1SVNA

Savinase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAVINASE (TM)
publication title Crystal structure of the alkaline proteinase Savinase from Bacillus lentus at 1.4 A resolution.
pubmed doi rcsb
molecule tags Serine protease
total genus 99
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1995-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1svnA00
1WMEA 1V6CA 5ARDA 4DJ5X 1BE6A 3VYVA 3A3NA 3DW1X 3VV2A 1GNSA 1TM4E 3VHQA 3DW3X 3LXUX 3DE5X 3DYBA 1PFGA 3DVSX 5AVJA 4NMXB 1SH7A 2ZWPA 3L1KA 2QTWB 4KB5A 1SCDA 3LPAA 1SCAA 3QTLA 2W2NA 1GT91 1SELA 3DE7X 2Z2YA 1GTJ1 1P8JA 3WIVA 2GKOA 1AQNA 1AU9A 1WMDA 2SNIE 4NE9A 2HD4A 1R64A 1Y34E 1UBNA 3EIFA 2G4VA 2Z58A 4CG0A 2Z56A 2PQ2A 3P5BA 1PEKE 2WV7A 3WIUA 4Z2AA 1GTG1 5FAXA 1KDYA 1SUCA 3I2YX 4MZDA 4KG7A 3GCWA 4J94A 4ZARA 1GA4A 2WUWE 1ZVJA 3DE2X 1AH2A 3QFHA 4ZOQI 3DE6X 1BJRE 1T1GA 1SUAA 1ST3A 3TI7A 1Y33E 2X8JB 2PRKA 1SIOA 1HT3A 2ST1A 1R6VA 1C9MA 1GNVA 3PTLA 3DE3X 1GTL1 3DVQX 3DE1X 1MPTA 1Q5PA 2E1PA 1TO2E 1Y4DE 2W2OA 1PTKA 1KE1A 3PRKE 5JXIA 1IC6A 3H42B 5ARBA 3F7MA 5AQEA 2ID8A 4AKSA 4RYDA 4WOCA 3A3OA 1SVNA 1T1EA 3SQOA 4C3UA 1TECE 1NDQA 1DBIA 1OYOA 4C3VA 3F7OA 2DP4E 1AK9A 4JP8A 3DWEX 3TI9A 1SUPA 4H6WA 3VTAA 1TO1E 1XF1A 3D9QX 1S02A 4CFZA 2XRMA 3CNQS 2XTJA 4OMCA 1SIBE 1PJ8A 1C9NA 2Z2ZA 3GT4A 2ID4A 1CNMA 2IXTA 1SBCA 5I9SA 1KE2A 3BGOS 3OSZA 1P7WA 1T1IA 3QMPA 5B1DA 1TM5E 1NDUA 3BX1A 4FONA 1SUDA 2Z2XA 3UNXA 4BWGA 4DWWA 5SICE 1A2QA 1YJAA 2ZRQA 3HJRA 3EDYA 1Y3FE 5K7SA 2WWTA 1SCNE 3I30X 2B6NA 1SBIA 5JMOA 2HPZA 3TECE 5B1EA 1Y4AE 3Q5GA 1VSBA 1SN7A 5JXHA 3DDZX 2Z30A 4I0WB 1GCIA 1WVMA 5FFNA 2PWBA 1ZVKA 1SBHA 1EA7A 1Y3CE 4WOBA 1P7VA 3T41A 1OT5A 1Y9ZA 4LVOA 4KPGA 2P4EA 3CO0S 2W2MA 1SCJA 4CFYA 1GA1A 4AKTA 2Z57A 3AJ8A 3LPCA 3I34X 1SUEA 4OV6B 1YU6A 4H6VA 1S01A 1TM3E 1ST2A 3DE4X 1TM1E 2PMWB 1Y3BE 1SPBS 3VV3A 4YN3A 4OMDA 4LVNA 1CSEE 2DUJA 5CW1A 1AVTA 5JXGA 3WHIA 1Y1KE 1YJBA 1TM7E 2PWAA 1OYVA 4M1ZA 1IAVA 1LW6E 1Y48E 4NE7A 1Y3DE 3ZXXA 4HX2A 3GCXA 5JXJA 2SECE 1SBNE 4B5LA 1SBTA 3AFGA 1DUIA 1GA6A 2V8BA 1BFKA 5AMXA 5AVKA 1SIUA 1SCBA 3GT3A 1MEEA 3Q40A 1BFUA 1TMGE 1V5IA 3LPDA 1TK2A 2W2PA 3WQBA 3EE6A 1SUBA 5FBZA 3A3PA 1S2NA 2SICE 3I37X 1WMFA 3F49S 2WUVA 2DQKA 3SICE 1JEAA 1C9JA 4H6XA 3VSBA 1KDZA 1NLUA 3D43A 1C3LA 4DZTA 2IY9A 3DVRX 2SBTA 2X8JA 4GI3A 1EGQA 3BPSA 1AV7A 2W2QA 2PKCA 5ARCA 2TECE 1AF4A 3DE0X 1THMA 1KDVA 1R0RE 1BH6A 1WSDA 4K8RB 4HVLA 1YJCA 3ZXYA 2ZWOA 1BE8A 2PYZA 3AJ9A
chains in the Genus database with same CATH superfamily
