1SVIA

Crystal structure of the gtp-binding protein ysxc complexed with gdp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
195
structure length
182
Chain Sequence
MKVTKSEIVISAVKPEQYPEGGLPEIALAGRSNVGKSSFINSLINRQTLNFYIINDELHFVDVPGYGFAKVSKSEREAWGRMIETYITTREELKAVVQIVDLRHAPSNDDVQMYEFLKYYGIPVIVIATKADKIPKGKWDKHAKVVRQTLNIDPEDELILFSSETKKGKDEAWGAIKKMINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the Open and Closed Conformations of the GTP-binding Protein YsxC from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords GTP-binding protein YSXC
total genus 61
structure length 182
sequence length 195
ec nomenclature
pdb deposition date 2004-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1sviA00
2FGKA 5D3MB 4BRUA 1G20E 3RWMB 5HR5A 2WKRA 1AZTA 2D62A 2RAPA 3A1UA 3CX7A 4EFLA 3IIJA 3KQUA 4RD1A 2OCYC 3H86A 2H92A 4PPQA 2W58A 4LJ9A 2PX3A 3PV0A 2ZJAA 3GCGA 2QG6A 2Q3HA 3TKLA 1E9EA 1CR2A 1VKJA 1CS4C 1E9CA 4DDVA 1VCNA 4TMVA 5FL7A 3V4FA 4A9AA 5CB6A 4KCGA 4UJ3A 1ZBDA 1XTSA 3X1YA 4R98A 4IXMA 3ADBA 3I5YA 4QFMA 1MO5A 3WRXC 1GOTA 4L9SA 2GCNA 3AGQA 5H1YA 1KSHA 1CRQA 1GP2A 3MWJA 4JIMA 4URWR 4WVFA 5P21A 3TRFA 1W0JD 2FMXA 1JNYA 5IF9A 4RD2A 4Z8XA 2JLQA 2NZ8A 1G8YA 2HLDA 3K09A 1MO6A 3BC1A 3QY0A 2J1LA 2W2XA 1DVRA 3CPJB 4LC1A 4CZ2A 4DLYA 3K70C 1N3BA 2YC2C 4V03A 1F60A 1E69A 3NH9A 4ARZA 4JLNA 4DCNA 1XX6A 4PZZA 3THWB 3JZMA 2ZUDA 3BE4A 4DLZA 1YZNA 2GF0A 5FBQB 3QPUA 2RGXA 4HB0A 1GNPA 1G3MA 1C9KA 2BBWA 4MGYR 1N6OA 2GCOB 1SVWA 5A0FA 1AKEA 4NYMQ 4Q18A 4AKHA 3GLFB 3FPAA 4B33A 3TVTA 5G41A 1J7KA 4X8LA 4LYHA 2EWWA 4BWYA 4ZCIA 1TUIA 1LB1B 4C2TA 1M6NA 5L3SB 4OI0A 5TB5A 1E2NA 1SVMA 4P4TA 3W3ZB 1Q44A 1Q3TA 2QPAA 3EZ6A 3PUWA 2F9LA 2GRJA 3ZVRA 4KFSA 4Q4AA 5JJLA 4D81A 5FTJA 5CLLA 1WRBA 3ZZUA 1E9AA 4PC7A 4UXHA 1G4UR 2YKGA 4DDUA 4GBMA 2DB3A 1G7SA 1KJYA 3M4YA 5CJPA 5EXPA 5FR2A 4ZDKA 2ATVA 5DN6A 1RZ3A 1E9SA 5F9HA 2Z43A 3GLFE 2XTZA 4LSGA 1N6PA 5DI3A 2VQSA 4US2R 1YZGA 1H8HD 3PENA 4LBYA 2WKPA 3CO5A 4B6EA 3LXXA 2FF7A 3GLHE 5FTMA 4ASUA 4C0HA 1JPNA 1TQ6A 1S1MA 5JHHB 4B43A 2QL6A 4ZIRB 5FPHA 1HQCA 4DLUA 3AVUA 3NBYC 5BXQC 2B8WA 1DG3A 3GFPA 2WAYA 1YR9A 1YU9A 1MABB 2J5XA 2REOA 4PPGA 2V7QA 1EGAA 3C5HA 5FI0B 1B0UA 1U0JA 5JSZB 4EPRA 3QG5A 3HPRA 4Q00A 1EWQA 3KKMA 3AF1A 4M4SA 3PUYA 4KHZA 4NYIQ 2GK7A 2W2TA 3UMSA 4QOSA 2IYWA 2V7QD 3GJ8A 1PJRA 5EUMA 1Z6XA 3LO5A 1XWIA 2W6IA 2GK6A 3BFXA 4FWIB 1E2KA 1DG1G 3U60B 1O3YA 5CJ2A 5L8VA 1TQ4A 1VCMA 1UJ2A 1P9WA 3TH5A 3QBTA 1E9RA 4PC1A 1RRGA 3WHKA 4IKEA 2GILA 2OBMA 2BVNA 5AJVB 1WXQA 2CHGA 3L0OA 3MGCA 2EU8A 1Z2AA 3AM1A 2WZQA 3Q85A 4M1KA 1ZNXA 3LDAA 2JLYA 3E70C 5JEEA 3CUEF 2DBYA 4Q9IA 3NTUA 1JXOA 1KI8A 1TUEA 1N2CE 4I4LA 3IHWA 4QM6A 2PLFA 5DYGA 1IHUA 1KI7A 1E1RA 3ZH9B 4E03A 2NO1A 4IEIA 1H8EA 2CJWB 4HLUA 3P27A 4QBIA 1T4GA 4RVCA 1G291 1N6KA 2R6FA 3QKSA 3B82A 1Z22A 4NYIR 2ZYVX 3BH7A 1PV4A 1FQKA 1KYIA 3VX4A 4DHEA 4CEJB 3W6OA 1E6CA 1WQ1R 4ZIRA 4N3NA 4RKEA 1XTRA 3VFDA 2O8BB 2F7SA 2SHKA 5H68A 3ASYA 4IOMA 1EK0A 3AQ4A 4PSAA 3BFVA 1GM5A 1KI6B 3PJRA 4OHWA 3CNNA 4BE7B 2ZEJA 4EPTA 4GOKA 2V1XA 4LBZA 3RS5A 4Q48A 5DE3A 3KFVA 4A2QA 2ZPTX 3OE7A 2CCJA 1NN1A 1YHNA 3Q7QA 4TLEA 4PC3A 4KLNA 4AD8A 4LHYA 2JJ2A 3TE6A 3LQRA 2OM2A 2ZRLA 3R9IA 4U7DA 2YWGA 1WB9A 1NKSA 2GAAA 2ZS9A 2P65A 3GLGB 1TNDA 1Z29A 3U4QA 2RGDA 2UVQA 3RS7A 1TQ2A 2FX3A 2AN9A 5IDVA 4MA4A 2VO1A 1W36C 2XJ9A 2C03A 2DHRA 4DIEA 4ZCMA 3FVQA 4D0GA 2ZJ5A 1G8FA 1HA3A 1R8QA 2A5JA 2C9CA 1E9BA 4JZKA 1UBCA 1AK2A 4TL6A 2ZRIA 4Q66C 3NH6A 4QNRA 4PXAA 1KSFX 3LLMA 4MRSA 3GEHA 2VEDA 521PA 1W2GA 2P67A 2YVUA 3I62A 5KNDA 1D8TA 4JLVA 4HYYA 2BCJQ 5EP3A 1XMSA 5IK2A 3OIYA 2RCNA 1YKSA 2YOGA 4Q4HA 3AUYA 2FOLA 4J0QA 4PO1A 2W6JD 1N5IA 4YMWA 1W47A 2ZSBA 1MRSA 1BKDR 3KTAB 3VR1A 2J0VA 4RCYA 4BZQA 2F43A 3CB4A 4IFEA 1Z3IX 4CEJA 1NN0A 1PLJA 2OG2A 3U7HB 3LBNA 3RRMA 3JVVA 1Q1QA 3CF6R 1COWD 821PA 4BFVA 3LFUA 1XB2A 5DH9A 4ACBA 4HLCA 2A7QA 1CU1A 1GDDA 2D7CA 3GJ4A 1A7JA 3ADCA 4BFSA 2IHBA 2WKQA 3FMFA 4PO9A 3WHLA 3I5XA 4AC9A 2VHJA 4U5XA 1G6OA 1VHLA 1IN6A 4TTQA 2RB4A 1KGDA 3CRW1 1A2KC 4UKDA 3FB4A 1IN8A 2G0NA 4WOPA 2NO7A 5E95A 3AVWA 3C14C 4RD6A 4TMZA 2OXRA 1XEXB 1VHTA 2J41A 4RZUA 3THWA 4Q1CA 2Q9AA 4C30A 1RIFA 4IDQA 2GBLA 4Q1AA 5CYPA 1ZC4A 1R0XA 3IBGA 5DGXA 4B6FA 1SKYB 4KV9A 4V0ME 2YOFA 3SYKA 4C0KA 2GESA 5GJCA 3B6EA 3T34A 2PX0A 1ZD1A 1NI3A 3RRNA 5KUTA 1DS6A 1F2TB 2MSCB 3HU1A 2ZR0A 2FEMA 2EYQA 2WWGA 3QEJA 4MGZR 5FUVA 1DE0A 2N46A 4Q7KA 3PEWA 2XSZA 3VR4A 3Q5DA 5C4GB 2AX4A 4QL3A 3VTKA 1KK1A 3X1WA 2OCBA 4KFTA 1DAMA 2REBA 5FBVB 1GRQA 1DTSA 1KKMA 1M74A 1VG1A 4R71A 3FGNA 4D82A 1JEEA 1RFLA 4DXAA 3D7MA 1XEFA 1JQLB 3FMIA 1W4AA 4OQNA 1OFHA 3I73A 4UQOA 4AYWA 5B57C 3N70A 2RGNC 1YJ5A 1LVGA 3NC0C 4Q21A 4B74A 4V0MA 3BH0A 2ZE8A 1E1QA 2EFHB 3A4MA 4XVRA 3EIEA 4M1SA 1G7TA 1E99A 2ODEA 2ZIAA 3FE2A 2A5YB 4E07A 1T8TA 4HEJA 3A1WA 5HKKD 5EE0A 3PXGA 2W83A 2OZEA 5KPJA 4C7OA 1YZUA 3B5JA 4TTPA 4DUGD 4TLBA 3HR7A 2A30A 4DSOA 3PEVA 5JBQA 4YMSA 2HXSA 3KDSE 1Q1EA 2CCGA 3W6NA 2D2FA 1U94A 1XMJA 2EFGA 3BD9A 2IF2A 3HU2A 2UKDA 1JJ7A 3NEJA 3C16C 4HLUC 4JVSB 2DWQA 1GKUB 1LTQA 2GXUA 4B35A 4LI0A 4EQ6B 3PUXA 1ZNWA 1KI9A 2JLZA 