC 1ZHNB 3DX9B 3RA7L 3ARXA 4EKXA 2EO1A 4MXQC 2DQDL 3NN8A 2FH6A 3P73A 1YZZA 2FLRT 3JZ7A 1YEIH 5EULV 1I7ZB 5JDSB 1MWAA 1CTNA 3RKDD 1EJOH 1S78D 4QXGL 5E2VH 2HYMA 5M94B 1CU4L 5DZNA 4DKFH 4Z8FH 5A16A 1FNLA 5C9KA 4LVOB 5IVXF 4PD4J 1MFAL 2VZUA 2GTZB 4UQ2B 5BZDA 4XGZB 4LLDA 3AY4C 3VD5A 3SE8H 1S78C 2VABA 3GSUA 1ZLVK 5EBMB 5C0FB 4K71C 4WUUE 3V5DB 2AV7A 4KK8D 3ES6B 2X4UA 3SDXB 1XIWD 4QT5A 3IDYC 3OBAA 2VNCA 3GBML 2HTKD 3VXMA 1IFHL 2X41A 4PJFF 3WNPA 2X7LB 4G9FB 1NC2D 4JFHD 1C1EH 3BAEH 3GB7A 5KSVB 5KOMC 3UX9B 2HJKB 3WNOA 4Z7QE 3PWPE 2OXHA 1CXEA 4FXGB 3X3FL 1ROWA 5KJRH 3ULSA 2PYFA 2X4TB 3KG5A 4PLOB 2QADB 3T2NL 2R2BA 4G6ML 2HTKC 3D39A 1RUMH 4DW2L 5BZWB 3ZHLA 2OTPA 4ZNCD 2I5YH 3HHRB 4M61B 5I76B 4S11A 4X98A 1S7QB 2WANA 4C4KO 5HBBA 4PJ7A 3QXDB 2ED8A 4ZFZA 2YA0A 3CZFA 3N0PB 1JPGA 3F5WB 4XNUH 1V7NH 1G7IB 3VRLE 5CEYB 4LFHD 1MJUH 5FYLH 4ZD3H 4M02A 5CD5D 1MCPH 1BBDL 4PLKC 2QQLL 2O61A 5KZCB 2R0WL 3TT3L 4Z7WE 3FB5A 5TDPB 3VFMB 1ZT1B 3RVWC 4C56D 2ZSVA 4Z7UF 3D2UD 3EDKA 4AK1A 1ZANL 3SKOA 1IC5H 1VFBB 1K4CA 3HR5A 3EAKA 1AY1L 2BSTB 4LFHG 1QBLH 4YHYC 1NCCL 1M7DA 2GCYB 3V5KA 5CSGA 4NNPL 5T1LB 2GK0A 2VLKD 1R3IH 5ABDE 4GRLB 5LKNA 1U8KB 1ZLWK 3SDYH 3FFDB 1T89A 1HINL 1XF5B 1MI5A 3O8XC 2EZ0C 3CFDA 3G5XB 3SKUD 1LO2L 1WZMA 2NY5H 3GO1H 2YA1A 3WIFB 4MD4B 1HSAA 3MLSH 5I1JH 5J13C 5E1AB 2YD4A 1XEDA 5I1KH 2FYYB 4NWUH 2OTWA 3BMWA 1CXHA 1ZLSH 4NWTH 1EMTH 5C2BH 3U48A 1I9RH 1OARH 3QCTL 1KIQA 3DTXA 1YJDH 2AXGA 5HPMA 3TV3H 1F02I 4ZUVB 1MCEA 2XFXB 3KPNA 3MC0A 3N1QC 2MQ0A 4UINL 1NAKH 1G6RB 4U1SA 5TPWH 2FEEL 2JK5B 4KROD 4PGDB 1RK0A 3A67L 4BZYA 1JHKH 4WFHD 1G9ML 5L6YH 1GOGA 3AM8A 4P46C 4MS8D 4EUPG 1X5XA 5C07D 4RGMC 4HKBB 3F7VB 4GAJH 4LPTA 1OP9A 3W0WE 1ORSA 1QSZA 4P4KA 5E9DA 1KB5H 2ICES 1ES0A 2V7HB 4I9WD 2VYRE 4EBQL 5EZJA 3TJEH 2C5DC 4HUUB 3FO2A 3RGVA 4PRIB 3STBA 2FLBT 2IPTH 3ULUD 4HC1H 1IGFH 2VZOA 1SBSH 2DOCA 4MS8C 3OB0H 3HE6C 3QHFL 3SBWC 3MA7A 2FIRT 3D3VD 4N0CD 4HDIB 4Y16D 5B8CC 3OKDB 3LOWA 1KCRL 4OZIA 5H94B 2HJLB 3FO1A 1IAKB 5LGJB 4RRPG 2KL6A 3UCRA 5EOCH 3TA3B 3UTZB 4JFQB 3QHZL 5CJXC 4AH2B 3ULUC 2APWA 2EE6A 5DI8A 3FQRA 3QDGE 4N0CC 3VWKD 1HHJA 4NPYB 2ORBL 2DLGA 4JFPA 4QRRD 4Y16C 1CLCA 5F1NB 5I16B 3LKQA 4IOIB 5HYFA 5F44A 4I8DA 1H5BC 4AENB 4HV8A 4KJYB 4DN4H 2DQFB 1B0WA 3EOBB 1OWRM 2IALB 4JPVL 5C08E 4LNRB 1N6QL 2R0KL 1XZ0B 2AK4A 5IFHH 3SCMA 4RX4A 5I1CH 1A9BA 2CDFA 5IUSA 2IANA 4KJWD 5IQ9A 1TZHB 3KPSE 1PZUB 2OLDA 4M1GL 5EO0B 4JM2C 5EN2A 5E8DH 3OR6B 4OD2B 1MFBH 2YWYA 1VDGA 2KPNA 2PW2A 1U9KA 2BSED 4H25A 3K4ZA 1ZT7B 2HRPL 4P9HC 3U0TB 1MPAH 4UBDC 3T4AA 4DGVH 3MTRA 4Y5XB 5IW6A 1AKJD 4LGSB 4PJ5D 1CFQB 4W4NA 3GRWA 3LS4H 4UZGA 3SKNA 5ILTL 2ZOLA 4RZCA 4NUGH 1GAFL 3QUXA 1WAAA 3Q3GA 2KDGA 5I8KL 3NIFF 4Z7NF 2NX5D 4YDKH 3W39B 4BH7B 5FA4A 4WGWB 3X11B 2RGSA 4DQOL 3HZMA 3DECA 4HPYL 4U3HA 3NAAH 3VXPA 2NXZC 4PJBB 5GGSY 4MX7A 4P3WA 1ITBB 1QSEA 4JZNA 2CH8A 1OY3B 3BW9A 4N8VA 1N26A 1P5UA 4Y5VA 4JG1L 4PJCE 3S5LA 3X13A 2OQJA 2H26A 2W07A 2Y25A 1A3LH 2NNAB 4EN3A 2R56L 3K80A 4NJ9L 1NAMH 3ZKSD 2WWMC 4AL8L 4WEBL 4PJGF 4U0QB 2XWTA 1N0LA 4HF5H 1KTDB 3MXWH 4R2GD 1H0DA 3RBGA 1TETL 3LN4B 4PBVC 1YNLH 4GW5B 1FFNB 1LK2A 4E41B 2BVPA 4WFEE 5HYSA 4NKIH 3WNLA 3B5GA 1IC1A 1K2DB 3I6LE 1L9MA 3S9DB 4KV5E 3HUJB 4M43L 2R39A 4S1SL 1KJ2H 3C6SB 2I07A 2ICWI 1N5AA 1S7WA 4WHTB 3MRLA 4KI5D 3BUTA 5F9OH 1MCOL 1FHGA 5H2BA 4WI4A 4R2GC 4JY4B 2R1YB 3ELAT 3L3KB 5A43C 5JIPA 4B50A 2Z93A 4ZOAA 4U1NA 3GSWB 2CKBH 1TNMA 3I02B 3OKKB 4DZ8B 3GM8A 4RAHA 3VFNB 5FYJE 5T5NF 5L9DH 2V17H 4B7LA 1ZGLA 1AQDA 4BFEA 3WUWB 3SDDD 1N7ML 3U7WL 2CMRH 4KI5C 3IAQA 1DN0B 4ZDHB 1NBVH 4UUJA 3S36H 1U2HA 1OT2A 3HC4L 3EDDA 4WFGD 5I15L 3S4SG 4HWBH 4XBGB 1M7IB 5EA0L 5BVJB 4X6DE 3SDDC 1QRND 1TCMA 3V79C 4YXLL 4L4TE 2X42A 4NIKB 2B4CH 4S1RL 1W2KT 2DQIH 1MCDA 4XNZB 4P5KB 1IEBB 3U46A 5DEZA 3FT4B 5SV4A 3H7BB 3KVQA 3PDDA 3SDCA 5DVMA 1OAQL 1KYOJ 3QG7L 2DQTH 3BD5A 1CDJA 5HI5D 1FYTD 3OG6B 2D4FA 4OB5L 5HDBF 3VWJA 3WSQH 4JB9L 5HHOA 1L7IH 5INCA 2VR4A 3VE0B 1MAKA 3AMKA 4R96B 2ZOKA 3A6CH 4F58H 1A66A 4HZLA 4XMPH 