7GPBA 3KELA 5CK5A 3UJNA 1JDTA 4CLOB 4XPIB 2VAMA 3ZZUA 4Y9DA 1FU4A 2GASA 2IY7A 2D5BA 2WFLA 1N5KA 1NNUA 3QYPA 4CQMA 2O8EB 2OO3A 1UKZA 4HX5A 3ZY5A 4XA8A 1RHQA 1Y6QA 5BR7A 4M6WB 3SGLA 2JHPA 4DYHA 1VFPA 1NBAA 2C5AA 2GA8A 3ASZA 4LIPD 3RS8A 4DGQA 4HB4A 5HCIA 3DYBA 5E0KB 2IYYA 4LFCB 3RO7A 1Y7TA 3CVOA 3AEKA 4M8LA 5K8VA 3KQLA 2WHXA 3SFVA 1WULS 2BLLA 5JT1A 1B4DA 1FXWF 3F67A 2I0FA 5DDIP 3ACDA 1F51E 3H5AA 2GR9A 1CQJB 2GPSA 2VVTA 5CR9A 1AKYA 5J4YA 2I87A 1XTRA 3KFVA 2QSJA 1ITZA 1R4MA 4R9VA 1NTRA 1SH7A 4IQGA 3M7IA 4L1KA 2C61A 2DC1A 3T34A 3GLRA 2ZB3A 4PTZA 2W8BB 5EMLA 1I4EB 3MCTA 2ACWA 2PK3A 3I1JA 4PSUA 3AL0C 4IEFB 5J4VA 5FH9A 3MC1A 4JOBA 2JI9A 4QLOA 5JVDA 1VPTA 3HUEA 1Y8RB 4JX9A 1PZHA 4IGKA 1R0LA 4OJQA 1QQTA 1BS9A 1X7XA 5G3YA 1ZL2A 3ETJA 3V7FA 4AJIA 4RVHA 1KKMA 1KTVA 1VCIA 2I2XB 2ORVA 3EMDA 2DY1A 3KOWA 3BN3A 1XTBA 1EFVA 3FCEA 4UDYX 5JCJA 3VDMA 5K0TA 5KYXB 2NTNA 1EDZA 4HWSA 1OASA 1M76A 4MPRA 4L78A 2WIAA 4MV0A 3K0FA 2GJSA 1RHJA 4FYHA 4U0KA 4ARUA 2P6OA 3BKWA 4P7GA 4QXPA 2PMCA 1Z6QA 4OUDB 4EH1A 4EATA 2AI1A 2HC9A 3HKEB 4UM5A 2X2FA 2A67A 2AZDA 4AQDA 2NN3C 3USZA 4RVCA 1QFXA 4ND8B 3UM9A 5FBWB 2WKSA 2LCFA 1JQ3A 2AOWA 1E9VA 3M33A 3W04A 3O95A 4B33A 1IMOA 1C4XA 4KUGA 3NOOA 3TUIC 3L7OA 1EP9A 1R7RA 2FW0A 2JBHA 1KVQA 4AVYA 3COSA 5M29A 1UEIA 2VEDA 4Q21A 1E2HA 3DFFA 3MUFA 1H2FA 1QYVA 5JIBA 1OZ0A 3HO6A 1DT3A 1NMZA 1QR2A 1SXJE 5EMHA 2I1LA 3ST7A 4D9GA 1NVDA 2BWJA 2FKAA 2P7IA 1HRKA 3H2HA 1CNFA 1I2MA 3WFJA 3WLSA 1USVA 2CMDA 4OQNA 2VHCA 2O07A 1FZQA 1OPRA 4UUMA 2NZJA 1KDYA 4W5QA 3BWYA 2R6ZA 3WYAA 1XLWA 3CX3A 1ZXLA 3HLKA 3MWLA 4CQLA 4PPNA 3OOWA 3INRA 3GGJA 5DNCA 2C2YA 2ZBQA 2I03A 2AX4A 3JQ9A 1Q50A 3L6EA 4NQRA 5EOVA 1Z7EA 3IRVA 3PC2A 1X8LA 4DLUA 5CRIA 3EQ7A 4LG1A 4KG7A 3B2EA 4KGDA 2X15A 3KM0A 3CQ9A 3L1HA 5DTIA 1LLDA 3PXDA 2DETA 4S12A 1KAEA 1RLOA 2R6GA 2WD9A 1TEXA 2WUWE 3GI1A 3MLAA 3UBTA 4XH9B 4JCOA 4MVJF 1LSOA 2FPIB 4ETMA 4RSMA 3VR6H 1NLZA 1UDCA 3PR1A 4BGVA 3L0SA 3V80A 1V1MA 4US1R 2VQEB 2HA2A 2XCIA 1D2RA 1S4MA 3E2IA 3HEBA 3P8ZA 5DMHA 2F6RA 2PKQP 1VL5A 1DX4A 3G6KA 1AT1A 1HR0B 5DHRA 1U0OC 2EATA 1TCAA 2GARA 3QVLA 5LBIA 1HRDA 1UP4A 2IPXA 4LDPA 2QJOA 3WDMA 2N9UA 3C4QA 4XJTA 3UIEA 3ZTTA 2PIAA 3ZD8A 3K0CA 4GU5A 3QU9A 1XMXA 3Q7SA 4G2NA 1MH1A 2WJHA 3AHFA 1CK4A 1C2TA 2D1FA 1KZ6A 2AMVA 5KVVA 1FUYB 5EJ2A 4FSXA 3KTFA 1MNAA 1KC3A 1PJ2A 3VU3A 4UQLA 4L74A 1NULA 1S8NA 3NTRA 4B76A 4OREX 5ALSA 2GSWA 4A10A 2GHQA 3OCWA 4TVSA 2OZEA 1SBYA 3R2JA 1F1JA 3RVMA 3DD1A 4R0VA 4NZMA 1H5QA 1R37A 1IM8A 4DSUA 1UQTA 4BP1A 3HJFA 1TO2E 3ZK8A 1N2EA 5AUPB 4KSBA 4MW9A 2Y2VA 3TLBA 2Q0XA 3VZSA 4J0KA 4WXPA 4Q47A 1I94B 8MHTA 6AT1A 2QMYA 3KJFA 4PV7A 4R1UA 1E9AA 2JS7A 1K3FA 1CJKC 1G2QA 2H8KA 2DFNA 2BGWA 3PR3A 3EZXA 3LHIA 1HQKA 1B1AA 3ENWA 1VLVA 2JD0A 1U2GA 3IJPA 4H16A 3ROFA 3TQTA 3WXBA 4PO1A 4BIIA 1CR2A 