3Q7PA 1YRAA 2GHIA 3H0KA 5J4KA 3B60A 1EFCA 1KNXA 1DO2A 5G3YA 3WP1B 3T06B 4TZ6A 2ZM5A 3AKCA 1VIYA 3ZS8A 1Z0IA 2VSOA 2H1LA 1GSIA 5JHGB 1HY3A 4TYYA 2GAOA 3QF4B 4FI3C 3SZRA 4DT1A 2V1UA 2HDNB 4A6PA 2F1IA 3HYTA 1PUJA 5DLQC 1IXSB 1DAEA 3FHOA 4P32A 1OHHA 1GL9B 2DFKB 3WYGA 3A37A 3A58B 3TR5A 4GI7A 4D2IA 1UBFA 4JLKA 4TTRA 1XJQA 1NNEA 3G82C 4OQFA 2V6IA 3AEZA 2VHTA 4EPYA 2X77A 2ODWA 1AQUA 5LPNA 4JVNA 4URUR 4D4MA 4C2UA 1LFDB 1OHHD 2QEQA 1XPRA 3A1SA 3GQBA 3RNLA 4A0HA 1ZM2A 2BDTA 2ZYTX 3W9YA 1J99A 1M2OB 4K8OA 4MUAA 4NCIA 2VF7A 2IUSA 2WJJA 2IS1A 2NQ2C 4OYHA 3WMEA 3T1QA 3A6PC 1FPMA 1TF7A 4LJ5A 4P4SB 2FDCA 5A4JA 1GVNB 1CJVC 4JS0A 1Q0UA 2OILA 2FV8A 1ESMA 5AWFC 4XD7A 4NPHA 2CHVA 1HH4A 2GXQA 3RS0A 2C99A 3L82B 4JSYA 2ZR7A 1NJGA 2P6NA 2A9KA 4OQLA 2GZAA 2CVFA 3RDPA 2WIBA 1W5TA 2YYZA 1KMHA 1DEKA 2CK3D 3BGWA 3EIQA 2VP4A 1R5OA 4PQFA 1SXJD 1G17A 1JR3A 3AP1A 2GZHA 1PLLA 1Z0DA 5EE1A 4WIAA 2OESA 3A8TA 1NSTA 2P2LA 3PG5A 1NJFA 3FKQA 3PQCA 1DELA 4WBSA 1XTQA 3RLFA 4MQBA 4XVUA 4Z1MD 2EFEB 2BMFA 5FBLB 4GMXA 1TAGA 4FMCF 3GJ6A 5SZKB 3KJEA 4OI4A 3EA5A 1TU3A 2GJSA 2VP0A 4P33A 4DLVA 1E1QD 4F92B 4BLQA 4F7WA 2AK3A 4CT4B 1P9NA 4O0MA 1YZQA 2QAGB 3Q9LA 1OH5A 3X2SA 5G53C 4OHZA 1AS2A 2VRWA 1NMXA 4O2LA 3WYFA 5A5GA 1KO5A 1N0VC 2VP9A 4H9GA 1VYUA 3UXMA 2BOVA 1GWNA 2Q9BA 4MRRA 2YINC 2ZTSA 4B3DA 3QKSB 4V0LA 3DOEA 1CEEA 2O0JA 2HLDD 1VG9B 2CE7A 5DSZA 1NBMD 2J7KA 2IYVA 4G01B 4TLCA 1ZP6A 2QBYB 2D06A 1ZUNB 1K8RA 3MUFA 2WM9B 4KO8A 2OLJA 4PSKA 3PUVA 2ZVQX 4MH0R 1Z83A 1GITA 1A82A 1NKTA 1OXVA 4QG7A 5C46F 2H7VA 2IYLD 1Z5ZA 3I4LA 3LVQE 4QHTA 3GJ5A 1WMSA 5M04A 1I2MA 3U7EB 3TSOA 5HCNA 2XB2A 5CIQA 2ZSEA 4A8JB 5TY0A 4EPXA 221PA 1MO4A 2ZJ8A 2EFDB 1ZNYA 5GJWC 5JRJA 3HP1A 2HT1A 1EFHA 1P2SA 2C5LA 5K8UA 4NYJR 2B92A 2H57A 4HUQB 3CWQA 4NONA 1T5IA 1U90A 1P2UA 4PO8A 4FMCB 1S3SA 2Q0HA 5C4MA 3UIEA 1L7VC 4JL6A 4LZZA 5HTKA 4AYXA 1M1YE 2C8VA 2J45A 1G5TA 2ERYA 4EFNA 2QTHA 1W0KD 4JJZA 4WXPA 4ZV4A 2G83A 1Z6GA 3WMFA 1XMIA 4IOJA 4B47A 1VIAA 1OKKA 4DCSA 4D80A 1H8HA 1U8YA 2QSYA 4QJ3A 3A36A 2AHOA 4HUQA 4YMUA 5JWRA 1FX0B 4H1UA 1F48A 1UF9A 3HDTA 1NBME 4CEHB 1NN5A 4RD0A 2WHXA 4OHYA 1KK3A 2BC9A 3SJBA 5EXXA 3W3AA 4M21A 1RKBA 4G5QA 2BBSA 3C8UA 2OV2A 3DOFA 4W7SA 5CITA 3I8SA 1U2RA 2LKCA 2ZYUX 2P0EA 1CJTC 1JAHA 3UMFA 2J0UA 4DEXA 1IY0A 2FN4A 4EJSA 3TUZC 4JLJA 1KDOA 2YWEA 4XWKA 2AWNA 3Q5EA 1FP6A 1W5SA 2QRZA 4QHSA 4ASUD 1FUUA 4RY2A 3VKHA 2A5GA 3KXLA 4PX9A 4Q7MB 4LJ4A 2FPLA 1LV7A 4EKDA 2CJWA 4UNNA 4AG5A 3LBIA 1E3MA 2QE7A 3P20A 1U81A 3K53A 4JBYA 3W6PA 2QAGC 1T5LA 2TMKA 4OQMA 4Q4HB 3X1DA 1TF5A 4O2RA 4FINA 3S1AB 4W5WA 2ZVPX 3SU8A 3QVUA 2GCOA 2ZI6A 5CK4A 1ELOA 2QP4A 3L0PA 1KTVA 2FSFA 3ADDA 1RW4A 4G5SA 2E9SA 3WNBA 1F2TA 2HJVA 5J4YA 4V0KA 4Q01A 2PBRA 3AF0A 2R6AA 4KSBA 4IHQA 4CEIB 1R10A 3BRWD 2NGRA 2ASEA 2H17A 2KBEA 121PA 3BH6A 3CKLA 1XTJA 2HCBA 5GVSA 5AR1A 2YC4C 3SHWA 5H70A 4DSNA 2BJVA 1NY6A 2VYFA 1S3GA 1PZNA 3UG6A 3FHTA 3BK7A 1VECA 1XD8A 4A92A 4URYR 2V8OA 1P9RA 3U61B 4HZUB 4TYQA 4NDZA 1AIPA 4KITB 2VHQA 3ZD6A 5EJEA 1MR3F 4IOKA 4JVLA 2JCSA 5LD2B 4KVAA 3ND8A 4N0DA 1UADA 5FPTA 5TV2A 2ONKA 2PL3A 2OUKA 5CM8B 4IEEA 3CZPA 1NIJA 1NRJB 5KDOA 2IS2A 1EG7A 4HATA 1AS0A 1P3JA 2WVJA 5DNYB 1ZD9A 2BMDA 2ZI5A 3IO5A 3ONWA 3GLIE 4BLPA 4HB2A 1UAAA 4QBFA 2E1RA 2QGZA 2FH5B 4JL8A 3REGA 2OT3B 5B30A 3R9WA 1T0JB 1G18A 2JJ1A 1ZU4A 4YDSA 3EZ9A 4F4IA 3K0SA 4F91B 1PUIA 3RC8A 2FFBA 3DMNA 4F4JA 4M8NE 2NPIA 4DEYA 5E4FA 2GJ8A 3IDQA 4X8OA 4DJTA 4ILEA 1LF5A 2V54A 2QZ4A 1KAGA 2FGJA 3T61A 3I3SR 3B85A 1QHHB 3K0CC 5L3RA 2D2EA 2ZJ2A 3QXXA 2RHDA 1US8A 1HURA 4HLQB 4LV6A 2ZRPA 1NLZA 2ZE5A 4AIIA 4M9XA 2J0UB 1ESNA 1IN4A 5KPDA 3BB1A 1DAKA 1MRNA 2G1KA 4LPSA 2ZRAA 5JECA 1HYQA 5HE9A 3T12A 3NG1A 1P61B 2BWJA 3QF4A 1HEIA 3GJ7A 2DY1A 4JLAA 4M9SA 2ZQ5A 3R20A 1GNRA 3CZQA 4Q9LA 3WP0A 2RGGA 3I61A 1PLKA 4IFBA 3CLVA 1R0YA 1E2GA 1NVUQ 4TMXA 3IBYA 3L8YA 1ETUA 1Z06A 3HYRA 2O8FA 2ZRCA 3SC3A 1LY1A 2ZE7A 1GAJA 5DIFA 3RC3A 4KBFA 4LYJA 3SE0A 1VG8A 2VP5A 4B2PA 3V00A 2VSFA 1XXHE 3DM9B 3RVBA 1S96A 1M8PA 2ZAMA 2JJ8A 1OFTA 2AWOA 1FMLA 2G3YA 2WJVA 3EARA 2ZREA 3I72A 3L0SA 4P3YA 2ZANA 4LWZA 3UKDA 1KY3A 3LNCA 2BBTA 1KOFA 2PMDA 5JFGA 1AS3A 3MWKA 3U7FB 1E4YA 1WE2A 1IXRC 1EFRA 1IXZA 2G0TA 3HPQA 3L0IB 1QHIA 3AKYA 4TYWA 2CLSA 4RFSB 1T9HA 1KI1A 5JRZA 1JPJA 2Z4RA 2WPDD 3TSWA 1B23P 1NF3A 1G3RA 1NVVQ 3AVVA 3QXSA 2QMUA 1P60A 4G0NA 1OYYA 4BFXA 1MABA 4FMBB 1MOZA 1G3QA 4R9UC 1X1RA 4IJMA 4WZBE 3VNUA 1RJ9B 3KQHA 3GJ0A 2IF0A 5EP2A 1E2LA 5HZKA 2P5TB 3QKUA 4QJ4A 4D4LA 1S9DA 1E9DA 4OJQA 4EPWA 3F0TA 3QXCA 3V4RA 4A0RA 4BUJA 4BZPA 1R2QA 1UDXA 1OH6A 5AUPB 3PEYA 4K81B 4LBVA 3AVXA 3SBDA 1KZGB 1SGWA 1VG0B 2WWWA 1FNMA 2FZLA 3H4MA 3SR0A 4LJYA 2J0SA 1R7RA 4Q7JB 5IHPA 3ETLA 3L2OB 2GEDA 4G1UC 3CW2A 4TWZA 2R2AA 2JLXA 4GT1A 1OIVA 3GLIA 2NIPA 3DO6A 2P6RA 5BYJA 4KVGA 4M9QA 2O0HA 3NBFA 5LD2C 4L16A 2PJZA 1LS1A 4ARZB 4B76A 1G4AE 4G3XA 4B2LA 2CE2X 4AKIA 3FTQA 1N6RA 2XOKD 4G5GA 4TL8A 4QHYA 1Q12A 2NPFA 3VAAA 5FBWB 3WRYC 1XEXA 1KDTA 1NVXQ 1P4SA 1D6JA 3CF2A 1RYFA 2ZAOA 5EE9A 3KUDA 3SI7A 3SFVA 3GLFA 4BLSA 3LW8A 5ANRB 2AXPA 4LOAA 1NMYA 2GF9A 3NKVA 4FCVA 4KYUA 3TBKA 1OT3A 4Y0AA 3OIUA 