4NC1E 4PRHB 3KPMA 3B9KD 3VJ6B 1WZ1H 1CCZA 4QWWD 5C0BD 2R1WB 2I26N 4Q9QH 1LEIA 1SJEB 3UTTB 1CGWA 1HZHL 1QP1A 3CLFH 3CVHB 4I0PB 4GH7B 4P2QD 3HLAB 1LILA 4XCNA 4HK3N 3E6FB 4PB0L 1S9XB 3V0WL 2YEZB 3V6OE 1PG7L 1CTOA 3GMQB 5DEGA 4D9LL 1HQ4B 3QI9C 4UDTB 3MLRL 1ACYL 4HPOL 3L5XH 2DM3A 3T4YA 4F7MA 2PO6D 3FONB 4DGYL 3SY0A 4R0LC 1G6VK 2JIXA 3AXLA 2PNDA 1A6UH 3SJVB 4JFFA 3KPLB 3DYPA 5L2KD 4H0IA 1V7MH 2WMPA 3EO9L 4PY8I 4F15C 3RQ3A 4BZ2H 3GMOB 3EJZD 3IDIA 1ETZB 2IFFH 3VXRB 5DRXA 1T7XA 1FVDA 2EYTB 5IMKA 1D5MB 1U8JB 1RJYB 4NQCA 4HKJB 3H3BC 5DHYB 5GJSL 3CDGB 3G5ZB 2VAJA 4PP1C 3PQYB 5DR5H 3C08L 5CCKL 1X5KA 3MGTA 2E6PA 3BIAX 2CLZA 1VFUA 1NDGA 4CMHC 1QQDA 4GG6B 3OQ3B 4HH9B 1DCLA 3BZ4B 2AXFB 3CVIH 4KTYA 1P4LB 4IRJA 2PXYC 3QNXA 4X6FB 5LQBL 3S34L 4ESKA 2FJFB 3KPPB 3MJ8A 4LDOB 3VI4E 2DLTA 3GSVB 4IRSA 2Y5EA 2G9HA 2UZYB 5EZLA 2HWZH 2CR3A 3WXWH 3VGBA 1VGEL 3X3GH 4YHZL 1X5YA 4O2FB 4Z6AT 2DBLL 3PUCA 2BJML 4QYOA 4TULH 4KRLB 4FA8A 5FO9A 4XP6L 1KLFA 1DE4B 3DMMA 1FN4A 4QOKB 1ZVSA 3TZVC 2HLAB 4N1HB 3CSYB 2P46B 2UUDH 3GEWB 4NKOB 3ZE0E 3LEXA 5BV7C 1DQQA 3WN5B 3HNVH 2VLLA 5EO1B 2XRAL 1G1YA 3WIIH 5EIIB 2P1YA 4HUWB 2BMKB 3MUHL 5E7FA 2DD8L 3B9AA 3CC5A 4LSRL 3WLBB 5I30L 2ZG2A 4F7EB 4LMQI 3O4LB 3BPOB 1P2CA 4HGWB 3WXVH 4ZTPL 2X9WA 1A14L 5D2NE 2C4XA 4BSVB 2IGFH 1PJ9A 1FAIH 1A4JB 2UWEF 5FO8A 4MA1B 4S1DC 2HN7B 3WFEL 2LTQB 4JRXA 1FFQA 5AZ2H 2IF7A 5FKAA 3QFJE 2AGJH 1JUFA 2PCPA 2YC1A 4ZYKB 5ICZA 5DUMH 2HA1A 5E8OA 2IG2H 3GNML 3FFCD 2ADJB 4LKXB 4KH2A 3MLXL 2X9XA 1T1WA 5IFAH 4DK6A 4AEHL 4IS6B 1EV2E 2YD8A 7FABH 5FAAA 3LH2H 5B39B 4U1MA 5MEQB 1G7QA 2H2PD 3NH7H 1B6DA 1JHTB 1RZ7L 1O0VA 3ZKMC 5J6HB 4MWFB 3RX8A 5SWZB 5KVFH 3KYNA 2P48B 2WBWB 1GGCL 3QH3B 1EFXA 4ZO9A 3K1KC 3O3EB 3GMRB 1VEOA 3FRPG 3NA9L 4JFHE 5IVXB 5ANMB 3G6JA 2AEQL 4G80A 4OM1L 5EO9B 2BOCB 3ZL4L 4HJJH 1FJ1A 1TPXB 1FVCA 2H2PC 2Y5TB 3OXSB 2QQNL 4O2EB 1ZLUK 1M6OA 2YPLB 5KANI 3ARUA 4RDQG 1AHWB 3FCTA 2NY3C 4GQ9H 1I1AC 1PSKH 3MRFA 5T1KB 3C60B 4WI5A 3O2VL 4LQFL 1NCAH 3KLHD 1OL0A 4D8PB 1A7QL 1FLRH 1M71B 2MWCA 3QUZC 3QZWG 4GJTB 4EI5A 2JCCA 1UXSB 3EOAA 3VFOB 3X14A 1FNSL 4Z95L 5K9QI 4G8FB 3FQTB 3S37X 4BZ1H 1NGZA 1R5WA 5HYJD 4I3SH 1W0VA 1R0AH 1OCWL 4NFBA 1NBQA 2ADFL 3HPLB 3MROA 3KLHC 3FZUC 1IQDA 4QXWA 3K0WA 4JAMA 5FOJA 1ED3A 4JO1H 4K8RC 1RZFL 4A2MA 4PJFA 1GZQB 3KYOB 3VH8B 1RZIA 4C56E 1MAML 1ZWIA 5GXBB 5K9KB 3L6FB 2VDQL 4O02H 3VGEA 2L0DA 4KMQA 3U4AA 5FK9A 3H9SD 3IFPB 2DRUA 4JJ5A 1SMAA 2NTFA 4FTVA 4LPXA 3S98A 1RZKC 3EOYG 1NFKA 1WF5A 1KELH 5GIRB 2VLKE 2Q6WA 1BWMA 1HDMB 1FE8H 3G9VA 2Q87A 2CUIA 1KB5A 4NRXA 2V7NB 3Q1SH 4NDMA 1AO7B 1AGEB 1VFAB 5F7WC 5HVGB 1LMKA 2C1PB 1YEIL 2ZCLH 5GSVB 5BOZG 3WEXA 3WD5H 1EJOL 5CWSB 1U6AL 3DYOA 1F6FB 5E2VL 5ID1B 5IHZB 1OW0C 2HLFD 4F7CB 4F37K 5JXEA 4DKFL 4ZAKC 4Z8FL 5GZOD 4MNHA 3EO0B 4R7NB 4YWGL 3ARWA 3AB0B 4CVXB 4RBPH 3EYSL 3O3AA 4X5XA 3N9GH 2AJYL 4O58H 1CD0A 3VXNB 2MPAH 3HG1A 4Z7UA 3SE8L 35C8H 4P5TD 5I8CB 1KPVB 1MHPL 2HLFC 4ETYA 3L7FA 3U4EB 1ZSDB 3Q5OA 2EDEA 4MNGB 3BKJL 5GZOC 5K9QG 3DGGB 2ICEB 4L8SA 4HAFA 4DOHB 4XZUB 3KDMB 2W9DH 5FUZL 1RUPL 4JFOA 1C1EL 5DZOA 5C07E 3TN0A 4Z78B 4PJ9D 3DVIA 3TC9A 2HMID 3O6LH 3GUTB 2ITDA 3DV4B 5KJRL 3MV9D 4DZBB 5DZLA 4M48H 3U7YH 1AE6H 2Z92B 4NN7B 4KKAD 1RUML 4OAWB 3ULUE 3GSQB 2IADB 2CQVA 4WW1B 2JB5H 3NCCB 3VXSB 4WWKC 4XP1H 2I5YL 4IBLT 1AGBA 3V6ZB 5J3HD 1NGYB 5F6IC 4G6AD 5F7EH 4HIEB 4U1HA 4S0TD 2XN9D 2W60B 3D25A 3GSXA 4JQVA 4J3OC 1QBMH 4YFDB 1S5HA 3QDJE 4MJIA 3OF6A 2V9RA 2Q7YB 4K3EL 4XNUL 4KKAC 1ERNA 2EEBA 5C6WH 4DUXA 1EBPA 2J8HA 5FYLL 1MJUL 3FB7B 5DJ6B 43C9A 2FH8A 1MCPL 3PGDA 4NBZB 1MCRA 3ZYOA 4W68A 1G7MB 1ZHKB 1ZVYA 4QRUA 5HGBA 1VEMA 3IXTB 3R1GH 3N85L 3MYJA 2QQKH 2MKWA 3QUYB 1XGUB 2PYED 3HE7D 2M2DA 3HC3H 3T0BA 4U6XA 3W81A 1QBLL 4NQDB 1ULVA 4Z0XB 1HYRC 5EIQA 3NZ8B 3O6FD 1R3IL 4M62H 1WIPA 5ERWA 5TDNA 3SDYL 3EFDH 4QRTB 3U9UA 2APTA 3BQUA 2QSCH 3U6RA 1P6AB 3B9DA 3GO1L 1NAMA 1YY8B 3FAWA 3H9HB 1F90H 3CCHB 1QPPA 5HHQB 1E4XH 2YUXA 3MLSL 5I1JL 5ESAA 4IOSD 2IBZY 3EYQD 3CXHJ 4H20H 3O6FC 5IB4A 5I1KL 