3WGUA 5A4AA 4OYLA 1X7ZA 1EAYA 1ECGA 3AR4A 3ETDA 4BNHA 2BKEA 4ILKA 4OKSA 3DV0A 4RENA 3A6LA 1WLYA 3HA2A 4MQLA 2ZSEA 4YMLA 1O4WA 3PFFA 4WOCA 5GGYA 4HMQA 4QLBA 1OQAA 2AUMA 4XYLA 3VI4B 2D59A 5F73A 2YC4C 3UVEA 5TPWB 5AKXA 4EG5A 3B9RA 4IWNA 5EJFA 1SWVA 4JMPA 1E92A 3EAFA 3O3OB 3UGKA 3EXFA 2L42A 3SXJA 3JASA 5JVDB 3BB4A 3WRYA 4D9FA 5JMWA 1DBIA 4BQQA 1QK5A 2BJVA 4IIYA 1U0EA 3U3KA 4EUKA 1CRWG 2QN7A 4II2A 4LHYA 4YHBA 2CFCA 3ZU6A 1X7XB 2WRZA 2ODBA 3IQWA 4JMLA 2HU5A 3RIHA 2X14A 4B4WA 5D5QA 1TCUA 1EFVB 1N5DA 1HDEA 1QG2A 3IAM1 4WOPA 1YZVA 1XHFA 1RXIA 1T9HA 1ORHA 2YZGA 2NXCA 5IC4A 2WW8A 4W1PA 5AVSA 1QC5A 1C9EA 2WEKA 4W8OA 3MAAC 2E55A 4BMNA 1TADA 2XD4A 1FB5A 3H65A 2RHOA 4INZA 3OA0A 4PRZA 3WOHA 2ENUA 3VKGA 2ZE8A 4AJ4A 1YBMA 1MOQA 1QORA 4ROTA 4Y6OA 5EJAA 5AVRA 4DVGA 4GDFA 1TAUA 4OI1A 3O3NB 2YS6A 4ZV4A 1YHYA 2MIIA 2VFAA 5BXYA 1T4CA 4F3TA 4HQFA 4BLRA 4XGQA 3DZIA 3ZHBA 2I3BA 5K8IA 5LQUA 1Q1AA 2EJVA 5IXJA 1FDSA 1G7TA 1L5SA 3SVZA 2DCUA 5IM5A 1DKRA 3C8ZA 4OQYA 3CKYA 3EZGA 4H7EA 2ZG6A 2AZXA 2P1RA 1YI0A 3DWIA 1WKBA 1E59A 1Q6YA 1VPLA 2QR2A 4M89A 4XOUA 2D54A 2RAUA 5B53A 4FONA 1HNZB 2OAEA 4BWGA 5FLYA 5AW5A 1Q77A 1J0XO 1R5NA 1RQGA 2ZUDA 3LQ2A 4MVJA 5T6BA 4N6OA 1PHRA 2JFHA 2HDNB 1Q0SA 3G17A 3LHSA 2FW9A 4RY2A 1W8DA 1TUEA 1GSIA 1E77A 3RVDA 1M8PA 2JAUA 4D4KA 4P3OA 3OEHA 3OESA 4KKVA 4CQLB 1L4HA 4CG2A 3FGZA 4U1RA 1I32A 4F71A 1JA0A 1CR4A 1JRLA 4P4SB 1ZZGA 4F3KA 3SVLA 2X0RA 2Q4EA 1D2NA 2X9LA 4TWBA 3BD6A 3H5WA 4NH0A 2JC3A 3LTNC 1X3SA 3U13A 1T2AA 3ILXA 5C7IO 3ZEIA 3L6UA 1RQ7A 4KO2S 3DL4A 1VSBA 3FVTA 3CLVA 1JIXA 3PP8A 5E2IA 1UEJA 4CKCA 1GCIA 3OC6A 4R8SA 2B8TA 1RQ2A 1T8PA 3F9IA 5E1MA 1X42A 4JP5A 1B73A 4IV8A 4R3NA 2FA9A 4TYWA 3G1WA 3C41J 4IYJA 3A8TA 4ZOAA 1OXKB 4BUJA 3LBNA 1GARA 1OT5A 3QU5A 4TT3A 3THRA 5I47A 3L7LA 1KU0A 3EIWA 5DNYB 1WNTA 1X1SA 4MWOA 1CR1A 4AG5A 1GLVA 2Y66A 1PU2A 1PR6A 1SR8A 2H31A 4X24A 2Z09A 5FAKA 3WLEA 1EFTA 1ENPA 2VHTA 3LBYA 1A5BB 3EVEA 4Y2PA 4ZVPA 3RT7A 2PMKA 5F5LA 1MQ9A 3MTGA 4GBED 2QRPA 4R1MA 4FNAA 1MABA 3OO0A 3V55A 4EIWA 5GZ1A 3GARA 3M34A 4IINA 1ATZA 1T24A 3K16A 4OXKA 5EUBA 1QIHA 3CNHA 2PTHA 1OYWA 2QLFA 3L8DA 3C5WP 3Q7RA 4OQLA 4B4UA 3S5JA 3BQ9A 1FTWA 2FRXA 1O6CA 1ZUD1 4KRYA 5TVKA 3CR8A 2B35A 4M87A 5EUQB 4Z0TA 4NMLA 2GBIA 4MCJA 1DKUA 1H0KA 2HKIA 3W9SA 5JNRA 4TKLA 5JZSA 2ZRJA 3SZLA 4P5EA 4W6ZA 1R66A 4BNYA 4FB5A 4MEJA 2YJ3A 4HXFB 4ZAFA 4AZSA 1IZZA 2WJPA 4F45A 5HJ5A 5IJ0A 5LKRA 3V34A 3C1UA 1EM6A 1Q14A 1QVZA 2VNIA 3H0KA 4P86A 4EPYA 2QN8A 4LMBA 1ODTC 3GK3A 1WE2A 1NFFA 4LVNA 3RS2A 5C5DA 3CBQA 1DNPA 1L7RA 1YB2A 4O0LA 4W8HA 1ADFA 2HRBA 3R5SA 3U39A 2EQ5A 3DT6A 3DXZA 3DV0B 4BQSA 2EJCA 1P9LA 5EJ7A 2I3AA 4ZMBA 4IIHA 