1BIFA 1T91A 2RGAA 2F9MA 1D2MA 3J81k 1G3IA 1P7CA 3RWOA 3BWDD 1D2NA 1HE8B 1XD9A 3AF2A 2FJUA 5CM9C 2J3EA 1GRRA 5CK5A 3ZZTA 1T6NA 2Y8EA 4TT3D 3W5JA 1P2TA 2ZROA 4PPNA 4QBGB 1Q20A 5KYKA 1CF4A 3AV0B 1I4TD 3VX3A 1XF9A 2F43B 4MKHA 3GJXC 4LJ8A 1K5DA 2CNWD 4Q03A 3VNVA 1XCGB 4C3ZA 4GP7A 2J0QA 4BRWA 1D2EA 2AKAB 4LBWA 2VF8A 2AD5A 5L3SA 5AUNB 2OEPA 1SVSA 3KX2A 1KZ7B 3HU3A 5FPKA 3T1OA 3K0CA 3SHFA 3B1ZA 2GBLC 4W9MC 3ZVNA 4MRNA 2PMKA 4B44A 5FPSA 5CDFE 2CLCX 1WF3A 3A4NA 1KNQA 2RH5A 3EZFA 2VIIA 3MMPA 4IDPA 5FBRB 4URXR 3KQLA 1MT0A 2FSGA 5B64A 5J4LA 2ZYWX 2IS4A 4D4JA 5SZHB 4NBSA 4DLTA 4D4KA 2KJQA 3AB3A 3EPLA 5BWMA 1Y63A 2F3TA 4US1R 4MYUA 2HCJB 5FOUA 2E87A 1S0UA 3OEEA 1HT2E 1Z8FA 2DPXA 2B21A 2ZI7A 3EWAA 3AUXA 3GMTA 4GMDA 4DCTA 3VR2A 1E2EA 2QAJA 1G5RA 3QXHA 1Z6YA 2V4ZA 2BCGY 2GA8A 2G88A 3WBKA 5L3QA 4MKIA 1UKVY 4PHTA 3RS4A 4JKYA 2LKDA 3Q72A 2FPKA 5DI9A 4M53A 1OH7A 1IY2A 4JMPA 4DKXA 3QOFA 1AGPA 3E5HA 4K46A 3OEHD 5KDLA 4Q1BA 5AJWA 3QUSA 5F98A 4ON9A 2BV3A 4URZR 4Q9KA 3AP3A 1XEWY 5JS8A 2C77A 3DZ8A 3NHBA 4JLBA 4QGGA 3OAAD 1JB1A 2OE2A 3C41J 3D31A 4EPVA 1E96A 3MSXA 2ZUCA 2CHQA 4NMMA 3OEHA 3VHLB 2VH5R 1FNNA 4MDEA 3F5FA 1AKYA 3RSLA 3UWOA 2ZRGA 3NBXX 1CR1A 1FTSA 4UXJA 4HDQB 4I1OA 1X8KA 4RFVA 1EX7A 2BEJA 2WV9A 5KTYA 1HUQA 3ZYCA 4A8JC 4PTLA 2O52A 2IWRA 2WWFA 1G7RA 1RVDA 4JSTA 1L4UA 2KWIA 5C18A 4L5BA 1EXMA 1OLOA 4BQSA 4BLTA 2RGEA 4MRVA 1KJZA 4NH0A 4BZXA 2CK3A 3B1VA 3N2EA 1QHXA 4TL9A 6Q21A 1UKEA 1I2DA 1XD2B 3P32A 2W0MA 2HXYA 4LHVA 4R2HA 1GL7A 2WWYA 1IM2A 3C4JA 1P6XA 5LBIA 1TADA 3A1TA 4RD3A 4XTRA 1SVOA 5L3VA 1M34E 3QE0A 1YR8A 1VYVA 1E2IA 5E3HA 1RRCA 3AVOA 4D6PA 3QIAA 2R6DA 2QA5A 4LHZA 3FFBA 3OHMA 5K8LA 1ONBA 3KJHA 3VKGA 2QAGA 1ZRHA 1NIPA 2BKUA 3LW7A 4TMWA 3TVDA 4ESHA 3DPUA 4RZXA 1IBRA 4EDHA 2B7CA 4QXAA 2AKYA 1W0JA 1KDRA 3LRPA 3PITA 1ZU5A 2WAXA 1Z6AA 4MRPA 3FKSA 2ONJA 4G5OA 3DMDA 4I81A 2PJRA 4BPBA 3KQNA 3IO3A 3SFZA 1WCV1 5JLJA 1V43A 1KO1A 4L8GA 1CJUC 2GJ9A 3VHXA 4JKIA 4Q5IA 4YMTA 4A2PA 3B9PA 3K9LA 3ADKA 1ZCAA 1QVAA 4GZMA 4L4UA 1X6VA 1NN3A 2ZRJA 4A0FA 1X86B 4DDWA 4C0SA 1D9ZA 2RHMA 4PR0A 4TQAA 4I99A 3F3YA 3VMFA 3RRYA 4W5HA 4HSEA 2QU8A 2BIFA 1TF2A 1JALA 3GLHA 5KDDA 3THXB 4ZDJA 5KNBA 2WOJA 3QPWA 3WNDA 3MCAA 2WJYA 2GEUA 4DCVA 2IYTA 4HB4A 1QHYA 3TGPA 3BXZA 2DCUA 1IJEA 1OPXA 4R2IA 5JCPA 3DDCA 4HDOB 1P72A 2ZJOA 4NZYA 1IN5A 3UATA 2CL0X 2J59A 1OFUX 2GJKA 4DSUA 2AXNA 3AVQA 2JATA 1GIAA 2CLDX 3EXAA 2IW3A 2GJAA 4POAA 2KE5A 1BYIA 3GJ3A 2Z83A 2VBCA 4TLAA 1VTKA 2YJTD 1TTTA 3CRQA 2EQBA 1NLFA 4CVNA 1CP2A 1UKYA 2P3SA 3QNUA 4C0JA 3ZQ6A 2JLUA 2GTPA 2AD1A 2H18A 4QM7A 2HT6A 2QTVB 2JDID 2GVZC 3EA0A 4CF7A 1Q21A 1FTNA 1WA5A 4IVPA 4BEBA 3RAPR 1Q3HA 1W4BA 2G77B 3NWJA 3W8NA 1CRPA 1RRFA 2IEYA 1HQYE 1OXSC 1ZVQA 3LD9A 2QUZA 3NXSA 3P4XA 4OI2A 2JDIA 5HCIA 5TARA 2F55A 1XPUA 2CL6X 3OIVA 1KO4A 2XB4A 4NE2A 3N2IA 3X1ZA 1E32A 1QBKC 1XZPA 2WWXA 3EIHA 3OFND 4LYFA 1KY2A 1N6HA 1KMQA 1OH8A 4QGAA 5EQTA 1KO8A 1II8B 2KSQA 5D3MA 3Q8XB 2XJ4A 4IDNA 5LB2A 3W90A 4EFMA 2WTUA 1XRJA 1KAOA 2WMOB 2H5EA 3CIOA 1G21E 2OO7A 2ZSDA 3OFNA 4MITA 4HDCA 4JT4A 3CONA 1IY1A 2CVHA 4PZYA 1QG4A 3VR3A 4D0LB 4GP6A 1G19A 2ZU6A 1R0WA 2MSEB 4Q1FA 3KL4A 2LWIA 3GFOA 3LLUA 3MG9A 4BFZA 4KU4A 2BM1A 3AF3A 2HEIA 4B3XA 2QPOA 3HJNA 3CPHA 2ZITA 4MKFA 3B8HA 5AJZA 3TAHA 2MSDB 4BLRA 1U0HC 1SVKA 4TYNA 1OSNA 4O25A 5FL7D 4YC7A 1E1RD 3BFKA 3K9NA 4LPKA 1UFQA 1ZAKA 4MYHA 3DEFA 8OHMA 3M1IA 2EFCB 4AWXA 5GJBA 1SXJB 4PC2A 4MYCA 4A6XA 4OI1A 2XZLA 2BBOA 2ZE6A 1KIMA 3PR1A 4M1TA 1GG2A 1OE0A 3QQ5A 2YZ2A 1FL9A 1ZIPA 5DYIA 4PPFA 4X8HA 2FWRA 1K6MA 2JIZD 1DBSA 2ZRMA 4I1UA 1I4LD 4XOIA 2I3BA 4QNMA 1OV4A 4RD4A 4CIDA 2IK8A 5GVRA 2CCKA 1U99A 3WNCA 3SN6A 1G9XA 2N1BA 2XEXA 1Z0AA 1ZUHA 2JEOA 1IONA 2RGBA 1QF9A 1SQ5A 1H8ED 2NG1A 3LH5A 1HV8A 1HT1E 4LRWA 4Q4JB 4LYAA 3SYNA 1QHNA 1DADA 1N25A 3CPEA 3O8RA 1US8B 2QY9A 3MLEA 4ITRC 5FTLA 4F93B 1LS6A 2KB0A 2NZJA 3KFXA 4HAVA 2O8FB 4S35A 3MFYA 4FCTA 4EJSC 2B6HA 2QRNA 4US0R 4WA7A 3EZ2A 3WBJA 4ESVA 1U8AA 3SQWA 2FFQA 3H2YA 1OB2A 1JEDA 3IQWA 5JWOA 2DR3A 3AVPA 1P5ZB 1QRAA 3GD7A 3EW9A 4TN1A 1OKKD 3Q3JB 2CMKA 2QSZA 2WJGA 4AK9A 5EP1A 3TQFA 1N5KA 1TEVA 2GWHA 4XJXA 2F1HA 1VCOA 3MWLA 1E2FA 1Q1ZA 2PT5A 1NG1A 1R0ZA 3IEUA 4DUGA 1WBDA 1VYTA 2QBYA 4OL0A 5FPYA 1P62B 3D8BA 4TT3A 4LV8B 4QGFA 4B32A 1R8SA 3EG5A 3SBEA 5B2ZA 2C9YA 4U02A 5JI3E 1IOZA 2W6JA 4IVQA 4LDJA 3W8RA 4DLWA 1ZC3A 4HI0E 2JLRA 4ZO4A 1RC8A 2O0KA 1S2MA 3TQCA 2IYSA 4Q9HA 3EZ7A 4BFWA 1IAQA 2BMJA 2HV8A 4MGKR 5FOWA 2RMKA 2XZPA 3QKRB 2QM8A 2YHSA 3ECCA 4N0EA 4Q1DA 2G9NA 1II0A 1CULC 4OHVA 3B9QA 3EC2A 2XAUA 3CH4B 3K1JA 3KTAA 2JGNA 721PA 4B34A 3G0HA 4CEIA 3PFIA 3SJCA 3I92A 2ORVA 2F1JA 1CBUA 1XJ0A 3QJYA 1HTWA 3U6KA 2W6ID 3T1VA 5JJIA 4UNSA 3LX8A 4FIDA 5UKDA 1RYHA 3THOA 4S2EA 3U3OA 3U2QA 1DOAA 3CRMA 3EX7C 1E0AA 1CXZA 1QHGA 1OXUA 2AK2A 4XSGA 2IXGA 3FOZA 2F3RA 4PAQA 1JBKA 1F3OA 1G5PA 3THXA 2ODNA 3RS2A 4EUNA 4IDHA 2FA9A 3DZDA 2A78A 1U0LA 4MDFA 3GEIA 2QMHA 2QORA 1NSFA 2EVWX 1JECA 1OIXA 1BYUA 1I4DD 1WDTA 4HB3A 1OF1A 1Z0KA 2QI9C 2QQEA 2FNAA 2J7PD 4HZIA 4EJSB 2QP9X 5JCZA 2O5VA 2R6CA 5H8WA 2ODBA 4C0AC 2PEZA 4B71A 4RSGA 5J5CA 1NVVR 2X19A 4DLXA 3LAWA 