4NWUL 3JTTB 4I2XB 3RVXC 1DQMH 3GSNB 4QHKI 3OKLA 4L8DB 4WY7L 3SGEH 3AUVA 5D6CA 1ZLSL 4NWTL 1EMTL 5C2BL 1I9RL 5MEPB 1OARL 1KJ2A 3BPCB 1YJDL 2FWOB 1A6AB 2GJZB 3TV3L 3P4OB 2NX5E 3NTCH 5FDYA 2AJVH 5J9PA 2ZSWB 2R23A 4YAQA 1NAKL 5AYQA 2CKBA 3O41B 5TPWL 3IJYA 4UNTA 4XPBH 3DVGB 5IR1B 4HIHB 1FZJB 4EOWH 3ALXA 1ORQA 2VN4A 2ZUQB 5GGUA 3WS6A 4P2OD 1HE7A 4OF5A 5DMYA 4KTEH 4GAJL 5C8JB 2R15A 1KB5L 2IQAA 3OMZA 3PL6B 4EI6A 1TQBB 3TIDB 3TFKD 4GAGH 5GZND 1KULA 1HH6A 3TJEL 3BIKB 3MACH 3TCXA 3FB6B 1IZJA 3QYCA 3NPZB 2IPTL 1TJIH 2JJSA 3O6MH 1W72A 1SBSL 1VENA 3MRQA 4P2OC 4IRZH 4G9DA 1C7SA 1UWGH 1X7QB 1UM4L 3TO4D 2ATPA 3PDOB 3WFCL 2KBGA 3B6SA 3FMGH 5EZIH 4LOUD 5GZNC 2X4QA 1WK0A 3TNMB 5EOCL 3TVMB 3IDMA 4X4YA 1D5ZB 2HVKA 5C9JB 2CIIA 1JGUH 1RHHB 2X4RB 4KI5E 4ORGB 32C2B 1Q9OB 4PJGB 3JWOH 4UIKH 1MCCA 4FQXB 1KPRB 1K4DB 2BVYA 2R0LL 3BP6B 3UTOA 5HYEA 1CS6A 2FZ3A 4Z7VF 4LOUC 5SV3A 4DN4L 3VW3H 3E1F1 4XCCH 1CFNB 1T5WA 3ARBA 3UJJH 5SWSD 4ELKA 3PWNB 1IAIM 5IFHL 2WIIA 3RTQA 1I8MA 3UTSD 2Y9RT 5I1CL 4N1CA 3MR9A 4ODSH 4PBWD 5FCUH 3WLWD 1QFUH 2BCKB 5IT2H 3GMLB 1T80A 2YBRB 2VLRB 4PY7B 2NY0D 3D9AH 4NGHH 5E8DL 1QRNE 1MFBL 5DJYB 3NA4A 1BQLH 3OKNA 1I8LC 4O2CB 4PJDF 5ICXA 4QHMB 5DUPH 1MPAL 4DGVL 1AC6A 3WLWC 1FGNH 1R3HB 1LHZA 5KN5A 2VL5A 1JPST 3LS4L 1BIHA 3IFLH 3QAZC 5DQJB 1BQHA 1HILA 1YYLH 1YDPA 4NOFA 2BNQA 3CX2A 1FYTE 5FM5O 4NUGL 3W9DA 1LNUA 2H9GA 4YO0A 4H5SB 4BSWA 3RRQA 2IPUK 1U93A 4L4JA 5E4IA 1NMBH 3C5ZA 4YDKL 2OL3H 4XCFH 4HCRA 4HLZH 3RWDB 3VXUD 3EO1B 4QF1B 1YN6A 4Q2ZB 3NAAL 3QWQB 1T1XB 5BJTB 1F6LL 2OMBA 4MHHI 5C0BE 4KZDH 4J12A 4F9LA 5F9WB 3DLQR 3MNWB 3D69A 3O0RH 5ACZA 1OGAB 3ILPB 3VD4A 1D5BB 4YHIB 4LLUA 1HH9A 1XGTA 4PJ8A 2HH0H 4HIJB 4K94C 3RY6C 1KN4H 1NAML 1HSBA 3LKRA 4FG6D 1RK1B 4JO4H 2RJMA 3TH3T 2FX7H 5D5MF 3NFPB 5D93C 4HF5L 3VG9B 5FF6A 1KJMA 3MXWL 4OCRH 2VDMH 3PXJA 3AAZB 3S3PA 1U91B 3WJLA 2NY4B 3GHEH 5L2KE 4NKIL 4HUVA 1U3HA 1P6FA 2D3VA 1OQOA 3MLZH 4RAUA 1I8KA 1J0HA 1X6LA 3FT2B 3MRIB 3VDBA 2F19H 1KJ2L 3C6LA 4HMEA 4LEOB 1KCUH 4KHTH 1KUMA 1IEAA 2FB4H 5F9OL 1AXSA 2YD3A 1NMCC 1BOGB 1BAFH 4NQED 1Y6KR 3U36A 3PG2A 4OZFH 2CKBL 1HXYA 1HXMA 3LKNA 4TVPD 3RUGB 5IBLC 1KNOA 2ZG1A 1DDHA 3EBAA 3ARDB 5L9DL 2V17L 2X44D 4E42B 2H2SC 2ESVB 1B4RA 3PHQB 5A2KH 2EDFA 3BZEA 1FYHB 4HLJA 1RZGA 2W65B 2CMRL 3I3EA 3EDEA 1NBVL 4M6MH 3EHBD 3S36L 2P5ED 1C08A 3HI6H 2P8MA 3BJLA 4XTRD 1R24B 3PWVA 1JPTH 1QLRA 4JDZB 4LPCA 3U0PA 3B8SA 1G7HA 4GKOA 4ZFOB 3SGDH 2Z91A 5FYKL 3GMPA 3KLAB 3LQZB 5D2LF 1A02N 5EC2B 1AGFB 2B4CL 5MENB 1JF1A 4I0CC 4YHMH 3EHBC 5GGVH 2DQIL 1YPZE 4LKCB 2OCFD 3RWFB 1I1RA 1P69B 1PYWA 2PR4H 4FXKA 2PW1A 1ZE3C 5D7JB 3TCLB 1VSCA 2P47B 1J18A 2QR0A 4PJXE 1KEMH 2DQTL 5E00B 1T6VN 4Y4KB 4JRYB 3F7PC 5E9DE 4MQ7A 1SMOA 4XP9H 3HI1B 1ZS8B 1L7IL 1FNFA 5DK3A 5JO5B 5F89B 1MY5A 5JPMB 3D0LB 3A6CL 4LP4A 1EEZA 2YXFA 4GRMB 4XMPL 3AC0A 3SQOH 5I9QC 5TGBA 3HAEB 1E4JA 1WCBB 1YA5A 5IROA 5JORB 1IAIH 3MRHB 3QHTC 4W4OC 3G5VB 4D0BB 4Q9QL 3O9WB 4HULB 4OZHE 1GVIA 3TIEB 3CLFL 1IT9H 5TDOB 1FIGH 1QSFA 2FR4A 4R26H 1QFOA 4TNWK 1XR8A 4KHXH 1IGYA 1I3VA 1UENA 1UXWB 3IU3A 2YSSA 3FFCE 3UYOD 3ZKXB 2GSGA 3L5XL 4JN2A 1RD6A 1T0NA 2J88L 2V6HA 4JZJB 1CD9B 3C8KA 4K3DH 1A6UL 3SO3C 5ESQA 4LSUH 2UWEB 3QIBB 2R2EA 1V7ML 1AXIB 2XKNA 5I2IA 4BZ2L 1OHQA 2IFFL 1MCJA 1JYXA 2AK4E 1MFCH 1TITA 4UIMA 2DWEA 1H3UA 4HUMB 2JLLA 5DJ8A 4KFZC 1WBXB 3WKMH 4ZMAT 2HT4D 2WBJB 3L3DA 5DR5L 3WNNA 2W0KA 4X4XB 1IAOB 5E8PA 1A1NA 4OIIH 1MLBB 2D9QB 3UTQB 4PJIF 1CG9A 3MRNB 3U1SL 4YBLB 1PW3A 4Y4FC 5JW3H 2E7BA 2IEPA 4DKEH 1ZMYA 3VRLF 1OAYH 2BNRB 3CVIL 4NUJA 3FFDA 4LMQE 5EUOF 1KCSH 1EEQA 1EPFA 2R2HA 1E6OH 4Z7WF 4NO5A 1X5FA 1R5IB 5GRWA 1NFIB 4BELD 1LP9F 3LKPA 2AXHA 3U7AA 2UUDK 4TN9A 4ZXBD 5ICYA 2IPUG 4ONHA 4OQTA 5CMAB 3S97C 1T0MB 2VTFA 2AW2A 5HYJE 3RKPA 4RMWA 1AQKH 3QNZB 1WWWX 2HWZL 3WXWL 3MLPA 1MUJB 2A1WH 3X3GL 1OTUD 3HA0A 3MV7A 5E1HB 4CVWA 1T7WA 3IDUA 4NO2B 4TULL 3ROLA 1WZLA 3DWTA 4K71B 3L5JA 3GMNB 3DI3B 4X6CE 4ZXBC 5JIIA 4L9LA 4GKNB 3V52H 1NJ9B 1QFWM 3IDYB 1YUHB 2EO9A 3LKSB 4LAJH 4CU6A 1CDBA 