1TZJA 3UMGA 4CI0B 1E9FA 2FKNA 5C32A 3NO4A 4M86A 2I6GA 3AVXA 2PBFA 3K9QO 4PZDA 2JVKA 4QASA 3QVOA 4E32A 4ZQBA 3PHLA 3UTCA 3TRHA 1EAMA 2E49A 1Z4PX 1T3ZA 2CLSA 4BMZA 4C01A 1JG2A 5CVUA 5AW3A 5A3VA 1IAVA 3ORFA 3PGXA 3EXFB 1RPAA 1H05A 4YUWA 2YFQA 3JASB 4YJ2B 3WYFA 3ZY3A 2Q27A 3K9GA 3MG9A 4RMGA 3U4AA 3QSGA 4BLPA 2COUA 3GBSA 4JR0A 3VKWA 4X9XA 2B34A 4H6PA 2EW8A 1NG9A 4MITA 2ZB2A 3IVGA 5IHXA 1ADBA 3KK0A 4ZRMA 3EOAI 5C4GB 4MARA 3KWJA 1KETA 4B5LA 4BB0A 5TY0A 4JB2A 2VDUE 4N9QA 3MYRA 3AVUA 2QRQA 4I99A 1VYUA 4OOFA 1QC5B 2C96A 2HY7A 3NC4A 1B14A 2QW1A 1QHNA 4LKOA 4ZICA 4YXFA 4MWSA 4A8JA 1GIAA 3IKMB 5TARA 3VR0A 3RAJA 1NYQA 3ZHQA 1K27A 4IXDA 4QU5A 2W0SA 4Q3CA 4YRCA 4ZCSA 2AOUA 4UZEA 3TSOA 2RGAA 3PXGA 2FI1A 3R77A 4J1QA 1T4CB 2ZCUA 4NZZA 1MJNA 2YJZA 5ALEA 3PHJA 3PYLA 4K05A 2ODEA 3ZJUA 2VDOB 1U7PA 2J67A 3DLTA 1OVMA 4H9GA 1BFUA 1W4ZA 5G1OA 1Z8FA 3IAS6 2R7AA 1R2QA 2PKWA 1WVIA 4MXDA 2XKJE 2PQ6A 4K6FA 2E4WA 3B82A 4LOLA 2Q8NA 4N3NA 3RVLA 4K6OA 5CVDA 5C53B 2XB8A 2QX6A 2WT9A 1QO0A 3WDSA 2I2WA 1S2NA 1JDVA 1ZCAA 2A9FA 3QLEA 4MVJH 2XZPA 5TDHA 5DO9A 1P39A 1DS6A 2R84A 3UWPA 2EFEB 1L5VA 3F49S 2XR1A 3DONA 3P26A 4P4NA 1AQUA 4TL9A 4D02A 3KXDA 1HQCA 1Z0DA 5CCBA 1C9JA 5FYQA 1PJ3A 4YUXA 4NCBA 2IU3A 2Q62A 2DFPA 5IJXA 4OL9A 1ILEA 2VSXA 2I66A 2OGWA 3TKYA 1Z2CA 1RXSA 2JDIA 1V4BA 3G59A 3Q6NA 3U3RA 3EGCA 4ZJYA 2IDZA 4QOEA 2HBZA 5DGXA 3EVFA 3KVNA 3PFBA 5F4BA 2I1WA 3VR4H 3S99A 3FFWA 1K75A 3MMXA 4GKVA 2PX6A 4KE9A 1P7PA 4MJLA 3K09C 3LL7A 1W4BA 4DY6A 1IBLB 3G2MA 2GD0A 3EPPA 2CMHA 1PD1A 3L8GA 5CP8A 3WL5A 5C2JB 4CKCB 1FEZA 3QWAA 1Y4ZA 3DB1A 3FI0A 4GI3A 5B4TA 2FQYA 1XPOA 2I6XA 3A14A 4RTOA 1U7OA 4X91A 4ARIA 1KOGA 2BZGA 1Y7HA 4HSEA 3H2YA 1YBAA 2VSNA 2X2EA 1DKPA 4IKEA 4P53A 4WECA 3LQ4A 1W49A 2C9YA 4X3PA 2MCFA 3WSVA 2XXAB 1GRVA 1DV2A 1OD6A 3I32A 2R6FA 6GPBA 4RHUA 3C43A 5ENVA 1BH6A 1WD5A 1G9TA 5FUMA 2C2OA 3ZXYA 2QUAA 4B73A 1S2DA 1JHQA 3ND5A 4X3OA 3P2OA 2V4MA 3H7AA 4KE7A 5K6RA 4G9BA 2VNKA 1LLQA 1GP2A 1SD5A 1TK9A 1DEKA 1Y9EA 5ARDA 1UPUA 1MCZA 4M9QA 5AI0A 5C1IA 5SZIA 2IS1A 4DJ5X 4RY0A 3OPYA 3ZWNA 2ZE5A 2XUQA 4JL8A 4QAJA 4TV9F 3WB1A 5EYPB 3BCSA 3JYHA 5K3AA 3R7LA 4OL0A 1KOLA 4E1VA 3AL3A 1SQ6A 4MZXA 1TM4E 1V7ZA 3BRSA 4GG1A 4HRAA 5LDGA 2FPKA 2EIXA 2NM0A 1V1RA 1H4VB 3RRZA 1CT9A 1NLFA 1DJLA 1G7RA 3EBPA 2X8LA 4QIHA 5BSTA 4IOJA 1NPYA 1JN0A 3FRIA 3K6KA 3NYIA 1JAZA 1KMMA 3TB6A 3H0EA 3KPWA 2QPTA 2CN1A 2UV8A 4YK7A 4IQ0A 5IEBA 2DLCX 2R96A 3VNUA 5DM1A 3QYFA 4JLWA 2YL2A 3ZDYB 3REGA 4J07A 1T5IA 1ZINA 3DEFA 1GU0A 3IQIX 5T3UA 1UXKA 1XLVA 4NZNA 3THXB 8AT1A 3QF4B 4DR5B 4BZXA 2A35A 1JE0A 2FOLA 1K9VF 2OXEA 2V5UA 3HYRA 2O8NA 1SOVA 3JSXA 1SELA 2XBUA 1GUBA 4LI0A 1HM5A 