1OJLA 4LHXA 3EPJA 4II7A 4C7OB 5E7IA 1ZD8A 1CIPA 2PZGA 3MRSA 3ICEA 3M0EA 3CRVA 4WZ6A 1G8PA 1GKIA 2Q21A 5DO9A 3IPXA 5FUWA 1NMZA 1SVIA 4KFRA 2P6UA 4UNPA 3REFA 1W46A 2R9VA 2OHFA 3PIRA 1NP6A 2WBLC 2XSZD 4L15A 4OBEA 1FZQA 4TQUS 2O8EA 1SKYE 1JR3E 2OBNA 1L4YA 3CH5A 4TMKA 4Y0VA 5FUYA 4DVGA 4F4CA 3LX5A 4NU0A 4Z1MA 1GL6A 3ASZA 3C15C 4LJAA 5C2JB 2IHYA 4MYTA 5J4VA 5F9FA 4Q4JA 3BB4A 2ZI4A 4ZPXA 2W00A 5EXSA 3TR0A 1Z47A 5J4HA 4R7ZA 2ZRFA 2VHUA 4A1FA 1Y3AA 5DHAA 2WOOA 4PHGA 5FTNA 1MH1A 4LV5B 5KSYA 4KSCA 2WWHA 2XNDD 2JA1A 4C0QC 4AY2A 2W2VA 4TSFA 3U3MA 3QXJA 1GTVA 1KI2A 2AL7A 3RHFA 4KJZA 4NYMR 2O8EB 3O8DA 1CKEA 2FE4A 1XD2A 5CB8A 2FU5C 1OYWA 1TMKA 2XNDA 1SKQA 4UXIA 4C0BA 4TSFD 2H16A 3ND9A 3O8BA 2HF9A 1KI6A 3T1TA 1E4VA 4B75A 4OK5A 3G5UA 3VU9A 5HKKA 1XMVA 4M2LA 3VR5A 3ICQB 4TZ0A 1E2HA 2HF8A 3FWYA 3M6AA 1FUKA 4JBXA 5TXGA 1SXJE 2FFAA 2XXAB 3CF0A 1E2MA 1NY5A 1U8ZA 2C2HA 1UM8A 1XNJA 4HAZA 5IK2D 1Z08A 2C95A 2EWVA 1G1MA 3B2EA 3K9HA 3THYB 4YDHB 3T15A 2GXSA 3OF5A 2IUUA 1YR6A 1T3LA 3NBZC 4ACAA 4BLOA 2OXCA 5SZIA 3P26A 3TW8B 4D0NA 2CNWA 5JS7A 4LCBA 3P4YA 4PHHA 5FOSA 5FL3A 4E09A 1YRBA 2BEKA 3WYAA 5TDHA 4XSHA 2YWHA 2B7BA 2AR7A 4D26A 4KFUA 1XXHB 2QMEA 3CRRA 2I4IA 4CT5A 4EAQA 2ZRDA 4P31A 1TQDA 5SZJA 1T3SA 4YMVA 3BIFA 1YR7A 3KKPA 4QJ5A 3ZZ0A 4NCNA 2XX3A 2BKEA 4B3BA 1XTIA 3MAAC 1V5WA 2VP6A 2JLWA 2WSSA 4KBGA 1KI4A 3ZJYA 4NL4H 1QZXA 3R8CA 2HUPA 1KSGA 2AFIE 4QC2A 4QGHA 1XEWX 1Z0JA 2XNSA 1Z0FA 3B13B 4PHFA 1GNQA 5LDDC 4CW7A 4Z51A 2WSSD 3B78A 2PT7A 3OESA 4FW9A 3OAAA 4NP6A 2HYIC 1WBBA 3LQQA 1YE8A 2QM7A 3BORA 3ZVMA 1J90A 1UPTA 3QF7A 1XPOA 1XZQA 2C9OA 3SEAA 3TAUA 1GRNA 5JSZA 5BN5A 2DFLA 5AJYA 4OQXA 2PZEA 4DIDA 4RZ2A 5DISB 2ORIA 2PEYA 1JR3D 3FMOB 1AZSC 5BN4A 4A36A 2QP3A 2OCAA 2IWHA 4C4PA 3MD0A 1TX4B 1M7GA 3E2IA 4CDGA 4IDOA 3GLIB 4TLDA 3FDIA 4PQYA 3U44A 1EFUA 5IT5A 2IC5A 4I1SA 2GZDA 3HR8A 1IQPA 4XD7D 4A2WA 3AF4A 2QTFA 4W5JA 4FN5A 5EP4A 4AG6A 1U98A 2WMNB 4P4SA 2G6BA 4QRHA 5CDFA 5EUQB 3C7KA 2EYUA 3K09C 1G64A 3UWKA 3TUJC 3K70B 1XTKA 2X1VA 4WW0A 1NG9A 4P4UA 3SDZA 1N5JA 4PC6A 4DC9A 1Z07A 2K5UA 3AKEA 5CIWA 1Z28A 3O8CA 1FQJA 4DCUA 2ECKA 1ZYUA 4RFSA 1ZM3A 2BJWA 5AK0A 1TL7C 4ZKEA 3U44B 4OK6A 3D3QA 4CRWB 2GCPA 4HAXA 4Q47A 1E0KA 1R6BX 2HJGA 2R62A 4ERNA 4ZKDA 3QKTA 1KK2A 4NKRA 1JI0A 5K8TA 1YZKA 2ANBA 1TPZA 3FFAA 4XTCS 4TQ9A 3S1AA 3ZVLA 1UEIA 4NCKA 1Z63A 2D74A 3HWSA 1OIWA 3LVRE 4Q9JA 2VSXA 4ABYA 3R7WA 4U00A 1IJFA 3KZ1E 1MV5A 5BW8A 3UMRA 4LY6A 3GEEA 2IYUA 3IUYA 3GLGA 4B3GA 3NDPA 4KXFB 3PUZA 4NTZA 2ZRHA 2PCLA 2PH1A 4HZUA 4L9WA 1W2HA 2IXEA 1PVOA 4AKGA 1CR4A 3WMGA 2Z4SA 1C1YA 1W1WA 1X8JA 4M1WA 2CBZA 3B1XA 1YVDA 2OBLA 1N0WA 4OHXA 1X8LA 4BGDA 4BEJA 1D5CA 1XCMA 3MWYW 4JYCA 4M0LA 3A1VA 5JWHA 3TJZA 1UEJA 4HAWA 3X1XA 4A0GA 3K70D 3H1TA 3KXKA 1NBMA 5KSOA 1T3HA 3RSOA 1W48A 2XITA 4Q4LA 3QENA 5DHFA 2YOHA 2WJHA 1CLUA 4DB4A 1RJ9A 4BFTA 1CR0A 3BBPA 2ZI9A 3IGFA 4HAYA 1N5LA 4M1OA 3SNHA 2VPPA 1A5TA 1M7BA 1Q22A 1A2BA 2IXFA 3LA6A 5JI2E 3GLGE 3WY9A 4TYPA 4PZLA 1W0KA 4HAUA 2OFXA 2ERXA 1AN0A 3U3KA 3NC1C 5FTKA 3TLXA 2A5DA 2C96A 4B73A 3F8TA 3THYA 4JYBA 3OE7D 5HZHA 1ODFA 2QNRA 1C4OA 1KKLA 3SS8A 3IEVA 1E9FA 1II8A 1S4QA 1S9HA 4LK2A 1BH2A 3CBQA 4GZLA 4D25A 4JT2A 4G5RA 5DN6D 5F2EA 2LCFA 1G3UA 3KUCA 1XFAA 3MJRA 1NVWQ 2A3RA 1JJVA 2I1QA 4B3FX 4Q4AB 2ZXUA 3VU9B 4IVRA 3OZXA 3BERA 2OSBA 1M7HA 4PANA 1U9IA 5DI3B 2X2EA 3QBVA 1GUAA 4ZCLA 3VR6A 1LF0A 4BFUA 3ZIAA 1OB5A 2WWIA 2MMCA 3L8ZA 4CEHA 3LWNA 1J70A 3GFTA 2J9RA 2R65A 3PVSA 4O3MA 1OXXK 4JL5A 2IUTA 2V9PA 2GEVA 3LY5A 1KHTA 3K8YA 4Q1EA 4AURA 5AUOB 4E22A 1CTQA 1EX6A 1RRPA 2IYRA 1F2UA 2D3WA 4Q19A 4DBLC 2FPMA 3BS4A 2I1VB 3E1SA 2Q3MA 1SHKA 4PFSA 2RKOA 4YQFA 1E98A 3GP8A 3CX6A 2R6GA 3RRZA 3B7GA 1FW6A 1G6HA 1JAIA 2Z6VA 4LX0A 4V02A 4V0OA 3CX8A 2DWPA 3EASA 3LBHA 4ZI2A 2CDNA 1T8UA 2FSHA 2JASA 2XTNA 4KYIB 5EZ5A 1VMAA 3BOSA 2P5SA 4OKSA 3DKVA 1QVRA 2VA8A 2QENA 3JZAA 2ZRBA 5EE3A 1P73A 5JEDA 5FOXA 1G8GA 3AKDA 3NEYA 3R7WB 5KO2A 2ZR9A 4KI0A 4GSYA 5EZ6B 2QE7D 1FFHA 4PSVA 5D3QA 2QQ0A 3NIBA 1EFTA 4GL2A 2GETA 2X2FA 1AM4D 4URVR 4GFDA 2W0SA 3EAQA 2GVDC 4IOLA 3TW4A 1J8YF 1CJKC 1VCIA 3EPHA 1TEXA 3FKSD 5LB4A 4B2IA 5KOYA 2JIZA 1J8MF 4LUCA 1BS1A 1OXTA 2ZJZA 3TNFA 3N5CA 2V6JA 1E2PA 1SZPA 3SOPA 4XIGS 3KKOA 5KHOC 1G16A 5TVKA 2F6RA 2J7PA 3SJAA 4UJ5A 3KB1A 1FP7A 4Q7LA 3CR7A 4A4DA 2ATXA 1UKZA 1X1SA 1TU4A 2A2ZA 2WJIA 3U3RA 1LNZA 1H65A 1J2JA 1BMFA 4XWOA 4P0TA 3FMPB 2OFWA 4LHWA 3CWZA 3D6TB 4C0LA 2ZS7A 3R9XA 2QMOA 1E79D 2JJ1D 2QN6A 1W4CA 4JLOA 1CJMA 1KK0A 3IIKA 3IIMA 5EE5B 3V9PA 1BMFD 1F2UB 3QSYA 2JJ2D 2QT1A 4JLMA 2YNMA 1RE0A 1KDPA 4FWTA 2VHCA 2BM0A 4LC0A 2XOKA 5FR1A 5FH9A 2G1JA 1R5BA 3U3JA 4EIWA 1XXHA 2NTYC 1E2QA 4GOXA 1DAGA 3A4LA 2IX3A 2O8CB 1ZJ6A 4Z54A 2RGNA 4BECA 3K9GA 5TMPA 1X3SA 1E0SA 3QEOA 4FCWA 1N0UA 2PZFA 2IL1A 2WICA 2WSMA 1FMJA 3BAFA 3AH8A 1UDWA 4F38A 3BJIC 4LJ7A 4M22A 3EC1A 1DARA 3KJIA 3EWSA 1ZCBA 3DHWC 4AYTA 2UZIR 5KSPA 3ZDQA 4YLGA 3QKRA 3AVTA 3ZIAD 5FFMA 2XXAA 1W4RA 5ELXA 2N42A 4FXPA 1Z6TA 2NO0A 1AGRA 1L2TA 1RPZA 2L0XA 2BHRA 2PCJA 3NDBB 1K5GA 3K0AB 2C04A 1GFIA 2OAP1 3K0FB 421PA 4EQ6A 1E2JA 2EW1A 2NO6A 3TUIC 2OLKA 3GLHB 4GRAA 2FG5A 