2D7MA 4KGJA 4G43A 2DLEA 1IBGH 2G5BB 4TPRH 1IGTB 3MLYH 5IOPB 3SGKA 1OTUC 5I17B 1J8HD 3HNVL 2SEBB 3WL9A 1BOYA 3WIIL 3Q6GH 1MH5A 3ZDYE 1TVHB 1A1OB 2OM5A 5E7BA 3TBSB 3EIFA 3JV6A 3AROA 4WU5B 4F2MA 4PJEE 4LCWD 1MCIA 5F88A 3L7EB 3SKMA 2ZZUT 3DBXB 3T3PE 3WXVL 2DYPB 1H9VA 4F3FB 2KZ1B 2IGFL 5IESH 1FAIL 2X40A 1NC2B 1DEEB 3G6AB 3KWWA 5DQ9A 3NCJH 4HS6A 1XGQB 1HYSC 3QXTA 4HDIA 2AGJL 1IM3A 2PF6A 5DUML 3EGSB 2DM2A 5FFLA 1G0DA 4GG8A 5LGJA 5ISZA 3DRQA 5FDWB 2EICA 4CMMB 5IFAL 4J1UA 7FABL 3LH2L 4R7DB 3OGOE 1QEWB 1X44A 3NH7L 1OOAA 1URLA 2VL4A 4XH2A 3M1BA 4ZS6D 2GJ6D 5KVFL 2COQA 3BDXA 4LSVH 2ERJC 1XGPA 1HNFA 3VD7A 1JK8A 1NGWA 1D6EB 4ZUUA 1TZIA 1WV7T 5DMKA 4YHYB 2A73B 2DIJA 4HJJL 4U6VL 4AQ1B 3CSBA 1UURA 5IK3B 1XZ0A 4CNIA 3VI3F 3AGVA 3MV9E 4ZS6C 1EUUA 1ZHBB 4MSWB 5DRNB 1VEPA 1B88A 1PSKL 4GQ9L 1T7YA 2BNUA 3G9AB 3O8XB 4WEMB 3H42H 5FM4A 5IM7B 1MCWW 4QNPE 3HZKB 1P84K 3CD4A 4PJAB 1FLRL 3DX8B 4RFNC 3QPXH 1W8NA 4YR6A 3F12A 2OJZH 5LAXB 5J13B 4KKLD 3I6KB 2X4NA 2R4SH 4X99A 4BZ1L 4LASH 5J4MA 4V2BA 2CK0H 4M6AA 2GTWB 4MD0A 3JWDH 1R0AL 2AI0H 3BEWB 3MBED 1TVBA 3I50H 4W81A 4IDJH 2IFGA 1LO3H 1WVZA 3SPVB 5FGCB 1KIPA 4JO1L 1DVFD 2F58H 2J5LC 5TQ2H 4KKLC 1S7XB 3ROOA 1CDCA 3DROB 5E95B 1N3NB 4YDJB 2BVTA 3OAZK 4K7PH 2PYEE 2BVUA 2X1QA 1K5NA 4NSKB 3RIAF 5I18L 4P46B 3MBEC 5CS7A 2CKNA 1Y18A 4QRSB 1OB1A 1I85A 4HS3B 1CICA 2G5RA 4G8IA 4RBPK 4M4PA 4F7TA 4ISVB 5E2UL 1KELL 4BJLA 3BKMH 4JFED 3BP5A 3ZZ1A 1FE8L 5GS2D 4P23D 3CK0H 3G04A 3Q1SL 4MCYA 1MHCA 2ZCLL 2WLZA 2HFFA 3WFHA 4N0UE 4LRNL 5KS9E 3BN9D 3HE6B 2HRLA 3GJFH 5KSAD 2EDNA 5B8CB 1T2QH 3FOLA 4YHNB 3TYFB 4NQCE 1IKNC 3QIUA 2FEDD 4PGEA 3IDGA 3NABH 3GSNH 1G9MC 5AD0B 1NANH 3N9GL 4O58L 3MV8B 4NKDA 4PJCF 4OFPA 2MPAL 3HCVB 1IQWH 1SEBB 4L4VA 1JBJA 4UDUB 3LKOA 35C8L 1KLUA 3H7LA 1YYMH 5IG7A 3D3VB 1F8TH 4PYHA 1QACA 4F80A 2R1YA 3L3KA 3AVEA 4LLMA 2FEDC 1A22B 3BVNB 5ACMA 1KPUA 3OV6A 3UJTH 3V0AC 1P7KA 1WBYA 1UH3A 4HH8A 3BDYH 3NCYS 5GS1A 2WINB 4NHCH 2KH2B 5IHLB 4WDIA 4Z7OE 4NZTH 2AV1B 3HNTH 1I3RB 3VXMD 1S7VB 4KV5F 1DP0A 3O6LL 4JFDA 4QRRB 3REVB 1ZTXH 1NCBH 5C0IB 3MSPA 3U7YL 1AE6L 3RWGA 1PKQB 3O3UN 3F7YA 4JM2B 4LLWA 3HRZA 2JB5L 1DLHB 1RJLB 4XP1L 1UCBL 5HJ3B 4WW2F 2AEPH 3TO2B 1D9KB 5FB8A 3PP3H 4E5XA 1PLGH 3IGAB 4WJ5B 5F7EL 3VXOB 4FNLH 2ILLA 4Z5RA 2O26U 1RU9H 5HGHA 1QBML 5GRUH 5CGTA 4G9FD 5D70H 5C0AA 1U95A 5KTEH 1RUKL 1KFAH 4ZFFA 5JDJA 3LPWA 4PFEA 3WE6A 3MLTB 3LV3B 3ZTNH 3BOVA 5BRZB 1WBZB 4NFCA 2QADD 1DQTA 4AIOA 2OJEB 2FDBP 3IU4H 4D0CB 4U1JA 3R1GL 2C3VA 4TTGA 1CXKA 2QQKL 2OL3A 5DRZB 1CN4A 2J8UB 4X6DF 2NXZB 5F6HJ 3D18A 1F11A 3H2WA 5EOTA 1Z9MA 3FTGB 3HC3L 2EYSA 2MKLC 2VLJB 5IFJA 2BVOA 1KIUA 2I25N 5SWSE 3UTTA 2H6PB 5I1GH 1QVOA 5DK0A 3UTSE 3QEQA 2P8LA 4FFVC 2F53A 3OKOB 2QSCL 4MXVE 5CEZH 4WNQB 1EXUB 5FYLE 3GHBH 4Z7VB 5KZCD 4UTBH 1F90L 1E4XL 4GSDH 3PIQA 3K8MA 5ESVA 4MGXA 1NC4B 4FQHA 2B1AH 4JJHA 4H20L 1TDQA 4UTAH 4U1KB 4YQXL 4UILL 1Z5LA 4X0KA 3MLWL 4P9MH 1DQML 4U1IB 3K81A 2LFGA 2QJDA 4HXAL 1KG0A 1IEHA 4C59B 4L3EB 1PZ5B 5JW5A 3O45B 3K3QA 1CWVA 1CGYA 5T1LD 4LP5A 3JV0A 4GRLD 1T89C 2HT2C 3V4PH 1GHFH 4CDHA 1TJHH 4HWNA 4UU9A 4OZFA 1XR9B 5DJ2B 3VXUE 5IV2B 3T8XB 1JNHB 4FHBD 5CD3A 2X4PB 4XPBL 2JCCE 1D3CA 4EOWL 4L5FL 2FJGA 3ULVH 3MUY1 5JR1H 4X80H 4Y1AA 4ETQB 2NY2B 4KTEL 5GSRB 4MDJB 4Q9BA 4QRPB 4EDWH 3F8UB 5FKPA 2DI9A 1Q8MA 4EVNB 4GAGL 1U8LB 3L3HB 4HEME 5EU6B 4F8QA 1A9EB 3MACL 2D31A 5ID0B 5C0CA 5BS0A 1TJIL 1RMFH 3O6ML 3SDDB 4CKVX 4H88H 4IRZL 1SYVB 1UWGL 2DWDB 5KAQG 1WICA 4HFWA 2MQCA 4XP5H 1MCLA 2Z8WC 2ZG3A 3FRUA 4XP4H 1DE4A 3FMGL 4K7FA 4OCYH 4TRPH 5EZIL 1Z0NA 1JZ6A 5BVPH 2DMCA 1DANT 4OGYH 3T65A 1EZVY 2BXZA 4MD5A 4ZODA 1E4KA 2P24B 5JOPE 4LPWA 5IQ7H 1F5WA 3JWOL 4NQEE 4NYLB 4UIKL 5D7IB 2C1OB 4PRID 1NBYB 2A6KB 5GS3A 4M8VA 4ODHH 2DDQL 1CVRA 1Q9KB 4R4FH 1OF2A 3VW3L 1A8JH 3MLVH 4NBXB 4JO2H 3T0EA 4XCCL 4MAYB 4NKQB 4JQIH 3UJJL 2P5EE 3SGEI 3DOSA 4ODSL 5D5MA 5FCUL 3QO0B 3TA3D 3ZE0F 5IT2L 3QI9B 4U31A 5BW7A 4RWYH 4H8WC 5CBAB 4DVBB 3D9AL 4M03A 1IGMH 3P77B 4NGHL 3FN9A 4Z18A 1I9EA 4X4MA 1FZKA 4WHYH 