1Q0UA 4KIUA 1ZMXA 5FXMA 4L5JA 1UK8A 4MYHA 3LWZA 4KBFA 3EY9A 3QQPA 4C14A 1EVZA 2RGRA 4ENQA 3EFBA 2P9BA 3OJOA 1X0VA 4EKYA 5CGZA 4IUBS 3L05A 3KEFA 3CUYA 3MAJA 3N0RA 2FR1A 5SZHB 3SIRA 3T1YB 5I8PA 2REBA 1WX1A 2FN4A 4M36A 1XL0A 3PJEA 4DY4A 5KDOA 4Q3KA 1Q74A 3LRPA 4YDSA 5CAEB 4S0ZA 5FLEX 1ZJJA 2CK3D 5TQ2B 4JLOA 4K9SA 2G9UA 3CRMA 2MSNA 2F3SA 1Y5RA 3AF4A 2ZBRA 3IAM6 3RIXA 2QSUA 3NJRA 1VSVA 3E7DA 2RGXA 4CCSA 4LFAB 3TD9A 3ODGA 4A8JB 3TXAA 4UNSA 1PKXA 3MJCA 4YONB 3DAGA 2Z56A 1CULC 1F8FA 4I46A 4O2BF 4ZJUA 5BN1A 4KR2A 2FYTA 3EHEA 1DLJA 1OXVA 4B45A 2NO7A 1VMDA 2ORED 3T5GA 1BQEA 5A5EA 1T5TA 4Z53A 1KP9A 4J0HA 2CKDA 1HDXA 2ZVQX 3NGLA 4LQLA 5C80A 3PX7A 5FAXA 1CQIA 3KR2A 1GFWA 3CZCA 2C4TA 3EC1A 1D2EA 1KIMA 5HKLA 4DREA 2QZ4A 3LVBA 5MN6A 4MWBA 2DU8A 3QOYA 4LJRA 4EF4A 3E35A 2CXUA 1FVOA 2XGJA 2WA2A 4RXMA 4A6DA 4EW3A 4E07A 4TL6A 1AKWA 1NOJA 5DOVA 3KUCA 2IDMA 1CRPA 1F48A 1J49A 1RKQA 4HNAB 1ZSYA 1SVIA 4FZ5A 2QUJA 3GMTA 3K1AA 1XG5A 3LI2A 2GERA 1WDMA 1F4VA 1R6DA 1SC9A 2Z8XA 2PFGA 4I2NA 1ULZA 4DUGA 2E37A 2WHQA 3FKSD 4I14A 1K3UB 1RMTA 2AD1A 4GZ5A 2CDAA 4ZARA 4JQOA 2Y9PB 2FMXA 3I9V6 5CHYA 2QT9A 4WACA 1T3LA 1JDUA 5FV7A 5JISA 3CW8X 3S3TA 4L9WA 3PD1A 3S70A 3B53X 1ZUIA 2JG3A 2C77A 2IUYA 5DYTA 2DPHA 3BRWD 4YWHA 1GG2A 4O2RA 3ISVA 1ZITA 3M4XA 4DDTA 4EYGA 1V26A 4RTKA 1C0LA 1POWA 2V7TA 2JLYA 2VHXA 2WQ7A 1UFRA 5TMBA 4TV9A 3HR7A 3LT5A 4D8TA 2YJ5A 3V4SA 3O2SB 1CUEA 1R4NA 2QM0A 3EG9A 2XIJA 4WZBA 3Q2KA 1JKIA 5KOIA 1SVKA 3DVQX 1QNLA 2Z2KA 1NP3A 3KLPX 2WWYA 1DWUA 4ZVQA 2E48A 2GZRA 3B6IA 1LA2A 4TMXA 3R76A 4W9MC 2FJ0A 1IVNA 2HWUA 3IVCA 5JADA 1A98A 3MMZA 3I4FA 1CUVA 2HA4A 1E1DA 3W2HA 4FLEA 4KMMA 1HXHA 3PK0A 5KIAA 1I0IA 4ZEMA 4BN4A 1PTKA 2DFDA 3H18A 2PGXA 1Q1GA 4KR6A 2YWJA 4YASA 2ZBDA 2FE4A 2JJ2D 3EAQA 4QFCA 3WMXA 5GP1A 1OTYA 1INLA 1RLUA 3H16A 1L1QA 2H1FA 3COZA 3N76A 4N3AA 2XDQA 3DZHA 3QKRA 2HJVA 3GAFA 4GGOA 4LZWA 5FUXA 1T25A 1XP8A 4KW7A 5CPFA 5DTEA 4EITA 1KO8A 2JAOA 2JD2A 4FFSA 2QVLA 3UJHA 3RVOA 3F7MA 4WK6A 1Q20A 4PYRA 4M1YA 5DI3B 1W75A 3OEEA 1K6MA 2RGNA 3AUXA 1V1RB 3VGJA 1SD1A 2GFHA 2QENA 2O5EA 4QDJA 3CUTA 3ZBTA 2LE0A 2NADA 1V8ZA 4BX8A 3HSSA 4X92A 1D1TA 1LLFA 4Q4HA 5GM2A 2R9VA 3AU9A 3IALA 3KCQA 2EW2A 5IUKC 1C9YA 3G5MA 2OT3B 4PRLA 5BV7A 3ZDCA 3S2SA 2QKYA 4DCPA 2IUTA 3RVSA 1M73E 4ENTA 1NC3A 4H3KB 1XZLA 1D4ZA 1F06A 3VVBA 1X3LA 4GQBA 1TECE 2Q0HA 3VYUB 3B3FA 3PXEA 2H1HA 4FIDA 3EYAA 4JB0A 1JR3D 1W6RA 5E6RA 3OJWA 1MQ8B 1KOJA 1U2QA 2GBPA 1AK9A 4JP8A 1K7EB 2EKQA 3B1VA 4MAAA 3R0QA 1YR6A 4AF7A 5FRDA 3K1YA 1OX6A 1MQSA 1NU6A 4R5MA 4EVIA 3LYUA 2V6BA 5EZYA 4WV3A 4EKDA 5DYWA 3MJVA 3RU2A 3O6VA 3TX6A 5IANA 4CV0A 1G1AA 3GLVA 2WHYA 5IDQA 4G5HA 4MKZA 4NZ9A 