3MJHA 2VL7A 4AI6A 2IT1A 2C78A 1II9A 4DLSA 5BYKA 2VTKA 2ZUBA 2GNOA 2Z5FA 2D7DA 3QPVA 4JJKA 1KI3A 1JQJC 4FMDF 3VKWA 4Z8YA 5EXTA 3RANA 3IILA 1QDEA 4I1VA 5KU1A 1S8FA 1QHSA 2NO9A 1E0JA 4PQRA 4RZ3A 3UANA 2XGJA 4FMDB 1Q1BA 1ZNZA 2GDJA 2ZU0C 3OEED 1XU4A 4B3CA 1SULA 5CYOA 2IBMA 1FX0A 3AVYA 2O8CA 4QKQA 3VQTA 4OK3A 3CNLA 2GXAA 3ZD7A 2KBFA 1GKYA 1R4AA 2ANCA 4FD2A 3I32A 2DFTA 2YV5A 1ZIOA 2REXB 4Q02A 3DL0A 4LGMA 5KNCA 4C9BA 2IYZA 2ORWA 4MGIR 1P2VA 4YONB 4XVQA 2CXXA 3K0EA 4UNRA 4AKEA 1U9IC 2IS6A 3U5ZB 2WIAA 3W5IA 1O87A 1UBGA 3SQXA 3OIWA 1L8QA 4HUTA 3IQXA 4E5UA 3JVUA 4IXNA 4ZDIA 3KKNA 1W49A 5AJXA 4LJ6A 4DDTA 3NVAA 1VPLA 5B58C 3AP2A 1IN7A 3QI2A 2ZJYA 1DAIA 2YWFA 1G41A 4TMTA 3QG1A 2J87A 1DAFA 1E79A 4A8JA 1Z2CA 1G8HA 2FSIA 1E94E 2IEZA 2ZS8A 2ZSAA 3K0FA 5HE8A 4GPTA 2JLSA 3ZQJA 4DZZA 5J47A 3EPKA 4PAMA 1N6NA 4NCHA 4NYJQ 2NOAA 2ZI3A 1XJCA 1ZW6A 4RKFA 3LV8A 2Z0MA 2VP2A 4A82A 4BFYA 2IYQA 2OCPA 4DRZA 2JLVA 1OFIA 5JZVA 2ZETA 3DKPA 1P75A 4PAOA 2BMEA 1Q57A 1QG2A 1EESA 1DPFA 1GZSA 2QT0A 2R8RA 1SVLA 1ANKA 1JXMA 1XCPA 2FZ4A 4CYMA 2DWOA 5E7MA 2CL7X 4XH9B 3UG7A 3FYHA 3UPUA 3L43A 5JMTA 1N6LA 4DT1B 4JBWA 3DVLA 3FHCB 1AJEA 4GOJA 2RGCA 1BOFA 3IKJA 4NCJA 4KODA 1A4RA 3DM5A 3SJZA 1E2DA 3C5CA 3RYTC 2Q6TA 1KJWA 1ZM7A 2H8KA 4XWAA 5IRCD 2DYKA 3T35A 5C1BA 1YZLA 5E7JA 1LW7A 4QBHA 2FEOA 1ZM4A 2XZOA 3LXRA 3KKQA 4A15A 1YQTA 3IHLA 4YXWD 1GILA 1KMHB 1KSJA 2F1RA 4MUBA 1OW3B 3W34A 5FOVA 3R8FA 4M1YA 1ZUIA 1NL3A 1YZTA 2QGNA 3KQKA 2B8TA 3BB3A 2OFOA 3CR8A 1N6IA 4YXWA 4UNQA 2PLRA 4TL7A 5CLQA 2XTMA 4NHOA 4KAXA 1A1VA 1MKYA 5F3WB 1W36B 1D9XA 2O8DA 2QROA 5BQ5A 3RS3A 2MMGA 4RJLA 2JAQA 4DWJA 1JR6A 5FI1B 3UK6A 3ZS9A 4DLRA 4DB2A 3KB2A 4M9ZA 1DO0A 2ZRNA 4M1MA 1F5NA 3PEUA 3RABA 1COWA 4MKGA 1FOEB 3WXMA 5G40A 1EFRD 1MO3A 2O8BA 5JJKA 3KJGA 4V0NA 3SYLA 5GADl 2OAQ1 2IA5A 1W7AA 2WPDA 1KO7A 2GKSA 5GJVC 3T5GA 5HPYB 2V55B 3TK1A 2NMVA 1ZINA 3KXIA 4X8MA 3GPLA 3P1JA 1XBTA 2D4HA 2ZSFA 1XDBA 4B48A 2IYYA 1BO6A 4JVMA 2HYDA 3NHAA 3I1FA 2X8AA 2FFHA 1XP8A 5J40A 2CEAA 5FUXA 5FOTA 4RCZA 3ZLJA 3CM0A 3TSZA 4ZI3A 4H1VA 1AQYA 4HLDA 2O8DB 3H84A 1UBEA 3I8XA 2ZJBA 4N1AA 3U7GA 1SHZA 4WXRA 2KI5A 3B1WA 3CNOA 4IRUB 1EWRA 4GDFA 1ZM9A 3T5DA 5BN3A 2IYXA 4CGZA 5AUQA 1NLYA 1SXJA 5L3QB 4BASA 3U6BA 2V3CC 4GNKA 2UZ3A 1W36D 2VLIA 2AFHE 3TIFA 1W44A 1T0HB 2A5FA 1VDZA 2DFNA 3PCRB 3U4QB 1G7CA 2Q3FA 1SXJC 2ZRKA 5G3ZA 5KSZA 4KLZA 1WP9A 1ZMXA 4WAUA 2J46A 1QHHA 2QPTA 4OJKA 1HE1C 3TMKA 1S1CA 2Q9CA 3ZGXA 1AA9A 5K8IA 2R44A 3IPYA 1R5NA 621PA 1DAHA 3QVVA 4WZAE 4IW3B 3B1YA 2C98A 4ZDWA 3AGPA 4JLPA 3K0AA 4JLDA 1F6BA 3O47A 4DSTA
chains in the Genus database with same CATH superfamily
2FGKA 5HOQA 4OMDA 4PAGA 3EGDA 4WLUA 3LBYA 2C84A 5G0VA 2NYAA 4G8BA 3WA6A 2WKRA 1AZTA 4B7AA 3LYLA 2R2GA 1XZJA 2JFVA 3HYNA 4EFLA 5HIAA 3IIJA 5FWAA 1WOYA 3KQUA 3LT1A 5G02A 2ID7A 4DRXB 1IZ9A 1LRLA 2W58A 1H5QA 2R5WA 3PV0A 1YACA 1MB2A 2WZDA 3HA3A 3EF3A 4WGGA 1K63A 4DANA 3DZJA 1P19A 1CS4C 1V6CA 2NXNA 3R40A 1ZY2A 3ZR4B 3V4FA 3NM4A 1DOZA 3T9EA 3ZHCA 1XTSA 4M9CA 3OVMA 3WDSA 1XDSA 3BL6A 3I5YA 1Z5OA 1THZA 5LA6F 3WRXC 4D02A 1QCCA 2ES4A 3I6ZA 1KSHA 1CRQA 1GP2A 3IDFA 5H1YA 3TRFA 2HDHA 4OXIA 3ANXA 2JD2A 1HSZA 4IZ6A 1JJBA 1JNYA 1YU6A 4EJ6A 2DSNA 3I4CA 4MQUA 1PZHA 4M87A 5CFNA 2QLLA 2WYWA 4MS1B 3D6UA 3QY0A 2RCYA 2W2XA 4GPD1 2VSQA 3JWHA 4LC1A 4BO0A 1QP7A 1N3BA 2X3UA 4V03A 2G5PA 1CYDA 3B51X 1F60A 3L0ZA 3NH9A 3JR3A 3SPXA 5BV1A 1I94B 3THWB 3TL6A 1A71A 2ZUDA 3BE4A 5IKMA 3P5BA 5JAPA 2R86A 2RGXA 2WF7A 3LCVB 3SMVA 2RH8A 1G3MA 5DXAA 1MUUA 2PXCA 3QOYA 1SFRA 3H04A 2FZVA 4YJKA 1Z26A 5LNK6 3PYMA 1AKEA 1RXCA 1NE2A 1E60A 1XLVA 3HUFA 3TVTA 4B33A 1QP0A 4JXXA 4BWYA 3HCWA 2EWWA 1KZ1A 3I01M 3DE3X 5L3SB 4OI0A 1DC7A 3G49A 4GPBA 1E2NA 4K9DA 4MHSA 3QJ5A 1C2TA 4BX2A 2JFHA 4KACA 3WICA 3OKPA 3BD6A 1W5BA 4UCQA 1EFDN 2BFEA 4R01A 4TROA 1KMCA 4Q4AA 3TE7A 2FWAA 2XUZA 1H4QA 3BFJA 1G38A 1TKCA 4RTMA 4EMSA 3UXHA 4ISCA 5K0EA 4PC7A 4UXHA 1G4UR 4FGWA 5FBKA 1G5IA 1K6IA 4L4ZA 2JFXA 4MQ6A 2B3DA 2H0AA 4S24A 2IUEA 2OBXA 4ZDKA 1OX4B 2A57A 3NJ8A 4FZVA 1RZ3A 2AV6A 1V37A 4GNRA 1Z4KA 2R8PA 5A05A 2VNIA 3HZRA 3PDUA 4V24A 2E5WA 5F1YA 3HLYA 5DI3A 4G2TA 2VQSA 4MQFA 3RBVA 4LBYA 2C7GA 4HRYA 2H1HA 1FFDA 3LXXA 2QYSA 3PFCA 1RXSA 2NV0A 2PZMA 4U2FA 4ASUA 5I48A 3NUGA 2AFHA 1S1MA 1SB8A 3ABZA 4OHRA 4B43A 4OOFA 4ZIRB 4DMCA 1L1QA 4C4AA 1NYLA 3GG2A 4DWOA 4DLUA 5BXYA 3AVUA 4HPJB 2W43A 2QRVA 4UHCA 1DG3A 4AM8A 4IHKA 5JE8A 1W93A 2Q6VA 2YXNA 2G4VA 4YS6A 1MABB 2J5XA 2H1VA 2REOA 2AJLI 3D64A 3P9SA 4X6XA 2H65A 2V7PA 4DJFC 1U0JA 5CB4B 2ETVA 3Q88A 5A06A 5E6UB 4JEIA 1S2IA 2WWRA 3IEKA 1DUIA 1WUKS 3VZCA 4ZI5A 1DBQA 4GOOD 4KIFA 4NYIQ 3UMSA 4MR8B 2NP7A 2PL5A 2V7QD 3ZYZA 4ZN6A 5K2OA 3WK4A 1PNRA 3MERA 5EUMA 4CIAA 2QT9A 1RS0A 1XWIA 2GK6A 1LLFA 1PAUA 5K8VA 5IDWA 1KPHA 1P6UA 4J3FA 1NBEA 3U60B 2PQ2A 1I30A 2AXQA 1XNHA 2IDJA 2VNSA 2Y4NA 3FBTA 5CJ2A 3RV3A 4DJAA 4MS4B 3TH5A 5JADA 4M8LA 1LJUA 2YJZA 4EHBA 1RRGA 3WHKA 4TWAA 1F5SA 1GADO 5FORA 2SICE 2GILA 5DEOA 3TJMA 4LRXA 2Q2QA 3OT1A 4B8WA 3AJAA 1VP3A 4EKEA 1I2CA 1LWOA 3Q85A 1T6YA 2JLYA 4HQLA 4JUBA 5GOZA 1WOMA 4JVOA 3O5AA 5LYJA 4CKEA 5JOQA 2DBYA 1KZ9A 1VFPA 