3STZB 1LD9B 1PX3A 1BQLL 4KKBD 4PP2B 5IIEB 3JV5A 5DUPL 4JKKA 4Y5YA 3CLEH 1HEZA 3TA3C 3IFLL 1NCUA 1YYLL 1XF3B 3VFGH 4PRPB 2VWEE 1JGEB 4QTIH 4BFBD 3QH3A 5IGXH 3GBLA 3O3EA 3R06A 4ZSOA 2E7LA 2A83A 1X4ZA 1U8HA 2CD0A 4KKBC 2Q8AH 3QQ3A 1NMBL 1U92A 4TUJA 2OL3L 3DYMA 3PJSA 4XCFL 4X9HA 3OX8A 2BFVH 3B2UC 5KSUB 5SWQA 5HVHC 1W0WB 3QCVH 4PRNA 5CSZA 3VFRA 1QHOA 2PXYB 3PNWA 1PKOA 3CFJA 2YS4A 3RHWK 3O0RL 4HIIA 3FQNA 4KTDH 1UFUA 1UKTA 3L3OA 3QB7C 2XWBB 3ECBA 5D2LA 4KKCD 3R0NA 1WT5A 4TSCH 3QUXC 4EQ3A 1RFDH 1KN4L 4PGCA 2ITCB 3O3DB 3D85A 4OCRL 2VDML 4WFFE 4JFYA 4HJGB 2HAZA 3OJDB 1J88A 5HI3D 1XFPA 3TBWB 5D1ZB 3MLZL 5JIHA 4AIZB 4KKCC 3TZVB 4OUOA 3DUSB 2H8PA 5EFIA 3U4BL 4Y5VC 2ZP0T 1KCUL 4NC2B 4R4ND 4KHTL 4OIBA 1N6VA 4L3CA 4DGIL 2AERT 1BAFL 1J1XH 8FABB 1EEYB 1BVKB 1FNHA 4NJAH 1JGDA 1BFVH 2C3GA 4WUUA 1MHEB 5HI3C 3VRIA 2AJZB 4MJ5A 1FNEA 1UACH 1INDH 5DD0L 5JUEH 2XI9A 4XPHL 3DVNB 1I1YB 2V7NA 2P5WB 2A9MH 4XCYA 4R4NC 3MJ7B 2BX5A 4E41D 2LAAA 4P4RA 1UQSB 4M6ML 5TJWK 3HI6L 3L1OL 1RIHH 1GGUA 2R4RH 1JPTL 2X05A 3PWPA 3CH1A 1JRHL 2VRAA 3MRJB 4P59H 2J8OA 4PJIB 4PJHF 5CINH 2KZWA 5JNYB 3VFVA 3KPRE 1BFSA 1CXIA 1FRGH 5CILH 3NPSB 3QA3A 5EUOB 4KK6D 2D0FA 3BO8A 3OHXB 3PWUA 3T2OA 4J8RB 4I5BA 1U58B 4YHML 1UM6H 4XNMA 3RL2A 3P4MA 4LSSH 3PGFH 2I9LA 2PR4L 1RUQH 1LP9B 3ARVA 5HTSA 4YXHL 3CFBB 2V5MA 4AIXA 3S7GA 3X12A 1KEML 2DI8A 2XWJA 4A2LA 3KJ4B 5KBNC 2PTTB 4KQ4H 4GOSA 2NY6C 5DDHB 1BZ7A 5FECA 4XP9L 4YHKH 2I9TA 2GJJA 3HC0A 4NKMB 3SDCD 3KYMB 4GKZA 4LF3B 5E2TH 4Z7WA 5EUKB 3VWJD 3WUWG 1VACA 5C0DA 2NY3B 4LCWE 1I1AB 3SQOL 3HMXH 3LRHA 4KDTA 2H32B 1BFOB 1WEJH 5ITFA 3RWIB 1IAIL 3C8HA 1NSNH 4P48A 2X1XR 1HHKA 4QRQB 3QUZB 1MCQA 1JZ5A 5DD6A 3QZWB 1T5XB 1QO3A 1QLFA 5T3ZH 1IT9L 4BSJA 4UMGA 4XXDA 3SDCC 2I27N 4FABH 1FIGL 4BM7A 4LCCB 3RJQB 4R26L 4KHXL 1UA6H 3QXAB 4OIAA 3VWJC 4BFIB 1N5YH 4D0DA 4OFVA 3P0YH 4G6JH 4P2RD 2NW2B 1DBAH 3CX5K 4K3DL 1P9MA 4LSUL 3FJTA 4IMLA 1E27B 1QHPA 1UM5H 3ZMRA 4JY6A 4PRHD 4BKLA 1H8OA 1SJVA 4PRAA 1MFCL 4Y0GA 3K7UA 4I0PD 3PGCB 4HGMA 3ZDZE 1GGTA 3WKML 3WNMA 3NCBB 3VCLA 3IDXH 1EAPA 3W0WB 4ZQKA 4HQQH 4D94A 5B38B 2V9TA 4OF6A 4HX1B 4OIIL 2ZUYA 4FRWA 3IAPA 4OTXL 3AREA 2C7UA 4M7JL 4GUPA 1A1MA 4DKEL 3TBTB 2ENSA 1OAYL 3BP7B 3PHOB 2VN7A 6CGTA 5DRWB 2VDLL 1KCSL 2IQ9H 3SJVD 4I0PC 4OFYD 1E6OL 5CZVH 1VKXA 3CFIC 4KVNH 1JMXA 3KXFB 5JPNA 5IJKA 4I18A 3GJFA 5JA8B 4ZAKB 2XQBH 2YD7A 3EYOA 3L3IA 1AQKL 3MFFB 4KUCD 2UYLA 5D9SA 2A1WL 3PQYD 4GT7A 1VADB 4GBXA 5CEXA 4N9GB 4PREA 3NIGE 1RURH 5D1XB 3BDBA 4DFHA 4OI8A 3UTPD 1BLNB 3JBG7 3REWA 3IF1A 3LQMA 1IAII 2EDLA 2G75B 1DBBH 2P43B 12E8H 1IBGL 1K8IB 1IL1A 3OAYK 4TPRL 1RVFH 3MLYL 3X17A 4IRSC 4EUPH 1FZJA 3Q0HA 3Q6GL 2NYYD 3QWOB 5ADPH 2FIKA 5GGRB 1JN6A 1XF4B 4J3UA 3B3IA 3LN5B 1M4KA 3QXWA 5DMGC 3QDGA 2WW8A 4JFEE 2GAZA 5J57B 4RIRB 4X7SH 3RNQB 3S96A 4WI8A 1U8NA 3KPSB 4AJ0A 2VZVA 1XH3A 4PRDB 3PWJB 5IESL 4WWKB 1YMHA 4YBHA 5EU3B 2VUOA 5C08A 5F6IB 5K9JH 2VIRB 2BRQA 4N0RA 4QOKD 4WV1A 3DRTB 2NR6D 1UCTA 4K07A 1X7QA 2AKRB 3PV6B 3QDMB 1K3ZA 3QXUA 1NGXA 4KJPD 4YFLI 4JANA 5FA3B 3RWHA 3QPQD 4C83A 3ULUH 1M05B 1A6TB 2Y06H 3DUUA 1F4XH 3FT3B 1I7UB 1MVUB 4Y89A 1T21A 1LO5A 5ACLA 4YPGA 2EDQA 4WTZG 5IB2A 4LSVL 3WN5C 2V2WA 4N5ED 5GRVK 1YECH 3ME0A 2Y7QA 4YBQD 5B22A 1S9VB 5J8OA 2X4OB 1X5JA 3M8OH 1ZLVH 1S7RA 4HUKB 2E7CA 5K9OB 5SX5K 5D7SL 3FQXA 1VPOH 4ODWB 3ARFA 1OP3H 1T4KB 5GGVY 5F7NC 1WFNA 2YPKB 4H26A 1A6PA 3H42L 4HFUH 4BUHA 1KOAA 1EFQA 5FV1L 3A6OA 4CW1B 3VA6A 1H8SA 5E5MA 1YEJH 3QPXL 5CLWA 3P4NA 4ERSH 4RWHA 2VXSH 2OJZL 4P9HH 4D9RD 3SDXE 1N2RA 4L8CA 2R4SL 4PJCA 3VFUA 2R1XA 4GAFB 2YA2A 2CK0L 4FP8H 1I9JH 3C5JB 3JWDL 4G9FE 4L29A 1A7PL 2AI0L 3DHJA 5B39G 4APQA 3I50L 4HUXB 4IDJL 3WYRA 3WBDA 3OGCA 1LO3L 5DUBB 4LPYA 2FX9H 4M5YH 2YPLD 2FL5B 2F58L 5TQ2L 3TWCH 3RWCB 5F7HA 3DO7B 5T1MB 5HXMA 5HHVH 5T1KD 5SX4I 1UVQA 4K7PL 2CDGB 2JB6A 4OKDA 4YGVA 3DSFL 2KUTA 5EPMA 3STLA 3QEHB 4KDWA 2Z35B 4LCYB 5E6IB 1JYVA 3TGXA 3TBYA 3IAGC 1JP5A 4Y19B 3BKML 4Y2DA 3GMMA 4WW2A 1YNKH 2RB8A 2W9EH 2FSEB 4MNQB 5FUCE 3QQ4A 3QUKA 4XNXH 