1SVJA

The solution structure of the nucleotide binding domain of kdpb
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
136
structure length
136
Chain Sequence
b'NRQASEFIPAQGVDEKTLADAAQLASLADETPEGRSIVILAKQRFNLRERDVQSLHATFVPFTAQSRMSGINIDNRMIRKGSVDAIRRHVEANGGHFPTDVDQKVDQVARQGATPLVVVEGSRVLGVIALKDIVKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium-transporting ATPase B chain
publication title Inter-domain motions of the N-domain of the KdpFABC complex, a P-type ATPase, are not driven by ATP-induced conformational changes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 31
structure length 136
sequence length 136
ec nomenclature ec 7.2.2.6: P-type K(+) transporter.
pdb deposition date 2004-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1110.10 Alpha Beta 3-Layer(aba) Sandwich Calcium-transporting ATPase, cytoplasmic domain N Calcium-transporting ATPase, cytoplasmic domain N 1svjA00
1WPGA 5AW1A 4UMVA 5A3SA 4XE5A 2EARA 4KYTA 4Y3UA 1MO8A 4H1WA 4BBJA 5AW7A 4J2TA 5AW5A 1SU4A 2C9MA 1MO7A 5AVYA 3B9RA 1VFPA 4HYTA 3J7TA 2ARFA 3W5BA 4YCLA 1Q3IA 5AVTA 2KMXA 5AVQA 2YJ5A 2EATA 3NAMA 1XP5A 3FPSA 2C8KA 5AW6A 2ZBGA 2DQSA 5AW8A 2C8LA 2YJ4A 5AVVA 3AR8A 3AR5A 4XOUA 3TLMA 5A3QA 4RESA 3AR9A 3SKYA 2OA0A 3AR2A 4BEVA 2KMVA 5AW9A 1U7QA 3RFUA 2YFYA 2O9JA 3A1DA 3BA6A 3GWIA 5AVZA 3FPBA 5AW3A 2A29A 3B8EA 5A3RA 2ZBFA 4UU1A 3FGOA 2B8EA 3SKXA 4BYGA 2ZBDA 5AW0A 5AVSA 3B9BA 3KDPA 2A00A 3NALA 3AR6A 3N5KA 4YCNA 5AW2A 3A3YA 3W5AA 2IYEA 3W5DA 5AVUA 2YJ6A 2C88A 3NANA 2YJ3A 3N8GA 5AW4A 1T5TA 1SVJA 4YCMA 2BY4A 3AR3A 4NABA 5AVXA 3WGUA 1IWOA 4BEWA 2AGVA 2ZXEA 2ZBEA 5AVRA 3AR4A 3A1EA 4RETA 3WGVA 4UU0A 5AVWA 3A1CA 1T5SA 3AR7A 3W5CA 2EAUA
chains in the Genus database with same CATH superfamily
1WPGA 5AW1A 4UMVA 5A3SA 4XE5A 2EARA 4KYTA 4Y3UA 1MO8A 4H1WA 4BBJA 5AW7A 4J2TA 5AW5A 1SU4A 2C9MA 1MO7A 5AVYA 3B9RA 1VFPA 4HYTA 3J7TA 2ARFA 3W5BA 4YCLA 1Q3IA 5AVTA 2KMXA 5AVQA 2YJ5A 2EATA 3NAMA 1XP5A 3FPSA 2C8KA 5AW6A 2ZBGA 2DQSA 5AW8A 2C8LA 2YJ4A 5AVVA 3AR8A 3AR5A 4XOUA 3TLMA 5A3QA 4RESA 3AR9A 3SKYA 2OA0A 3AR2A 4BEVA 2KMVA 5AW9A 1U7QA 3RFUA 2YFYA 2O9JA 3A1DA 3BA6A 3GWIA 5AVZA 3FPBA 5AW3A 2A29A 3B8EA 5A3RA 2ZBFA 4UU1A 3FGOA 2B8EA 3SKXA 4BYGA 2ZBDA 5AW0A 5AVSA 3B9BA 3KDPA 2A00A 3NALA 3AR6A 3N5KA 4YCNA 5AW2A 3A3YA 3W5AA 2IYEA 3W5DA 5AVUA 2YJ6A 2C88A 3NANA 2YJ3A 3N8GA 5AW4A 1T5TA 1SVJA 4YCMA 2BY4A 3AR3A 4NABA 5AVXA 3WGUA 1IWOA 4BEWA 2AGVA 2ZXEA 2ZBEA 5AVRA 3AR4A 3A1EA 4RETA 3WGVA 4UU0A 5AVWA 3A1CA 1T5SA 3AR7A 3W5CA 2EAUA