1JXOA 1TUEA 1N2CE 3H5NA 5JSKA 4QM6A 4XUGB 2UYGA 3A4YA 5DN9A 5DYGA 1IHUA 3TDNA 3U1BA 1JA9A 3CW9A 3MC1A 2NO1A 4I2VA 1E92A 2Q62A 4DWVA 5JMWA 1V41E 4MOWA 4P3PA 2CJWB 4EVSA 1RWPA 4CM7A 4QBKA 1N6KA 5I8ZA 5INTA 4QFDA 2R6FA 3PFHA 2X7XA 1MC8A 1Z22A 5JALA 1W6RA 4NYIR 3VMMA 4G23A 1THMA 2REQB 5J2UF 4OGWA 3O0TA 4RU1A 1FQKA 3VX4A 3ZV4A 1N75A 3FJOA 4Q93A 2GOYA 4S2UA 4XCQA 4EG8A 2H1CA 3W6OA 4AMGA 5BVHB 3V5NA 4B35A 2H5IA 1SOAA 3VFDA 1CV2A 2H1WA 1RPAA 3AYZB 4PSAA 1N5RA 4GYJA 1L7BA 3L8EA 1OX5A 3NEPX 1CUEA 3PJRA 2E89A 4BY9E 3RAGA 4YX9A 5ICMA 4GOKA 3RS5A 2E85A 3NHRA 1O5TA 5A5VA 1BNCA 1IAVA 1X1EA 2ZPTX 2CCJA 3OE7A 3BPSA 4XW2A 3V2GA 1NDQA 1PR9A 1QH1A 2ONCA 1D1SA 3KZOA 2M98A 4EY4A 1QC5A 4U7DA 1FNDA 4IWNA 4MCAA 4XLLA 1TA9A 3SYMA 2ZTMA 3QTBA 3T0GA 1M2JA 2C57A 2P65A 2Y1OA 5HNKA 1ZL0A 1TNDA 3R41A 4HWKA 1WEHA 4YR7A 3F6EX 4OSOA 1I8TA 4RNDB 4I1RA 1WNFA 1Y8RA 2XJ9A 3LQ2A 3PP8A 3FVQA 4A1OA 3DYVA 5A7GA 1HA3A 5CFQA 1RZUA 1U2DA 3QX9A 2C4VA 1GUZA 1UBCA 1MJ5A 2VLBA 2CHUA 1UDBA 3EZXA 3U1VA 4Q66C 4Y7CA 3E8SA 4PNZA 1J5PA 1EHIA 4UFPA 2P90A 2F2TA 3L5OA 1SXIA 2H1SA 3LLMA 4D8UA 1WZNA 4HS4A 1CFJA 2Y6UA 3IP6A 4ZD6A 2VAPA 1EP3B 2JFQA 2YVUA 4R2MA 4F2WA 3ZIDA 4ZVVA 5K0JA 5KNDA 1KC3A 4R69A 2QN1A 9ATCA 4I9NA 4TWRA 5CXXA 5IK2A 1ISPA 4IICA 1PFGA 1VL8A 3LKVA 3B20A 4Q4HA 3MA0A 2BR3A 1N2BA 4PO1A 5CEEA 4GF5A 4CI9A 2I80A 4QDJA 3KTAB 4RV5A 1UR5A 3CJRA 2BKLA 1PZMA 4RCYA 5CT6A 5TS3A 1VJCA 4TUYF 3CB4A 3UT6A 2BGGA 3CKYA 1J7JA 3V80A 1QLHA 5AOCA 4BFSA 1MB3A 3IOEA 3WS7A 2OG2A 1QQ5A 1K8QA 2EJUA 5C9ZA 2W2QA 1MAUA 4ZZ2A 3MJCA 4BFVA 4IV5A 1L5MA 4HLCA 2I65A 1P4GA 5I3CA 1N2EA 1AU9A 2ZJ1A 1GPBA 1T0UA 2WD7B 3D3WB 3RTGA 3NASA 3I5XA 2IFTA 4FFPA 1RQLA 3T9BA 1C81A 4N41A 1FDTA 4U5XA 3JQAA 4YRMA 2NXWA 1IN6A 3UOGA 5T3YA 1JQAA 3VKUA 3BCRA 4YUVA 4PXSA 3K73O 4UKDA 2WA1A 1DXYA 3FB4A 1T4BA 3IBFA 4WOPA 5FO1A 3QLVC 5L4LA 1CW2B 5E95A 1VE5A 4RD6A 2VJCA 3D6MA 4TMZA 3A3NA 2DMRA 2J41A 3TFWA 3ZWQA 1R0KA 3THWA 3ROKA 1T6BY 4DREA 1RIFA 1QWSA 4IH1A 4IDQA 2EEPA 2QRKA 3IBGA 4XEHA 5DGXA 4B6FA 3P7MA 2YOFA 3KR9A 4Q6WA 4TT8A 3CRZA 1ZD1A 2PX8A 1Y7LA 1RXIA 1P5HA 2P41A 4FT4A 1DS6A 1NASA 3RRNA 3LKZA 5FCDA 4CFZA 2ZR0A 2EYQA 2JI6A 4IGFA 3QEJA 4LQCA 4RVNA 4C6HA 2OCGA 4W5NA 3STXA 2VXCA 4QU9A 4NC9A 1DRJA 3PEWA 2A84A 3FOEC 4GI5A 5C4GB 4LWPA 2AX4A 4KDCA 1DV2A 3CLUC 3C74A 4HAIA 4Q6BA 4CUJA 1RRKA 1KK1A 2EQ5A 4O63O 1JLLA 4WEQA 1R0SA 1SC3A 2ORYA 1ZJWA 2BR5A 2FPPA 1KKMA 2Q4BA 5L7YA 1FXWF 5I9TA 1ZS9A 4P98A 1JEEA 4OJYA 4LQ4A 3D7MA 2K2QB 5JSZB 1L1FA 1FIUA 1ZVVA 4RV9A 4OQNA 1FP2A 5EKSA 1UMKA 1MV8A 3TLMA 5B57C 2JBWA 1YJ5A 1SBQA 2BYTA 4YP5A 3E7FA 3CURA 2V97A 4YK7A 1G8AA 1IEQA 2JIBA 2Q8PA 2VTVA 4IX1A 2ZWVA 3AIMA 3RAFC 3A32A 4UULA 2HOQA 2NUBA 5FV7A 1YGPA 4ECAA 1G7TA 3VR0A 5KWJA 3A9RA 3FE2A 5ESDA 2A5YB 4E07A 4R9RA 3C5WP 3G23A 1R9GA 4PLPA 3B6ZA 1GGMA 2ISCA 1I6MA 4LZJA 1Z0SA 4JH0A 5KPJA 1CZOA 4C7OA 1YZUA 3BG5A 3B5JA 2OB1A 1X42A 4LTNA 4X6UA 4FYMA 3HR7A 2A30A 3WO1A 3MEQA 1NUPA 4FZ5A 3PEVA 1GHTA 1NVDA 3MTBA 2JAPA 1BXGA 3MT9A 3DMYA 5KVSA 4BQOA 2ERCA 2HA4A 4MJXA 1KOGA 3GRAA 1MG0A 2Y1XA 1U0BB 1UP4A 3E1GA 2ROQA 1LLCA 1WTAA 2EFGA 5K5EA 2BGLA 3BSYA 2IF2A 4PM4A 5KWIA 5HF8A 1KVSA 1JJ7A 3NEJA 1QRTA 2FPUA 3C16C 3N1UA 1GTL1 2J5RA 4ROSA 5DMHA 2DWQA 5EERA 3JQ8A 4CM8A 2C83A 2X5NA 3JQGA 3VVLA 1ZNWA 3KQVA 2GHIA 1HKHA 2GARA 3PXAA 1GA6A 5J4KA 2ZB4A 1KNXA 4G37A 1J00A 1CUVA 1X3LA 2VAMA 4TZ6A 2ACEA 2AE2A 4UBKA 1O95A 1Q0ZA 1VIYA 4MW5A 3ZS8A 3IERA 1FFBA 4MUYA 4BO2A 3BA6A 5DHTA 4JB0A 1MN6A 2O1SA 4TYYA 1E1KA 3HCNA 1ZH0A 4MA5A 2OYSA 4FI3C 1QANA 1JTFA 3VR2D 4FKBA 1A4UA 5LQNA 1BW9B 5M7EA 4K9OA 1WJGA 4A6PA 4BYGA 1X9HA 4ZU1X 5EA2A 1RHQA 5DYYA 5DLQC 1C1HA 5AW9A 1FXWA 3KXPA 1OHHA 5TSDA 2DLNA 2P0AA 3WYGA 4EA8A 2G9ZA 1M1YA 3SR3A 4YXWD 3ZNQA 1UBFA 2AVDA 2C07A 4CE6A 2B82A 2V6IA 1ACJA 3AEZA 1EVLA 2YDXA 1OA0A 4EPYA 2A88A 1DCMA 2VQDA 4AUEA 1Y33E 4UTVA 2OK7A 2WABA 1E3LA 2C4KA 4C7BA 4JVNA 3HJUA 2X41A 5IT0A 3A1SA 5EMMA 4A0HA 5HJ2A 1A9PA 1UBNA 2ZYTX 2O2SA 2Q0SA 2O2ZA 1J99A 2AJCA 2WJJA 3VDXA 3VKFA 1EYZA 3G6WA 3I37X 4OYHA 4KTVE 2IS1A 3T1QA 1QF7A 4LIPD 2FDCA 4LJ5A 1UZMA 5JZSA 5A4JA 4G85A 1CJVC 1VXOA 3DAFA 2P2CA 3F6BX 3H1GA 4MI3A 4YXFA 5FJIA 2EWMA 2R8YA 5AMXA 2ZUUA 1UOPA 2C2ZA 2CHVA 5AJUA 3T5PA 2GXQA 5CYFA 4X20A 3Q40A 3ZHUA 2ZR7A 4BTLA 5KWEA 1W5FA 2OY0A 2CVFA 3RDPA 2WIBA 1W2WB 1W5TA 3BWXA 4ZV9A 2HHHB 1CG6A 1XZBA 3UB2A 2BFFA 3E9NA 2A92A 3ONFA 4MW9A 5MFPA 5J1TB 2FJPA 2IU4A 1G17A 3AP1A 2VT6A 4Z0TA 1VMDA 2XHZA 3DHYA 2O2YA 1NSTA 3PQ8A 5I9BA 3UJ3X 3ZUGA 1WHTB 3PG5A 1C7RA 2XD4A 3FKQA 3FVTA 4JLWA 4NPCA 4WBSA 5D3ZA 4EB6B 5M34A 2BMFA 5FBLB 3MOIA 1M1ZA 4GMXA 3A9CA 3CA8A 3GEPA 4I8XA 3TQHA 2PGJA 2Z2YA 1UKAA 3QE2A 3EA5A 1AB5A 1TU3A 1RWQA 4R9SA 4AICA 3PJGA 1QP4A 3PGMA 5IYZF 4RJ2A 1E1QD 2ZSUA 3KYCA 3ZQKA 4DLVA 5BOSA 4DIKA 4F92B 1FUYB 4M38A 4CT4B 4ZO8A 1P9NA 2YWBA 1UINA 3Q9LA 4HO1X 1OH5A 3GFRA 3UHAA 1EUQA 4OHZA 1J2TA 4F21A 3TEFA 2AE1A 4C05A 4CMCA 1YZYA 2VDLB 1A95A 1NMXA 4YEDA 2EF1A 4XIFA 5LQJA 3PXDA 3HWRA 5CGZA 4EF6A 5DCYA 1KO5A 2VP9A 2CNOA 5DX8A 2XVXA 3TNLA 1K2WA 1W5EA 4IINA 3EPRA 3MXTA 1W88B 3QITA 4JUIA 2UVDA 1TA4A 4MRRA 1VXRA 4KN6A 4B3DA 1C0EA 