1I1FB 4WTXA 2J4WH 4P3DB 4U0RB 1F6AA 3MUGB 1NCNA 1YEDA 4AM0A 4DWHA 4U05A 1JYNA 3H0TB 5TQ0H 1T2QL 5ETUA 1VA9A 3UBXA 3KHQA 4D3CH 2CJUH 3VFWB 4PJ7F 3NABL 3GSNL 3IJSA 4LCUB 2DTMH 1EGJA 1Q9WB 1ZLWH 1CIUA 1FNGA 2WQ8A 3MRRA 4X8JB 1IQWL 4M8QB 5CHNA 4P99A 1GZPB 4X6DA 1YYML 1JGVH 3VH8G 1F8TL 2VERN 4L4TA 1BD2B 1LEGB 2P45B 2DJUA 4FQ2H 1AO7D 4EZMA 4Y4HB 4N0FA 4YH6A 3I9GH 1JNJA 1W8OA 1F13A 2Z8VC 3OXRB 3BDYL 5TE7H 2J3SA 4NHCL 5JXEC 2ADIA 4QXUH 1HQRA 4RMVA 1T2JA 3RDTA 5IW1A 3O2DA 1HHGB 4NHUB 4NZTL 3VRJB 1LE9B 3HZVA 4BH8B 2VR5A 4UAOB 3HNTL 2IPKB 4MJ6A 3B9EA 1L0QA 1YEKH 2XQYK 1F4WL 2AABH 5D7LD 1PD6A 3V5HB 5DWUH 1S7TB 1ZTXL 1NCBL 2VUYA 2P8PA 3TESA 1WIOA 5EU7E 4XVSH 4WI2A 3LEVH 4XB8A 2AEPL 4XC3H 4HHAA 4OUUB 1PLGL 4L8SC 4KWUA 4Z76B 1FBIH 2DL2A 3BPLC 4FNLL 4LHUD 1RU9L 1D5XA 5FHAH 2GT9A 5GRUL 3KR3H 4H0HB 3QAZB 3TN0C 4NNYA 5F1IA 5D70L 4JZOB 3LIZH 5KTEL 3JV4A 4A6YB 1T1ZB 1KFAL 1CL7H 4AEFA 1OWWA 5HGAB 1XGRB 5IEKB 1YN7B 3QO1B 5HGDA 3U0WH 4GKSB 3IU4L 2MHAB 3IVKB 1CDGA 2N1KA 4UT6L 4LHUG 2CDEB 4PRIE 4XPFH 4X6EB 4ZUSA 1XCQB 3VXSD 2BC4A 2BOBA 2V2TB 3VXQB 1RZ8B 2XY1A 4UQ3A 5HSFA 2IAMD 6FABH 1YPZF 4JQVC 4HK0B 5I1GL 1NANI 5F7KC 3TIEA 2EYRA 2A6IA 2GIYA 4PJXF 5DTFA 4NN7C 4DKAA 4EXPX 3M07A 1QFWI 4QHUA 4AT6A 1EERB 5D93B 3GHBL 2BRRH 2C4FU 4ACPA 4UTBL 5IJVB 2IAMC 2EDKA 1S7UB 4GSDL 3GK8H 5BMFH 2EDJA 4TYUA 4N68A 4F7PA 3QUYD 3W9EB 2B1AL 1NLDH 4UTAL 3ZKQD 5AYUH 4P9ML 1IM9B 1FFPA 2ATKB 4OZHF 4P49A 4NQDD 4OCXH 5EU4B 1CFTB 3BQUC 3V4PL 3ZHKA 1GHFL 1DUZB 3QUYC 5AG9A 2XKSA 3V6FA 1FFOA 1U42A 5AWNH 3RZCB 4X9IA 1C16B 4RSVA 3LD8C 3MRGB 1I7TA 5D1QB 5E70A 2V2XA 5F3BA 1S9YA 1F4YL 2V5SA 3ULVL 5LGKA 4MVBD 1DBJH 3MZTA 5JR1L 4X80L 4JDVA 3QIWB 4JREB 5FOBB 3IXAA 1MLCB 2APVA 5JQHC 3ZE2F 1BVZA 4EDWL 3ZO0A 1JNNL 4GAYB 1FCGA 5FYJL 4M3JA 1OP5K 4TTDD 2UY6A 3FB8B 1RMFL 4K7PY 4H88L 5D2NA 1QTYT 2UZIH 1O7SA 1AGCA 1P5VA 1WFOA 3MJ6A 5J7CC 4RFEA 1YMMB 3PWLB 4N8CH 4U6HA 1H15B 4XP5L 4K9EC 4XP4L 4OLYH 5FGRA 1BQSA 4KRPC 3B5TA 3EYFA 5DEFB 4OCYL 4TRPL 2XTJD 1BIIB 5BVPL 3LVEA 5BV7H 4OGYL 1YUHA 4TTDC 5HHMB 1AD0B 1FL6B 5IQ7L 1A3QA 3PL6D 4ZUWA 5DO2D 4FQQB 3PP4H 1UC6A 5I1IH 1WAAF 2ZCHH 1CYGA 3F6IA 3SE3C 1JZ2A 2JJSC 4PG2A 1S8DA 4WU7A 5FM5M 3LRSA 1AP2B 5HHXH 3L3JA 4ODHL 4OT1H 5I9QB 2XTJC 1LO0H 1XIWA 3VFSB 4R4FL 5LJYH 3MLVL 4JO2L 1EO7A 2FECL 4E41E 4U6YB 3DURA 1B9ZA 4JQIL 3MRMA 4RGNC 5I66B 1NBZB 4YZFF 2DKUA 3HUJE 5J6GB 3IKCB 3Q6FB 4R3SA 3T1WA 4KMTH 3TYGH 2FHFA 2OX5A 1A0QL 3TVMD 1FVEA 5F72S 3T77A 4RWYL 1K3IA 1KN2H 2NZ9D 3ZDYF 1IGML 1HHIB 4M6NL 3OKMB 2D0GA 1HOCB 2VSCA 1JJUA 3SO3B 4PJEF 4YDVB 5IMMB 1FSKB 3MV11 1B0GA 4JGJA 4PS4L 5C86A 3CLEL 3T3PF 4OKVA 2XQYG 4HWZA 3RL1A 3WHXB 2X4SA 2L7JA 1N59A 3ARBC 2HKFH 4X5LA 3MRDA 3BWAA 3VFGL 1JMZA 2R9HC 4PJHB 2X5PA 2NZIA 4QTIL 2W0FB 4WUKH 4X83A 5IGXL 4RFOH 3G5YA 5JW4Q 4QGTA 5A3ID 2BVQA 2Q8AL 5IKCA 43CAA 1LGVA 2A73A 2Q86B 2BFVL 2VLRD 4Y4FB 1CDHA 4S0SD 2AEWA 5CEZD 1X4XA 2OTUA 3HFML 4LK4A 3TLRA 4C56A 1BZ9B 2H32H 5T5FH 3D2UA 4NZRL 1JWUB 2D4DA 2JJVA 1RIUH 4LLVB 3S35H 5KVGH 3OKEB 4O00A 4G7YH 1RPQA 3FN3A 1MJJA 5A3IC 3M17A 4AG4H 15C8H 5LWYH 2Z31B 3VFTB 1JVKA 3I6KA 4L8BB 1R3JA 3BEVB 2VLKA 4FFZH 5T5NG 1HI6A 5BQ7B 3N1GC 5D72L 1J12A 5TFSL 4N1EA 1PQZB 4LBEB 4K8RH 3ALWA 3BP4A 1T1YA 3GGWA 4ZXBB 4PRHE 4F33A 2HFEA 4S10A 3H3KA 4F9LC 1K8DB 3GM0A 4NRYA 5DVOA 1T22B 3UTTE 4JPIB 4O4YL 1OGAD 2ZUVA 4M7LH 5EDXA 5GRJH 1J1XL 1RZKH 4EUPA 4PJ8C 2DQUH 2F53E 3QWRA 1I7RA 4NJAL 1MY7A 1BFVL 5MERB 1J0YA 3BGMA 1BWWA 3QRGH 4G8GB 1UACL 5MEOA 4FQJL 4OGZA 2Y6SC 3SJVE 5F9WC 1J8HB 3CPLA 2EIZA 3FO9A 4PR5A 1T0PB 5KVEL 1DQJB 1AIFA 5C07A 3C6LC 3VXRE 1UB5B 4Y8DC 1RIHL 2R4RL 3L9RB 3O11B 3ZDXE 4PV8A 1O5DT 3QEUB 1U8IB 3H6JA 4ONGH 4P59L 2W9LA 5IB5B 2Y1VA 4RRPA 3RIFF 4Q6IB 3BZFB 1FL5A 1FRGL 5CILL 4H1LB 1KBGH 3HPJA 1QRKA 5CJXA 4NO0B 5C0EA 3VMOA 4LLYB 5CIPB 1KSRA 4BQ6A 1UM6L 4EDXB 3ETBF 2FJHA 1BZQK 4LSSL 2DIBA 5IMOA 4GG6E 3PGFL 1RUQL 2QHRH 3BESR 1QNZH 2ESVD 4Y16A 5CZXD 1ZHLB 3WDIA 3MRCB 2ERJB 1CGSH 4BK5A 4OSUH 1AGDB 3DVFA 3C9NB 3QDJA 1H5BA 1G9NL 2GITB 