chains in the Genus database with same CATH topology
1WPGA 5AW1A 4UMVA 5A3SA 4XE5A 2EARA 4KYTA 4Y3UA 1MO8A 4H1WA 4BBJA 5AW7A 4J2TA 5AW5A 1SU4A 2C9MA 1MO7A 5AVYA 3B9RA 1VFPA 4HYTA 3J7TA 2ARFA 3W5BA 4YCLA 1Q3IA 5AVTA 2KMXA 5AVQA 2YJ5A 2EATA 3NAMA 1XP5A 3FPSA 2C8KA 5AW6A 2ZBGA 2DQSA 5AW8A 2C8LA 2YJ4A 5AVVA 3AR8A 3AR5A 4XOUA 3TLMA 5A3QA 4RESA 3AR9A 3SKYA 2OA0A 3AR2A 4BEVA 2KMVA 5AW9A 1U7QA 3RFUA 2YFYA 2O9JA 3A1DA 3BA6A 3GWIA 5AVZA 3FPBA 5AW3A 2A29A 3B8EA 5A3RA 2ZBFA 4UU1A 3FGOA 2B8EA 3SKXA 4BYGA 2ZBDA 5AW0A 5AVSA 3B9BA 3KDPA 2A00A 3NALA 3AR6A 3N5KA 4YCNA 5AW2A 3A3YA 3W5AA 2IYEA 3W5DA 5AVUA 2YJ6A 2C88A 3NANA 2YJ3A 3N8GA 5AW4A 1T5TA 1SVJA 4YCMA 2BY4A 3AR3A 4NABA 5AVXA 3WGUA 1IWOA 4BEWA 2AGVA 2ZXEA 2ZBEA 5AVRA 3AR4A 3A1EA 4RETA 3WGVA 4UU0A 5AVWA 3A1CA 1T5SA 3AR7A 3W5CA 2EAUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WPG A;  5AW1 A;  4UMV A;  5A3S A;  4XE5 A;  2EAR A;  4KYT A;  4Y3U A;  1MO8 A;  4H1W A;  4BBJ A;  5AW7 A;  4J2T A;  5AW5 A;  1SU4 A;  2C9M A;  1MO7 A;  5AVY A;  3B9R A;  1VFP A;  4HYT A;  3J7T A;  2ARF A;  3W5B A;  4YCL A;  1Q3I A;  5AVT A;  2KMX A;  5AVQ A;  2YJ5 A;  2EAT A;  3NAM A;  1XP5 A;  3FPS A;  2C8K A;  5AW6 A;  2ZBG A;  2DQS A;  5AW8 A;  2C8L A;  2YJ4 A;  5AVV A;  3AR8 A;  3AR5 A;  4XOU A;  3TLM A;  5A3Q A;  4RES A;  3AR9 A;  3SKY A;  2OA0 A;  3AR2 A;  4BEV A;  2KMV A;  5AW9 A;  1U7Q A;  3RFU A;  2YFY A;  2O9J A;  3A1D A;  3BA6 A;  3GWI A;  5AVZ A;  3FPB A;  5AW3 A;  2A29 A;  3B8E A;  5A3R A;  2ZBF A;  4UU1 A;  3FGO A;  2B8E A;  3SKX A;  4BYG A;  2ZBD A;  5AW0 A;  5AVS A;  3B9B A;  3KDP A;  2A00 A;  3NAL A;  3AR6 A;  3N5K A;  4YCN A;  5AW2 A;  3A3Y A;  3W5A A;  2IYE A;  3W5D A;  5AVU A;  2YJ6 A;  2C88 A;  3NAN A;  2YJ3 A;  3N8G A;  5AW4 A;  1T5T A;  1SVJ A;  4YCM A;  2BY4 A;  3AR3 A;  4NAB A;  5AVX A;  3WGU A;  1IWO A;  4BEW A;  2AGV A;  2ZXE A;  2ZBE A;  5AVR A;  3AR4 A;  3A1E A;  4RET A;  3WGV A;  4UU0 A;  5AVW A;  3A1C A;  1T5S A;  3AR7 A;  3W5C A;  2EAU A; 
#chains in the Genus database with same CATH topology