3HB9A 4L07A 4NR0A 1LXCA 3IHTA 3DOEA 4R8RA 2O0JA 2PZKA 5K4HA 3ZK7A 1SBHA 1AF4A 1K2VN 1NW3A 4QWMA 4Z4GA 1ID8A 3OUZA 3TPZA 1JZSA 1U04A 4M6WA 1R4MA 1OBOA 2QBYB 1FSPA 2XB9A 3DOUA 3JQRA 2R66A 2WJAA 3DZBA 4KO8A 4PSKA 5DGIA 2ZVQX 3A6LA 1PYDA 2R7KA 4OXYA 5FWXA 5JR3A 2DUWA 1JG2A 1GITA 1A82A 1I3LA 1CEYA 1B15A 4QFCA 1E6LA 1TKBA 2KLBA 2HPAA 3A9VA 2D2XA 1FFYA 1I13A 1YQDA 4QHTA 1QLJA 2GK3A 3EXG1 4O4HF 3D5TA 3KSDO 1I2MA 4R1UA 1V3UA 4MS4A 1NUAA 4CG2A 5BURA 2OG1A 5JNSA 4EB8A 1M1UA 2O20A 2JAXA 3LC0A 4KWEA 4G81A 1XZDA 4KIWA 4RLQA 5JRJA 3HP1A 2HT1A 3ZTTA 1L0BA 1TVKB 1L7RA 1XTZA 2X8BA 4KGDA 1P2SA 2C5LA 3IBTA 3NGLA 5FWNA 2H57A 5K8UA 1G9TA 3QNWA 4V1CI 4N3GA 1YWGO 4M1EA 1VOTA 1WCXA 5DT2A 3CE6A 4YIKA 2C4TA 4CG1A 2O05A 2R6JA 2HQBA 3K20A 4A3SA 5C4MA 2YMPA 3CR3C 3UIEA 1ENPA 2O5RA 3ILYA 5JDIC 2C8VA 4G1MB 1QS0B 2DBRA 2Q2VA 2RHOA 3R0IA 5BMVB 2ERYA 4EFNA 1SEPA 3K71B 4QELA 4XUDA 4EVRA 4BGEA 5TQ0A 1LKZA 3D8HA 5IYZA 1Z6GA 2O54A 2NU7A 1K8XB 3OCXA 4TTTS 1VIAA 4WZBB 3RADC 3DT9A 4J2TA 4D80A 2ODQA 2QDXA 3WYEA 4PN3A 1EIWA 2EKQA 3NAQA 4PFJA 3N07A 2AHOA 5JWRA 3EIFA 5G4LA 1FX0B 1KQPA 3KNZA 1QFMA 4H1UA 4M88A 3TLKA 1Z5UA 4RQBA 3PR2B 1USWA 3ZN2A 2FOXA 2O1EA 4BLUA 4RPIA 5HRAA 1H3NA 3CLUD 4MAFA 5G1NA 2Z04A 5JXWA 2Q1UA 5D5QA 3PFGA 2UZ1B 2EX4A 3OQIB 1FP1D 5EXXA 2MSKA 2C3PA 2Q8QA 1QO0D 3HDYA 2QLBA 4GMFA 4JODA 2V4UA 3NUQA 4YGXB 5CA0B 1IULA 3C8ZA 4ZEOA 4CMGA 3VKVA 5ETJA 2R751 4INZA 2YWEA 2GD0A 4GSKA 2VDUE 2B5OA 1C4KA 2H48A 3BDIA 4NX2A 3OD5A 1FUUA 3HCEA 4RY2A 4CM9D 5IFLA 3H75A 1UBJS 1DOHA 3H87A 3KXLA 3QOWA 4C87A 2FPLA 1LV7A 3DVSX 1FF9A 3ETEA 3PGVA 3Q8WA 4UNNA 4PBRA 5LC1A 3JYLA 3WLNA 1I1HA 4DW8A 1RD4A 3OQJA 2ZWIA 3IHKA 4HDSA 3WGMA 5CUQA 1T9GR 2QAGC 4R68A 3X1DA 5KYXB 1QXSA 1TF5A 2DUMA 2E48A 2I4RA 4FINA 4O2RA 4W5WA 3S1AB 4E11A 3QVUA 4QTTB 4MV8A 1R0BA 2PHZA 2PUWA 1AKQA 1T2FA 4AB1A 1ELOA 2OCDA 3MT8A 1KTVA 4Y98A 4RS3A 1A9ZA 2HJVA 2WB4A 4IJWA 4UMDA 4V0KA 4CL8A 1R8YA 3KD3A 3QVGA 2PBRA 5HFNA 2PRKA 1JBQA 2C29D 3BREA 1R10A 4ARVA 5JY1A 2ASEA 4MDHA 1RJDA 2PTGA 5CP8A 5DKFA 2KBEA 5E4JA 3BH6A 1W9HA 1MIOB 2EX0A 1CEQA 2HCBA 3LCMA 3R5TA 4MRMA 1VHDA 1WZIA 3UV6A 4BCCA 3TQIA 4BVBA 2CLMB 1NY6A 3GNLA 1Z75A 2DKNA 3BK7A 4KPUB 4G0OA 4U7JA 4YHBA 1XD8A 3ZPXA 1Z6ZA 4A92A 4URYR 4JLUA 2IGTA 5DOVA 5LQCA 2JHCA 1U3CA 3DGFC 2I9KA 2NWQA 3SIRA 1DT3A 4WNAA 2PUEA 2NZ2A 1TOAA 1KVQA 2LE0A 2ZATA 1JJAA 4BMCA 2AEJA 5EJEA 4O29A 2JCSA 1O9HA 4GLLA 4WLFA 3WK8A 4KVAA 5BR8B 4N0DA 4C0XA 3Q7IA 5FPTA 2ZUTA 4NS1A 1A7AA 2ZJ7A 2PL3A 2OUKA 1RYNA 5EJIA 2QJWA 5KJFA 3CZPA 1NIJA 1T3GA 2PNJA 2WFLA 3ESDA 1KWKA 3PQ7A 4KP7A 5HQ3A 1V1MB 1VRVA 3LHDA 4ZP1A 1UJCA 5KWSA 1UAAA 1IDN1 4G25A 2PVCA 1NOIA 4KAAA 4OFXA 1S5PA 4KZPA 4X24A 5EZYA 4NLLA 5BW6B 1AKVA 2OT3B 1MZPA 2B36A 4NY1A 3R3SA 3SSAA 1X1QA 1TYEB 2Q5QA 3EVAA 4X91A 3RSSA 2JJ1A 1P2FA 2NVOA 2XGSA 4Y8VA 3NW9A 2PMCA 3RC8A 4PZ0A 1RI1A 2BI7A 4FDLA 3ZBPA 4Q3DA 3HN6A 3N3BC 4UHDA 4JI2B 2GJ8A 4OGGA 3RVOA 4DJTA 2XRYA 2VUIB 1QIHA 4NQZA 3SEZA 2I71A 3THRA 5C8ZA 1CUZA 1TJYA 3OKAA 4CF5A 1ZH2A 1C0LA 1QHHB 2V7EA 5L3RA 2D2EA 1T2EA 2JEYA 3ENZA 4XGNA 4MVCA 3LS2A 2RHDA 1US8A 4I5IA 2GBIA 1GPMA 4LV6A 3LSTA 4B4OA 5I7RA 1RZRD 1OXMA 3C1TA 1PZFA 3LQKA 3WWZA 4AIIA 5F2NA 3PA8A 1Z17A 1O4WA 3SX2A 1U1CA 1KZHA 3T38A 1U7TA 5CFMA 5TPWB 1GLGA 2P9YA 2VRCD 1NXWA 1DC6A 2BWJA 3QF4A 5DHPA 4B84A 3ZCUA 4HVLA 4X44A 3W3AD 3F9CA 3GJ7A 3M9LA 5JS1A 4FHZA 1T0PA 1GNRA 3KG2A 4Q9LA 3WP0A 3FUTA 4L8VA 3I61A 1Q7CA 3PHBE 4HWSA 5CVUA 5AHKA 3IMFA 1ICIA 3QW2A 5ER9A 3L8YA 1JE0A 1ETUA 4IIYA 3AINA 4K3UA 1HE3A 4KBYA 1QNFA 2ZRCA 1QGYA 1P2GA 2O8FA 2DECA 2B1JA 4MMYB 1LY1A 1AQNA 4QLOA 1GAJA 4YCJA 3RC3A 2W8BA 2HJHA 2BGMA 3DFMA 3R24A 3HVRA 4ZYLA 4WZBA 3SE0A 1XVLA 4XJVA 1VG8A 2CJXA 2VP5A 4B2PA 5A1JA 3GOQA 2GSDA 1A8UA 1B2LA 3BZWA 5EHQA 4UD6A 1M8PA 2Y1LA 5BSMA 5IZ4A 5DULA 3OZBA 4GX0A 2JJ8A 3PVZA 4ZGBA 2QVZX 1U4SA 2G3YA 4B82A 1JAZA 9GPBA 2J33A 4U2GA 3QLEA 2NZWA 4Y9DA 3UKDA 1VA4A 2J07A 3LNCA 2GM9A 1JHRA 1U7DA 4KGVA 2ZDQA 1YS1X 3HFJA 2VTEA 4AJKA 3TO5A 3WBBA 3Q9NA 4AUNA 4P3KA 3BTVA 1WD7A 3KT6A 2A58A 3HPQA 1O57A 2QUAA 1Q2UA 1QR6A 2CLSA 1B00A 3FPEA 3L0IB 4FGKA 4I36A 5KYTA 3UJNA 2Q3DA 1B23P 1G3RA 1AH2A 1NVVQ 3HJAA 2FPPB 3C3DA 5GONB 5DHSA 4C3VA 1G63A 4QDXA 3S3TA 3ZW8A 1ZOOA 4ZAYA 4EW3A 5B55A 1MABA 2PSEA 1VYHA 2CDBA 2OL4A 3ACCA 4QQRA 4WZBE 3VSAA 1HLPA 5A2GA 3EB9A 3VRHA 1A8PA 4BQFA 2IZ6A 1CNEA 2R6ZA 3PEEA 2J32A 3TFOA 3HNPA 4QJ4A 3CLSC 4ZVMA 4AG3A 1E9DA 1QUEA 1EK6A 1B6GA 1S2LA 1LA2A 3DLTA 3PFNA 4A0RA 1MFZA 3V4RA 1L9XA 4D3ZA 1OH6A 1IB6A 3PNBA 5AUPB 4UPDA 4LQDA 1CY1A 5B5SA 1JG4A 1XMXA 3AVXA 1TK3A 3SBDA 1YDFA 1ZESA 3WFZA 1GPWB 4UC0A 3AEQA 3FGPA 1WPXA 3H4MA 3EFEA 3TLEA 2EDCA 1R7RA 3DNMA 5LUBA 2GEDA 1KYYA 4X1YA 1KMMA 4G1UC 3UTCA 3TECE 4YCNA 1LSOA 4OQQA 4GT1A 1OIVA 2P6RA 3M3DA 1SWVA 4GZ3A 4IVNA 1KEVA 1QGUB 3DA8A 3KSMA 4EPRA 5IKEA 2FMIA 1D8AA 1PQPA 4FYHA 1OXKB 1D6NA 1ORVA 3FR8A 3NBFA 4ZT7A 3R8XA 4ARZB 3CH7A 4R8SA 1G4AE 1Z63A 4YMTA 5C5CA 4R84A 1JILA 4YUAA 1P4SA 4MVWA 1FNCA 4RH3A 3EE6A 2V8BA 4EPXA 2W4IA 3HGMA 1A9TA 1L7XA 3LW8A 2QX9A 3PD0A 1J0CA 4WY2A 5CLHA 5F35A 4X1YB 2YR0A 3NKVA 2C2GA 4KYUA 5LA6A 1OT3A 2CLHB 4XX1A 