1NFDB 4KQ4L 2ADGB 5I8EB 4L1HA 4YDLC 5DK2A 3ZSSA 1RJZB 3RPKA 4RAVA 4EIGB 3O3BA 3TPUA 5E2TL 3VWKA 3GIZH 4P5MA 4PTTB 2D7TL 2F54B 3MREA 3IJHA 3CUPA 3MNVA 5IBTH 1J0ZA 1Q94B 2CIKB 1WEJL 1B4JH 1G7PB 1S7SA 3CFEA 5MEND 1NSNL 2QL1A 5J11C 3RWJB 4JHZA 5JHDB 3HB3C 4PGBB 5LGHH 5T3ZL 4FABL 3WMSA 1ZT4A 4XNQA 5D7JD 1MIEL 5GGSA 1KB9K 3TNNB 3VXOA 1UA6L 5DFTA 4OZ4A 4WCYH 5DMIH 4Y4KD 4JRYD 5DJZB 3BPNC 3N50A 2A6DB 1N5YL 3IDJA 1NUGA 5I1DB 3P0YL 4JVUA 4YFEA 1MFEH 4G6JL 3NIDE 4YHPB 5EOQH 4XI5D 5KVDH 1DBAL 3QJHA 2YRPA 2J5LB 2VC2H 3ARRA 1UM5L 4U1GB 3O4LE 5L2JA 2KKQA 2E9WA 3G6DH 1XCTB 1AKJA 3O9WD 2D03H 4PJ5A 3PABA 2BP3A 5T3XD 3L5WB 4V1DB 4M7LT 3F6LA 1SY6H 4QCIB 4QY8B 2Q76B 4XI5C 4HBCL 4M6OL 4ELMB 4F37F 4KVCH 1R5VA 5CBEB 1KT2B 2NX5A 3HAEG 5TH2A 1TENA 5F9JA 4G7VH 3QG6A 4ZPTA 5I1AA 3T1FB 3DETD 2IQ9L 3LSOA 1F42A 1SQ2N 1RY7B 3DGCR 2DI7A 3QIBD 5CZVL 3I75A 4KVNL 3VGDA 5ADOH 3ZYJA 3FQUA 4PLJC 4D9RE 3DXAB 1N4XH 5SWZE 3DV6B 5GQBA 2XQBL 1NKRA 2IH1B 2YD2A 3V4UH 2VXUH 3IETA 3BD4A 1ZLUH 2VOTA 4NCC2 1JV5A 2AS5M 4ONFH 5IVXE 2WBJD 4IJ3C 4R97C 1FGVH 2XZZA 4RQQB 4D2NA 3DETC 3UO1H 1RURL 1A7RH 1F3DH 3THMH 3NN8B 2YPLE 3P73B 4GXVH 3KPOA 3WFBH 2BNRD 4DN3H 4N90D 1MWAB 3W5MA 1Y0LA 2DB8A 5E8NA 1DBBL 12E8L 4TUOA 2R2CA 3UC0H 1RVFL 4Z0BH 1MJ8H 2WBJC 4CL7A 2GUOA 2E9IA 5A16B 1L0YA 5DC0A 5ADPL 4NT6A 4BK4A 3R0MA 2HFTA 1PVHA 1QR1A 3G6JF 1J1OL 1WWCA 3P9LA 4MA8H 5BZDB 3JWNC 4X7SL 3P9MA 4LLDB 3JTSA 2OR8A 5B21A 2VABB 4D9QE 3GSUB 1BPVA 1J11A 3S4SA 1OLZA 2AV7B 3RX7A 4MLIA 1RQ5A 2X4UB 4DAGH 4QT5B 3VXMB 4F8TA 4QHLA 5A2IH 3MNZA 3B43A 3D48R 2LVEA 3SGKC 1MHHA 1ADQH 2Y36L 2JCCF 8CGTA 1JYWA 4XCEA 3GB7B 3ULUL 1C5CH 3T0AA 4PRBA 2Y06L 4UT7H 3ULSB 2PYFB 1F4XL 2NTSP 4LDLB 1OP3K 2EE2A 2R2BB 1QRNA 3D39B 2GSIA 1UUSA 3TH4T 1AO7E 2EKJA 2AVGA 2DYPD 4GRWH 4X98B 3EFFA 4LIQH 4PJ7B 2DICA 4X5WA 2WBKA 3UMTA 1YECL 5T3ZD 1Q9KA 3E3QE 4ZFZB 1S3KH 1FYTA 1I3GH 3CZFB 1JPGB 2ICWA 4KAQH 3QCUH 3M8OL 4RNRA 4YEFA 3BH9A 1VPOL 3IFOA 4OV5A 2Z4QA 2O61B 3FB5B 5F71A 1U8PA 4PLKD 4MCZA 3B9KA 2ZSVB 5J89A 5C0BA 1MRDH 1YEJL 1S9KC 3RVWD 4ERSL 2VXSL 4R0LA 1ZOXA 4MNGE 4P9HL 3SKOB 3OZ9L 1K4CB 2B2XH 4UOJA 4P2QA 1TNNA 4DOHE 1CD1A 4FP8L 2FGZA 1I9JL 2ED9A 2DJSA 1PBYA 5TF0A 3V5KB 4A6YH 5CJ8A 2GK0B 1R3LA 2FX9L 3INUH 2PO6A 1A7NH 1MI5B 3TWCL 3CFDB 5HHVL 5JXAH 3N1MC 4OCWH 3O8XD 2EZ0D 5L2KA 4OM0H 5IBUB 2ICWJ 1HSAB 5F7LB 3VXSE 4LSTH 1QD0A 3V8CA 1P4BH 1CD8A 1SM3H 1RUAH 2OTWB 2HTLC 1B0RA 1OM3H 1WZKA 4Q97A 2OSLA 1KIQB 3DTXB 2AXGB 5HPMB 1YNKL 4K94H 2W9EL 1IKFH 3KPNB 2FO4A 4DCQA 2LAGB 4OBSA 5MHSD 4XNXL 3OSKA 2J4WL 4U1SB 5H35A 1RK0B 5TQ0L 1D5IL 4D3CL 3NZHH 4NNXA 4X7CC 4P46D 1A6ZA 2VITA 3AU1A 2DTML 2YMXH 1ORSB 2YPVL 4P4KB 3A6BH 4X8XA 5E9DB 2A74A 1T04A 1ES0B 4NQDE 1MCWM 3DIFB 4LSQH 2EC8A 3DX7A 5EZJB 1JGVL 3FO2B 3RGVB 3IB4A 3K4DA 4XRCA 3EYVA 4FQ2L 4I13B 1GOFA 2XTLA 1YPZA 4R9HA 3I9GL 3MA7B 4UNUA 2NW3A 3QR2A 4DUVA 3HE6D 5TE7L 1QBBA 4QXUL 3PV7A 4X6BA 4PJXA 4OZIB 3MUZ1 2UVFA 2VZTA 3FO1B 5I1LA 1NLBH 4I2XE 4CN4A 2VLME 1NEZA 4TVPH 1T03H 5DWUL 3DI2B 3MV8D 1C5DA 1YEGH 1XF2A 1V8HA 3KLSA 4P3CL 5DI8B 3FQRB 1HHJB 1UZ8A 5CKAA 4JFPB 4XVSL 1T20A 3JWOC 3LEVL 3LY6A 3LKQB 1N6UA 5A2LH 4XC3L 3G08A 1T66C 4GW4A 4OZHA 4HV8B 1FBIL 5GS1C 1KTLB 1I8IA 4X7TA 3BX7C 3T3ME 5FHAL 1GC1L 3KR3L 2AJUH 3CSPA 3NFNA 3E6HA 1EVUA 2AK4B 3RFZC 5HI4C 3LIZL 2HVJA 3SCMB 5HHPA 4DK3A 3FFCA 1A9BB 1CL7L 4PG9A 3UPRB 2CDFB 2IANB 4PY8J 5IQ9B 3FRPA 4WGVB 2EDHA 3VFPA 5EN2B 3U0WL 4QHNA 3TF7C 1UWEH 4JM2D 1BQUA 4XPFL 4YNYA 5HVHB 2VXQH 3VXTA 1E28A 2PW2B 2BSRA 5IHUH 4LNVA 1I75A 3I6GA 5IMLA 5F9AC 4H25B 1D9KD 3T4AB 3KPQA 5IW6B 4UBDD 6FABL 2D7PA 1Q9LA 3SKNB 2EE3A 2ZOLB 4RZCB 1G1CA 1S5IH 3NACH 5AUMA 3HTLX 1G7LA 3QUXB 3Q3GB 4POZD 4PJGE 5FA4B 5JMRA 5BRZD 1D9KC 3QEQD 2BRRL 1VGKA 4QKXB 3VXPB 4J4PD 5TE4H 3QBTB 3GK8L 4MX7B 5BMFL 4ZPVA 1QOKA 1QSEB 2NXZD 4JZNB 1NLDL 3MCKA 1X4YA 3BW9B 5TF1H 5AEAA 4JY5H 4N8VB 5AYUL 4CVUA 2VLJD 4Y5VB 4POZC 5E8EA 1A6VH 1DFBL 1TCRA 4U3CA 3S5LB 5HYJA 3X13B 1A3RH 5B3NA 2F74A 2WK2A 2OQJB 2H26B 2N56A 2UZXB 4OCXL 1F3JA 4UV4H 