 1WPG A;  5AW1 A;  4UMV A;  5A3S A;  4XE5 A;  2EAR A;  4KYT A;  4Y3U A;  1MO8 A;  4H1W A;  4BBJ A;  5AW7 A;  4J2T A;  5AW5 A;  1SU4 A;  2C9M A;  1MO7 A;  5AVY A;  3B9R A;  1VFP A;  4HYT A;  3J7T A;  2ARF A;  3W5B A;  4YCL A;  1Q3I A;  5AVT A;  2KMX A;  5AVQ A;  2YJ5 A;  2EAT A;  3NAM A;  1XP5 A;  3FPS A;  2C8K A;  5AW6 A;  2ZBG A;  2DQS A;  5AW8 A;  2C8L A;  2YJ4 A;  5AVV A;  3AR8 A;  3AR5 A;  4XOU A;  3TLM A;  5A3Q A;  4RES A;  3AR9 A;  3SKY A;  2OA0 A;  3AR2 A;  4BEV A;  2KMV A;  5AW9 A;  1U7Q A;  3RFU A;  2YFY A;  2O9J A;  3A1D A;  3BA6 A;  3GWI A;  5AVZ A;  3FPB A;  5AW3 A;  2A29 A;  3B8E A;  5A3R A;  2ZBF A;  4UU1 A;  3FGO A;  2B8E A;  3SKX A;  4BYG A;  2ZBD A;  5AW0 A;  5AVS A;  3B9B A;  3KDP A;  2A00 A;  3NAL A;  3AR6 A;  3N5K A;  4YCN A;  5AW2 A;  3A3Y A;  3W5A A;  2IYE A;  3W5D A;  5AVU A;  2YJ6 A;  2C88 A;  3NAN A;  2YJ3 A;  3N8G A;  5AW4 A;  1T5T A;  1SVJ A;  4YCM A;  2BY4 A;  3AR3 A;  4NAB A;  5AVX A;  3WGU A;  1IWO A;  4BEW A;  2AGV A;  2ZXE A;  2ZBE A;  5AVR A;  3AR4 A;  3A1E A;  4RET A;  3WGV A;  4UU0 A;  5AVW A;  3A1C A;  1T5S A;  3AR7 A;  3W5C A;  2EAU A; 
#chains in the Genus database with same CATH homology
 1WPG A;  5AW1 A;  4UMV A;  5A3S A;  4XE5 A;  2EAR A;  4KYT A;  4Y3U A;  1MO8 A;  4H1W A;  4BBJ A;  5AW7 A;  4J2T A;  5AW5 A;  1SU4 A;  2C9M A;  1MO7 A;  5AVY A;  3B9R A;  1VFP A;  4HYT A;  3J7T A;  2ARF A;  3W5B A;  4YCL A;  1Q3I A;  5AVT A;  2KMX A;  5AVQ A;  2YJ5 A;  2EAT A;  3NAM A;  1XP5 A;  3FPS A;  2C8K A;  5AW6 A;  2ZBG A;  2DQS A;  5AW8 A;  2C8L A;  2YJ4 A;  5AVV A;  3AR8 A;  3AR5 A;  4XOU A;  3TLM A;  5A3Q A;  4RES A;  3AR9 A;  3SKY A;  2OA0 A;  3AR2 A;  4BEV A;  2KMV A;  5AW9 A;  1U7Q A;  3RFU A;  2YFY A;  2O9J A;  3A1D A;  3BA6 A;  3GWI A;  5AVZ A;  3FPB A;  5AW3 A;  2A29 A;  3B8E A;  5A3R A;  2ZBF A;  4UU1 A;  3FGO A;  2B8E A;  3SKX A;  4BYG A;  2ZBD A;  5AW0 A;  5AVS A;  3B9B A;  3KDP A;  2A00 A;  3NAL A;  3AR6 A;  3N5K A;  4YCN A;  5AW2 A;  3A3Y A;  3W5A A;  2IYE A;  3W5D A;  5AVU A;  2YJ6 A;  2C88 A;  3NAN A;  2YJ3 A;  3N8G A;  5AW4 A;  1T5T A;  1SVJ A;  4YCM A;  2BY4 A;  3AR3 A;  4NAB A;  5AVX A;  3WGU A;  1IWO A;  4BEW A;  2AGV A;  2ZXE A;  2ZBE A;  5AVR A;  3AR4 A;  3A1E A;  4RET A;  3WGV A;  4UU0 A;  5AVW A;  3A1C A;  1T5S A;  3AR7 A;  3W5C A;  2EAU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...