4QRIA 5FYDA 2QTBA 1EDEA 2FXVA 2X4GA 2RGAA 1JYEA 3AUAA 3NCTA 4N8SA 4QQKA 4RPCA 4Y1RA 5TGTA 2QQFA 2RK4A 3UBTA 3J81k 4ZOQI 3AY7A 3HC7A 3IQEA 3RWOA 1AY0A 3BWDD 5HG0A 1D2NA 4UBJA 3OZVA 3MN1A 2ZJ3A 3HJBA 1T6XA 2J3EA 5CK5A 5ALIA 2C7OA 1GT6A 2B7LA 2L69A 4TT3D 2GN6A 2PO7A 1CHNA 2ZROA 1ZMTA 1Q20A 1CY8A 3AV0B 3JTMA 3AG5A 4YGYA 4GZ6A 5DGDA 3VX3A 4TLLB 4OHCA 3R76A 3GJXC 3KHUA 1K5DA 4Q03A 4W4TA 3VNVA 4PS0A 4C3ZA 4CFYA 1QQ6A 2FRVA 3MF4A 4EBBA 5HW0A 3L04A 4MV1A 5IH3A 5LVAA 3RJMA 5AUNB 4JA2A 5KYWA 4Y6GB 1FY2A 1ZGAA 1BVYF 3WL4A 5FLKA 3WDLA 3MCVA 3NDJA 3OH8A 4HK4A 4FFBB 4MWEA 1NXVA 3SLRA 2W2KA 4MWCA 2PMKA 4D57A 1YIOA 3IMKA 2CLCX 3OIDA 4CHGA 4D8WA 3D1LA 2X8LA 3OM0A 1KNQA 2RH5A 3EZFA 2VIIA 3M33A 4KXMA 2H4JA 4YN3A 3WQSB 1MT0A 3INNA 5B64A 4URXR 3BM5A 2IS4A 3S2IA 6YASA 4NBSA 3DBRB 1IY9A 2C7VA 3NNSA 2BMVA 2LP4Y 1N78A 2F3TA 4BNZA 3DAHA 1DCTA 2HCJB 1O8CA 2E87A 1S0UA 1Z8FA 4ZQGA 3OY7A 2DPXA 1QU2A 5EC8A 3GUYA 3SQMA 3GZJA 2P9EA 2BMWA 1OC2A 1YBFA 1SIBE 3AUXA 4JI5B 4E3ZA 1AMNA 3L6OO 2DT8A 2Z9BA 1E2EA 2QAJA 2HHLA 3QLUC 3QXHA 3KZCA 1Z6YA 2V4ZA 4F96A 2BCGY 2G88A 4LOKA 3WGIA 4FYVA 4JJ4A 2XXJA 1ILEA 4JKYA 1K8ZB 1VQ1A 1SQSA 2LKDA 4IIVA 3O4IA 3UAOA 5JNLA 3K6RA 1NBWB 1OH7A 4N3AA 3S99A 3LFTA 2I6UA 1AGPA 1AQ6A 2W93A 4PG8A 4OXKA 3AC0A 4Q1BA 5ADVA 3KIPA 4AAYA 5K9ZA 3IRVA 1N3LA 3H1EA 1UT5A 3L6CA 3H9UA 1Z68A 3SNKA 4NNOA 1CUSA 1OTHA 2G7MC 3REOA 4CTKA 4OYRA 2LCQA 5EIFA 4EPVA 2FW8A 5REQA 1U8EA 1E7RA 1F0PA 2CHQA 2WUVA 3AHIA 3KDAA 1RXVA 1E7YA 1G8SA 3UGTA 1ITZA 3N53A 3TEJA 4MDEA 3F5FA 4F1WA 4C5BA 2GN8A 1L8LA 1V26A 4E4RA 3L93A 3F6PA 1X8KA 4LMAA 3PIIA 2J48A 4A8JC 1DUSA 1L4LA 1LWNA 3PPYA 1YL6A 1GL3A 1G7RA 4IG4A 5C32A 1HC7A 4JSTA 5LCXA 4JI6B 5E9QA 4M6WB 3H65A 2EJBA 5C18A 3VYTB 1JX6A 4FR2A 1X2BA 5A62A 2PYZA 4W82A 1K7YA 3N2EA 1KC1A 3BMNA 4TL9A 4PO3X 6Q21A 3PC3A 4YFYA 2H6EA 4AS3A 4EYKA 1D6MA 2WJPA 1LW6E 1YBHA 2WWYA 3D54D 4JI8B 3BZUA 5LBIA 2YV3A 5ALNA 3A1TA 1JNXX 3IAUA 4XTRA 1XGKA 3CUYA 4OFZA 1WU8A 3I5UA 5FI5A 1F2VA 2A1UB 1ZWLA 2PAFA 2R85A 4J4TA 1PJSA 4HSGA 3QIAA 2BKXA 3C3AA 5AK5A 2D13A 2XUPA 3U3DA 2QA5A 3DTYA 3FFBA 3KU4A 3TS1A 3ILXA 4C20A 1V47A 5DYNA 5I45A 2XKKA 3VKGA 1AKWA 1JFVA 3Q7EA 3TVDA 2RAFA 3LW7A 4A0QA 4U0KA 1U7UA 4EG6A 3FTPA 5A5DA 3PRYA 4RZXA 3KQTA 3ZHZA 4CT0A 4EDHA 2P6PA 4FE4A 3KT8A 4DMFA 4DJJA 5A7FA 3P0FA 2YFQA 1KDRA 5HA5A 3S2SA 2ADFA 1ZU5A 1TJNA 2WAXA 1Z6AA 2CUKA 3INYA 3ANTA 4I81A 2PJRA 3HO1A 4W8GA 1KYWA 3IO3A 4ER0A 2W2KB 4WKPA 2B9VA 1VIMA 2H4WA 3E7DA 3GFSA 1XJ5A 1V43A 3GD5A 4E5SA 3BRSA 2CUNA 3IV6A 4IQGA 4L8GA 4KI7A 4KJXA 4QU8A 3LC2O 1CJUC 4JROA 5TPWA 3TM4A 5F73A 2CXUA 5A9TA 4C5CA 3MTAA 5MHTA 4A2PA 5J63A 5MDHA 2OHVA 2QM3A 4L08A 4L4UA 3DL4A 2BGNA 3EFBA 2XWSA 1NBHA 1ADYA 1K08A 4FGSA 1IHXA 4PR0A 4F4FA 3C3MA 4B4UA 4I99A 1E62A 1HDRA 2J3HA 1K89A 4ROTA 1PNOA 3F3YA 3RRYA 1YJXA 2QU8A 2BIFA 5IAKA 3GMSA 5BSHA 1EKXA 4ZDJA 4M76B 3R7LA 1UAGA 1RIIA 3E61A 5EIAA 2WR8A 3KQMA 4KKXB 1EINA 2VP3A 1L7AA 3QPWA 3WNDA 3WG9A 2KS6A 4L4RA 3F1LA 1GZ4A 4DCVA 5GZ1A 5G0TA 1AKNA 2M1ZA 3TVYA 1IJEA 1OPXA 2I6FA 3RT9A 4QGBA 2QL7A 5KTTA 1P72A 2AT1A 1JT2A 2YYSA 2PE5A 3I9NA 1R15A 2WTMA 4DSUA 5CCXA 1VSUA 1A96A 5E6SB 4EW6A 1TQHA 5DNWA 3FGZA 4KO3S 4N82A 4POAA 1BYIA 1S89A 1OY1A 4H3HB 4CLHA 3PZRA 4TLAA 1QKJA 1VTKA 2VPWA 3DDZX 3GA0A 2EQBA 1NLFA 2JFFA 1EFPB 3AI7A 5CT5A 4CVNA 4OMFG 1CP2A 3VYUB 3QNUA 4UASA 2NX2A 4BE9A 4JEMA 2JLUA 2GTPA 2JCXA 1D2HA 1FVOA 1U7ZA 1ZDMA 2QTVB 3K0BA 2V58A 3I42A 3U9LA 2PS1A 1ECJA 1DKNA 4DM4A 1DZIA 2DHDA 1Y3CE 3CNHA 5F7OA 4WXEA 1D1PA 2ABWA 4TUYA 3H8SA 2UUOA 4BEBA 4AJPA 3I9MA 4XARA 1Q3HA 2K6GA 2XECA 4UHFA 4OB8A 4GL4A 4O0LA 3W8NA 1IBCA 1OXSC 3FPKA 5AICA 2FR8A 4Y2JA 2G8LA 2JDIA 2H06A 4YAKA 3CF4A 4EW2A 3O82A 4RTOA 1R88A 1E32A 1QBKC 2WWXA 5DBEX 4HAOA 2IIBA 4LYFA 3ELYA 1IRIA 1L4GA 1Q7RA 3EJWA 3F46A 3GRRA 4BBJA 4F2HA 4QGAA 2AW3A 3N87A 4KK3A 3Q8MA 1SA0B 1II8B 4OA5A 1FJ2A 2KSQA 2G36A 3ZTYA 4DMMA 5LB2A 4IDNA 2XJ4A 5IVDA 2WTUA 5KVCA 3ANNA 3TZQA 1UP7A 2H5EA 1SG0A 2PMFA 2PL9A 3PXBA 5D3KA 1K1EA 1G20A 2ZSDA 3A04A 3OFNA 4U7GA 2J9GA 5KAPA 2ZUVA 1RI5A 4HDCA 2BGRA 1E3EA 1FMCA 5CYGA 5C5EA 2CVHA 3VR3A 1UAYA 5C7YA 4CL2A 4NMHA 1G19A 1R0WA 1V4VA 3QMWA 4BNGA 1Y4DE 2BM8A 3A4VA 4QREA 5DCLA 1JB9A 1VI2A 3GFOA 4Y2SA 2ZCJA 1ACMA 5DTIA 2A9RA 3MD9A 3DPIA 3ER8A 4DR2B 2QPOA 3IKLA 2HBZA 1O54A 2PUTA 1NURA 2ZITA 3B8HA 3LY8A 1A4XA 5AJZA 5DLPA 3TAHA 4B6GA 1SVKA 4BLRA 4Z1OA 5CD9A 4L0DA 4HEHA 4DMLA 1ZN8A 2R97A 3FD8A 4LPKA 4IS2A 3G88A 3Q0EA 1OFGA 4HEA1 1UFQA 4YRQA 4ZV7A 3TNYA 1OZFA 1NNUA 3E22A 2VI5A 1QHEA 2CXRA 3DEFA 3RW9A 3LSYA 1R8JA 4AWXA 5IEBA 5GJBA 1SXJB 1ZICA 4BVJA 4OI1A 2ZDGA 2BBOA 3PR1A 4M1TA 2NZYA 3VVCA 2PWAA 1GG2A 1O6ZA 3QQ5A 2YZ2A 3R09A 3E48A 4ZVSA 3JWIA 4ESOA 3T7EA 4PPFA 4K28A 2JIZD 2JNWA 4WECA 1DBSA 4XOIA 1J5XA 2O9JA 4I1UA 3D7KA 2II6A 3DJYA 4WNAB 3AI1A 2QTTA 2QTVA 5A5FA 1GT91 2CB0A 3SZMA 5ITWA 2IK8A 1Z82A 1V2GA 3PUHA 2FTKE 4GAEA 4I9GA 4BMSA 1FW8A 2NUTA 4EUEA 5I7UA 1F0YA 1NFQA 2N1BA 2XEXA 4MA0A 4X62B 2FWNA 2JEOA 2ATEA 4P81A 1F38A 3A3KA 1G59A 4F3TA 5LMUB 5FDFA 1H8ED 3KQWA 1J2UA 3WGNA 3HVJA 2VQ6A 1QHNA 4U3JA 4DA6A 1Y1SA 2Q5OA 3WVNA 1AXEA 3BTSA 1ADFA 3RJ5A