4EN3B 4OD1H 3GJEB 4J4PC 2XWTB 3D0VA 2WWMD 5AWNL 5FCSH 5CEZE 4X6CA 2V9QA 1TQCB 1H0DB 5DJXA 2APBA 2XZAH 5KOVC 1X3DA 1IVLA 1LK2B 2BVPB 2HT3D 2ZUSA 5HYSB 1AI1H 1Q0XH 3EJJX 1NC4D 3H9SA 5IB3A 5DHVB 1JZ3A 1SJXA 1Y6NR 1GOHA 2I07B 1N5AB 5CUSH 1S7WB 2X89D 4OD3H 1T3FA 3MRLB 4KJQC 1CL7I 5ELIA 4L3ED 4TQEH 2DMKA 5H2BB 3E8UH 5DD5H 1NPUA 4PJEA 3QUMH 2Z93B 4U1NB 2VZ1A 2HT3C 4AY0A 3B8YA 3PHSA 1QLEL 2UZIL 4ENEC 1ZGLB 1AQDB 1DBMH 4QTHA 4N8CL 1DLFH 3VGAC 4OLYL 5F93C 3BKCH 4UUJB 5BV7L 2WNGA 3ULVE 3K74B 5E6YA 2NY2D 2NY6B 1FNAA 1OGAE 5CP7A 4QRPD 1HHHA 5F8RC 3CFKA 1IC4H 1DSFH 3ARPA 4J3VA 3PP4L 3L95A 2HG5A 2ZCHL 5EU6D 4TNWF 4P5TA 5GGRA 4R4BA 3ZSTA 1MFAH 1FDLH 2EH7H 5HHXL 1VFMA 1LO0L 3BYYA 4OI7A 2NY2C 4M7KH 4QO1A 3U46B 2B20A 5C09D 2W59A 2W0PA 3SDCB 3GBMH 4PJ9A 2VIRA 4KMTL 3TYGL 1IFHH 2AJ3A 4JQXA 1E4KC 1Q0YL 3VWJB 2DM7A 5HHOB 3MV9A 2UV3A 1CE6A 4KUZH 4UOW0 5INCB 1CQYA 4JKWA 4H1LH 2ZNWA 3ILQC 3KNBB 2ZOKB 4HKXA 3QFDA 1JWMA 4HZLB 3RUGE 4G42A 1LK3H 3KPMB 1I7UA 2Y4SA 1X5ZA 3T0EC 3U83A 5L8JB 1IGJA 2ESVE 1LEIB 3JSSA 1EHNA 2XN9A 2HKFL 4MAYD 3PF2A 3FAXA 4XCNB 3SGJA 1AFVH 4RMRA 4WUKL 3VD9A 4RFOL 5DEGB 4P2RB 1CI5A 3T0VA 5K59F 1SHMA 5BW7C 3QJFA 5DJ0A 5EU5A 2D0HA 1CFSA 3QI9D 1SY6A 2Q3AA 3WS3A 3T4YB 4F7MB 1FZMA 1XAUA 1MSPA 2X1PA 3SY0B 3QP3A 4KXZI 4Q9CA 2JIXB 2IWGA 2WUBH 3AXLB 4JFFB 5T5FL 5IWLC 3ARGA 4MAYC 3OB8A 1J0IA 1BBDH 2PYEA 2QQLH 1EA9C 3HE7A 5MENE 3IDIB 4Y5YC 3BT2L 1P7QA 3S35L 5KVGL 5DRXB 4G3YH 1FVDB 1OSPH 4XPGH 5IMKB 1UZ6F 4KY1H 4NQCB 4AG4L 15C8L 1ZANH 3C5SA 5LWYL 2EDBA 4NQTA 5JOFA 5D4QA 4PRPD 4I48B 2VDPH 4FFZL 3O6FA 1G7JA 3PDGA 3U2SA 4JRYE 2E7LC 5B4MD 4PP1D 3RX5A 4H0GA 3MGTB 2XY2A 1YQVH 5E03A 1HK6A 1JPFA 1IGIH 2CLZB 1NDGB 5KS9A 4N0UA 3S35X 1QQDB 1INQA 1PG7X 3A0OA 4CBPA 4K8RL 4QXTA 3CMOH 4PGJA 4R8WH 3MMEA 4XVUC 4ZUTA 5DFVD 1FO0H 3QNXB 2YRZA 2PXYD 3FQWA 5INDA 1E6JH 1CIDA 3MJ8B 5B4MC 2DIAA 4NM4H 2EDRA 3GIVB 4IRSB 4FN0A 1BJ1J 3OR7A 5HPOA 1WT5C 2G9HB 3QEHA 1RZKL 4MLSA 5EZLB 4NQSA 2DQUL 1FAKT 5C0JA 1JFQH 3ARQA 5DFVC 4IM8A 3NCFB 3QRGL 2XPGB 2CGRH 3P3YA 4QYOB 1OTTD 5JLZA 5FO9B 3HZYA 3BH8A 3DMMB 1FN4B 4WIQA 1ZVSB 2CLRA 5D1ZD 4S2SA 4F9PA 4P2OA 3TZVD 2LQRA 3LEXB 5J1TC 1DQQB 3GSOA 3OL2A 4NO3A 2VLLB 1G9MH 5I19L 5GS2H 4ONGL 2EIDA 1H3PH 2IMMA 3RWEA 1OTTC 1KBGL 3CU7A 3CC5B 3QNYA 1FV1A 3K1DA 2EKSA 4NQXA 5F1OB 5D1ZC 1P2CB 2F5BH 5IB1A 1MWAH 2BNRE 4MAUH 5FO8B 4N90E 1QNZL 4U3XA 3RIAK 3TO4A 2P5WD 1CGSL 2ZJSH 2XV6B 4OSUL 4JRXB 4S1DD 4O5LH 5FKAB 1QSVA 4Q6YA 1A64A 1JUFB 3N06B 2PCPB 5DJAA 2YC1B 5ICZB 5E8OB 3BXNA 2NLJA 2QKIA 5L8LB 4G6FB 1T1WB 1MJ7H 3LRGA 3GIZL 2XIDA 4U1MB 1ND0A 5IBTL 2B1HH 5CKGA 2XACC 4HD9A 1B4JL 2NY7H 4QEGA 2YWZA 4LLQA 2MSPA 5J06A 3ZKMD 5LGHL 3KYNB 4P57A 3TBVA 2ARJA 3CXDH 2M8XA 3OJMB 1NQBA 1EFXB 5SWSA 2QHLA 3VG0H 3MRBA 2VH5L 3UTSA 2W92A 4WCYL 3G6JB 5DMIL 4G80B 4G8EA 5EH1A 1FJ1B 3T0DA 3NPSC 1FVCB 5BOPA 1MFEL 1M6OB 3O4OC 5EOQL 5KAQF 5F3HA 1U8OA 5DD1H 5KVDL 3FCTB 3RAJH 3MRFB 2VC2L 5JW4M 2NY3D 1I1AD 1D6VH 4QHKJ 2F9BT 3G6DL 1SYSA 4EI5B 1I4FA 3KJ4C 1ZK9A 2JCCB 2D03L 2VXTH 1F4AA 3QUZD 1L6XA 3EOAB 4DFIA 3X14B 5EBGA 1WIUA 4LPVA 5T3ZE 1R5WB 1SY6L 1LEKA 1MFNA 4GQPH 1RSFA 1W0VB 2EDDA 1NDMA 3MGAA 2GFBA 4KVCL 1J0JA 3WDHA 3IT8D 1LE5A 3MROB 3SE4C 4RMQA 1L7TH 1IQDB 3BUYA 4JAMB 4G5ZL 5DFWH 4M1DH 1P9MC 4G7VL 1ED3B 3FZUD 4KU1A 3VXUA 2IBZX 3VDAA 5DS8A 4PJFB 4K8RD 1RZIB 3MOBH 4LCCC 1ZWIB 2JJWA 5ADOL 4DQOH 2H41A 3FL7A 5ITBH 4UT9H 1N4XL 1S7UA 4JJ5B 5FK9B 5TE6H 2P44B 5EIVA 2NTFB 4JN1L 3V4UL 1J05A 2VXUL 4FTVB 2X2YA 1WC7A 3P11L 4GW1A 4ONFL 4BA8A 1FGVL 1LO4H 1S9WA 3W0WD 2Q6WB 3UO1L 2CLVA 3AREC 2QSTA 1C12A 1KB5B 1A7RL 1OSZA 3ARYA 4NRXB 4NDMB 4GXUN 4GXVL 3WFBL 4NJ9H 3WEXB 1CLYH 4DN3L 3HMWH 3T09A 1VERA 5KW9H 2ZKHH 4PJAE 4Z0BL 1MJ8L 1T83A 3KXFD 5B38G 1CT8A 1A2YA 4MNHB 3MCG1 1PDKA 2P4AB 4ZAKD 5BXFA 2VISA 3O3AB 4X5XB 2R29H 1IZKA 4NQEA 4PB9H 2IJ0C 4MA8L 3HG1B 5ENWA 3E2HB 4GBXC 1OPGH 1ZXQA 5EBWB 4Z7UB 4XBEH 4Q9RH 3L7FB 3OAZH 4XWOD 4HC1A 5D1XD 5FGCE 2EDWA 4OJFH 3FB8A 4DAGL 4MA3A 5DYOA 4MQXC 2E9BA 3BWUC 4HUNB 4W70A 4AQOA