4MGHA 2O6LA 3TM5A 2IW1A 3AXTA 3KJHA 5BUCA 1C1DB 3MOIA 5KTOA 3GDHA 1N32B 4DSZA 2PYIA 2J0EA 5U9CA 4BNNA 2NQ2C 2XZLA 4NV1A 1JEOA 2FPGA 2Y76A 3I2HA 4YCBA 3UEOA 4EGFA 4ZTZB 2VAVA 2ID4A 1VIAA 3LE8A 4POOA 5C8ZA 1Y6FA 2VUUA 1P18A 2I67A 4WNYA 4UU8A 3WV4A 2BD0A 3ROZA 3BFJA 5JS6A 4X95A 2O3RA 2ILVA 3H6GA 2A9JA 3PVCA 4R1SA 4WX2B 2WFAA 2ZRPA 1NXSA 1AZLA 4BPRA 1T1IA 2A9QA 1H1TA 4UVHA 4JJKA 2I8LA 4KKXB 1DX6A 4PFJA 4UM9B 4RVFA 2HJGA 1J21A 3GWGA 1JU4A 4UMVA 3WQSB 4MJXA 1EWRA 4I9HA 1ORWA 3LYLA 1QYRA 2OCBA 2A8YA 1JEEA 3GNLA 4LMPA 3UJ9A 3WRXC 4DQ0A 1MO2A 3X43A 4YCJA 1R0KA 2HXGA 2Z95A 1GPH1 3IJRA 3EPJA 5K2OA 1GDHA 3FSRA 1TA0A 2DSNA 2H6EA 2ONCA 1YONA 3D8BA 4GECA 4WVFA 3UB2A 3VOSA 2AEMA 1CQZA 2B94A 4WUVA 4YY3B 4H0CA 2IS4A 2OR3A 1T0JB 3C6QA 2K7ZA 4N5NA 1A4XA 3UQYS 4BNKA 3AETB 3IV7A 1WMSA 2JFWA 4U6SA 3ZIAA 5EIAA 4DMUB 2J07A 2I91A 5FOTA 3ZEAA 2NAPA 3K1AB 1C81A 1EIWA 4MO2A 1SWWA 4K81B 2WVGA 2RSLA 3JTEA 1KF0A 1YHNA 2QS9A 3FWPA 2FSHA 1L7XA 2PHZA 1AZWA 3CIOA 4KXQA 5CD9A 3SVTA 5AVTA 3N7UA 1XNQB 3ESZA 1EHYA 4X63A 1XPJA 2JHFA 3T5TA 3MJ4A 4ZHQF 1X87A 5ALWA 3HI6A 3ZN2A 1Z3IX 1Y5IA 3KX2A 1OAOC 1JIQA 2PWBA 3IA2A 3LUDA 3KUKA 4JNCA 2Q6LA 2WTEA 5SY6A 4JI3B 2UAGA 3KFLA 3AHEA 3M70A 3C3CA 3MERA 2O7RA 3A70A 3L6RA 4IDBA 2R3SA 3VO8A 3T5AA 3L7AA 1YQGA 2JATA 1OZGA 1FFGA 4JYCA 4F5EA 4Z4CA 3I6YA 3TRDA 1K92A 3JQBC 4H27A 2ZJAA 4J3NA 2C2BA 5AVUA 2A4MA 4BWVA 3PFCA 1F7VA 2XPCA 4JSRA 4OP2A 1XDZA 1PUXA 1OUMA 1PNQA 1I2BA 2AQHA 4P98A 5CVVA 1KQ3A 4LX0A 1GA1A 4JUIA 1MJ5A 3KJZA 4KPFC 2A5LA 2HPVA 4IDDA 5HFJA 5HIAA 2KB0A 1KQGA 1DBVO 4HTFB 3AJ8A 4MROA 1RAFA 1DGQA 2ZGVA 4L7QA 4ZOCA 1KI7A 2I8AA 3FTPA 4XARA 1BWSA 1GUAA 1IFXA 2BKUA 3FHOA 4OV6B 4F21A 5IAOA 1Q3HA 4ZT4A 2PM8A 3SXUB 2VBIA 4L27A 3NCHA 2PUBA 3JQPA 2YFYA 4I50B 1ZLYA 3DYIA 2WPDA 3OETA 4ZK6A 1A8SA 2PMWB 3GVCA 4J49A 2X0NA 4AJHA 3DKIA 4MUGA 2NOAA 2IYFA 4GLLA 4B5KA 5FT9A 3OOJA 1YQEA 2XDQB 3QKRB 3O8OA 4P35A 1WW2A 1D4AA 4FR5A 5TS3A 4IJ5A 4MQ4A 4I4NA 4A91A 5BSFA 3DBHB 3BJRA 1OLSA 3D8NA 4RD1A 5EFZA 3OLZA 2SKCA 4Z51A 4UTNA 3HYNA 2ZE6A 4OLAA 4OX9B 1L4BA 3EZ2A 3ZD9A 1OU4A 4NNJA 4KR7A 4AUNA 1Z62A 1UZAA 3C6BA 1JAXA 5BW6B 5A5GA 4IUYA 4DMFA 1N3IA 1VGRA 4XGKA 4TLBA 3G0HA 1E7YA 4FOLA 1ENYA 1XNHA 4Q4HB 1YDGA 3JQRA 3NANA 4JI0B 5FCDA 2FEAA 3BIJA 2J0UB 3CX6A 1F20A 1YB1A 3MT0A 2OM6A 2QPLA 3DT9A 4ZVOA 1JHOA 2WU8A 5AW2A 1PBNA 3CF6R 1BVUA 4QBKA 1BEEA 1KAGA 4Y2VA 3WNZA 3ND8A 5BYAA 3KT3A 1B3RA 2H17A 2IYOA 3H7IA 3BDIA 2ZETA 4K5QA 4LDAA 1EHIA 4M37A 4BKMA 1D5CA 1TKAA 1SY7A 2QTLA 4C89A 2ZZNA 4LXUA 1KZ4A 3D6TB 4RD0A 4DLLA 1O6GA 2X86A 5LLSA 2CZCA 5HIIA 4CUKA 3HO1A 2DWUA 1VJGA 2B0CA 2PVPA 2HJ9A 3GP8A 2YJ4A 1K7FB 3DLCA 7AT1A 3AR3A 3O1JC 1V16A 2WG1A 3JARA 4G0OA 3ZWMA 5IT0A 5EZYB 3AFGA 2CGEA 2PD3A 1P6QA 2R6AA 4FFBA 4FPXA 5LYJF 2DUMA 1R6BX 1ZJ4A 4QHSA 3SE7A 2CDCA 2DSTA 1N34B 2JARA 5AOBA 1KEUA 3NAMA 3EH1A 5KQLA 3AKCA 2JI4A 3HDYA 3S2YA 2FPGB 5K3CA 3RSQA 2O4CA 3CKLA 3O8BA 2V7XA 4FGWA 5DLPA 4DCGA 2LV8A 3LP5A 4YLEA 2Q99A 2WWGA 1RQRA 5JD5A 1B8NA 2UDPA 3ANNA 3E5MA 4OJMX 4OJTA 1Z0UA 1KO7A 1O89A 1WUJS 3WYEA 4QYSA 5BSVA 2O2CA 1A8HA 2WWIA 4C4XA 5KC8A 4CMEA 1E2JA 4XSGA 5AOAA 5TXGA 4JT2A 5DHFA 5AHKA 5JC8A 3LHFA 3RK0A 4U2DA 1CC1S 1QO9A 4PLTA 2GZAA 2DH5A 3DWGA 4I5EA 4E30A 1OBHA 2NUPA 1W581 2SICE 2XV1A 1QKJA 3AF2A 4QYIB 2BI7A 3TH5A 3E9ZA 2Q3EA 4LXQA 4B3DA 1G3UA 3ILYA 4MPJA 1NNEA 1FBNA 1N1GA 5PGMA 2LUOA 3O0DA 2QA5A 3KPJA 4L7VA 3HDVA 2C7BA 2C9BA 3KAJA 4MQEA 1SUSA 4BBAA 121PA 4G5OA 5B2EA 4I1SA 3WMGA 4GMGA 2KBFA 3KYBA 2JHGA 4AZ0A 3K72B 4QRIA 4X66B 2DMRA 2WD8A 1EXMA 1NYRA 4FXPA 1AD2A 3DFUA 2PKXA 2WG0A 3BXZA 1Z2AA 1B41A 1G17A 1ENOA 3FA2A 4HQRA 4KIGA 4NZOA 4CT4B 3OC0A 2B0JA 1NOIA 1KY3A 3CRRA 5BN3A 3UANA 1SAYA 2RI6A 4FGUA 5KYGA 3N8NA 4R0NA 1FTSA 3TQIA 3E1SA 5FBRB 3OTQA 4EW2A 1NJSA 4YJGB 2BT4A 3I64A 3OQBA 5JV5A 3D4BA 2HQOA 2I4IA 3MXOA 3WL8A 4Q00A 3N87A 3ZW8A 4FE4A 2R4UA 5GJCA 3A26A 1FTNA 4WOKA 1FFXA 1JR4A 2D13A 3LC1O 5FLKA 1BMDA 1DAHA 4RQTA 4AY2A 5HBGA 3JRWA 4BVHA 1P0MA 2QGNA 5GZ6A 5LLTA 1EFLA 4PLCA 1YS7A 2M9MA 2W6QA 3NFYA 1YJCA 1T6XA 1IOWA 1JEJA 5JPDA 2PH1A 1RI1A 2IU6A 4WWHA 1OC4A 3BG5A 3HQ4O 2FE1A 4YH1A 1A5ZA 3HZRA 4DADA 2BEJA 2DE0X 4ZGBA 5HKBA 1VI5A 3ELDA 4NU6A 2ATVA 2HCTA 2J0QA 3VYVA 4BZWA 2XDAA 1YQXA 1UZLA 3U4DA 3PQ3A 4EGAA 1PJQA 2REXB 1K7SN 1K8YB 2RGBA 4J16A 2IY8A 4PAMA 3UMBA 3OM8A 4BYGA 3BL6A 4IEIA 5AFSA 4B3TB 4LOJA 3QBVA 3GQVA 5JDCA 1ZUWA 1Y7IA 1RYNA 2BFOA 2E0IA 2GEFA 3D4OA 3N6XA 1MDFA 2A6PA 1P3Y1 3MMPA 5FWNA 1Q0LA 3VA7A 4XQCA 1DOHA 1P77A 5ICSA 3RVJA 1J1IA 3E5HA 2HMYB 5JAMA 3LZCA 3OCYA 1JL3A 1BKSB 1JHUA 1OLSB 4YJKA 1EK6A 5JPCA 4I3HA 3V8PA 3M6IA 2HU2A 1O6BA 4ZT5A 3GJRA 5A9RA 2E5LB 3AW9A 3B6JA 5TLSA 1RM0A 3QVSA 1LF5A 1HT0A 1RYBA 4UREA 2OTCA 1HLDA 1KQPA 3C7CB 3IE2A 1G5IA 2AG8A 3PUJA 4XX0A 4JUFA 4YUYA 1LK7A 5TMEA 1Q0RA 2IEBA 1BGVA 1BEZA 3LBHA 1J9ZA 1JYFA 4ZOLF 4XI9A 2QV0A 5LYJA 2Q9BA 3BIWA 1Y8CA 1YA4A 1IIBA 2D0DA 4CCAA 2CLIB 3W1WA 1B6TA 4QHTA 5DNWA 2WICA 3FMVA 4UVDA 2IBSA 4QTZA 2H1OA 3DKKA 1Q7CA 2V9PA 1K98A 4F4CA 3WWEA 4F9TA 1U3TA 5AM3A 5FDFA 1BN7A 3VKHA 1KRHA 3PTAA 4K2HA 1E0KA 3A28A 3P52A 3PHCA 4WKBA 3O4HA 4BNDA 3HM9A 2F1IA 1WY7A 3T5PA 2H85A 4PZEA 3OF2A 5B1HA 4GH5A 3TRJA 3L41A 1VECA 1R9MA 2N0SA 4KJZA 1V16B 3JARB 1Q2UA 1LJUA 2D7JA 1R64A 4FYJA 5DN6D 3KWFA 3PUKA 4FFBB 5L7YA 3SNKA 3IIEA 5CW2A 4UUOA 3PNYA 4MGKR 2A0XA 2UZ3A 3DV2A 2R1UA 3Q1LA 3QVTA 3OU6A 3I12A 3JWPA 5FNVA 4ZVNA 5I7HA 1RMQA 3AHIA 3EOZA 3OSUA 4YRJA 5SYMA 1GPYA 2GN2A 1CEQA 2I4TA 3COYA 4OU5A 1E4EA 1G6OA 5ADVA 1OAKA 4TMFA 1XJQA 2FZ5A 3I8XA 3OQIA 4DBLE 4DRXA 5KYYB 3TLEA 2QTVA 4PC3A 1RBMA 2XA2A 1R0BA 1UL1X 3QXXA 3DC7A 4NYJQ 4WFJA 5CGQB 4BNMA 1GTG1 4IIXA 2FX3A 4UHJA 3LDUA 3S8YA 3WWCA 2QTNA 4CMJA 4K40A 4XAQA 4RNCA 4D45A 4CM5A 5HCUA 16PKA 2POQX 1O1YA 3M5CA 1F17A 3KOOA 3UG6A 2GEKA 2A1TS 1UT8A 3PX2A 3WKCA 2JD1A 5HQJA 3X0DA 4BNZA 1IOLA 4WKPA 4C2UA 4P6VF 2R62A 3PYXA 3VU0A 2OAP1 2BZSA 4QDOA 4HNHA 5FR1A 4DG9A 5EWJB 5JBQA 5HNKA 2GB4A 1Z39A 1FJGB 3FCSB 1FMLA 5GZ3A 2AYYA 5J63A 2VSYA 1OV6A 4Q4LA 4JB8A 3BD8A 3A1NA 4TYYA 2VZLA 4MQEB 1I5RA 3A1UA 4RWEA 3BMNB 4FILA 2Y67A 1Y1TA 1GA4A 3DAHA 4GYYA 1NBHA 4OF4A 4DJAA 3IP5A 4RUKA 4E4TA 2V4UA 2Y0CA 2HFKA 2NO6A 4WHMA 4AZ0B 1THZA 1DBPA 4I9GA 2YXBA 3VR2D 1G98A 1FYVA 3PQ6A 2IW3A 2EYUA 2RG7A 4IIVA 3DMGA 4OLFA 2PBLA 4GC9A 1Z5ZA 4LYAA 2B4QA 4HL6A 1M0WA 1BXRA 3NG1A 3VISA 3A1EA 3WGGA 2GAFA 3TVTA 1OI2A 2J7PA 3NJ8A 3NC0C 4LBZA 1U3CA 2VNSA 1ZIPA 2W58A 4NCKA 3TW0A 1T29A 4ZIRB 4KHZA 4UHKA 5HW0A 3LX8A 1EVKA 1ZSVA 2XMSA 1F0PA 5KJ6A 5FULA 1TKCA 1A7UA 4CIWA 3OPMA 1PNRA 3SR0A 1M6HA 2JGJA 3U7FB 2F48A 2VCHA 2CFTA 1YIDA 5TR9A 3AJAA 2VCEA 3STVA 2ZYGA 4E5KA 3BD7A 4FR0A 3MOGA 5B1SA 5JTUA 2VJDA 1QK4A 1GGHA 3HACA 1SA0A 2RBKA 4ASUD 4OMFG 4ZCTA 1KO1A 3MGKA 2X5KO 1ZONA 2ZAYA 2WD7A 1TL7C 3M2PA 3TPZA 2XMBA 1HFEL 2AX3A 4FE3A 1RCUA 1VIYA 5EI5A 1GQYA 1CUZA 4MV4A 1REQA 1BHO1 4NS4A 4MV8A 4HDAA 3PHHA 3M8KA 4LCBA 4RV9A 4FK8A 2K4MA 4FT2A 1EX6A 2JK1A 1WKVA 3R6WA 3RU3A 4ZOLA 4HNUA 1WPQA 1TCBA 2X5JO 2XVXA 2C7PA 3UW3A 1YK1A 3EVZA 4RGVA 4WLNA 5CJPA 5KOJA 3FHLA 4YJHA 2LCIA 5K8UA 3PIIA 3DMRA 2ID8A 1YDFA 5E1OA 5GY7A 1ECLA 2RH9B 3CEAA 4S35A 5CBKA 1OJLA 2OSBA 1WZEA 4ZVRA 2DBZA 2IIQA 2CUZA 2KX7A 1A8QA 1BMFD 2G36A 2IPOA 2OSVA 4DNQA 2C5HA 2F64A 2CLLB 2I9PA 4RMJA 3J7AC 4XX0B 1PVVA 2YIMA 3KOYA 4X6XA 3RFVA 2XQVA 4TSKA 3H2JA 4M53A 2CBXA 3G0OA 2NWQA 1NT4A 1T3GA 4HG2A 5F33A 1OLXA 1XVVA 4IMJB 5H80A 1YR9A 2X0DA 3M2TA 3TTVA 4HAWA 4DWJA 4Z8XA 2P11A 5EAIA 1KYYA 1JB1A 1KBOA 1J25A 3VPFA 3BWVA 4BVJA 2R6HA 3IVXA 3AQ4A 1YGYA 1L4EA 2JAHA 4I1OA 1JALA 1EFAA 2X13A 1VG9B 2LDXA 3D0KA 4HB2A 1NKSA 2W4MA 4PBSA 2XWBF 1DEAA 4NOJA 2FDRA 2FF5A 3W2IA 4OU4A 4D6PA 3DOFA 3AM5A 1ML4A 3A1CA 1E2PA 1TO1E 2RH4A 3VTZA 4D26A 5F23A 4M0EA 4QXQA 2FFJA 1OZAA 3QF7A 4WLFA 2F8TA 4BNDB 3DOEA 4OGGA 1N2BA 1AB6A 1M5TA 2Q3HA 4R1QA 5HRAA 1CUWA 4D9NA 4M9RA 2BMVA 1G66A 3HA7A 3U7EB 2RI1A 4U5XA 3JYPA 1ZM4A 4XWAA 1VIVA 5KTNA 1I01A 3H6KA 1TVKA 3KKOA 3CLTC 4FSDA 3E3AA 2J5BA 1GQSA 1ZRMA 3PXBA 3L1IA 5FNVB 5CDSA 3PF8A 4ZFNA 5I9BA 4XWYA 2B1IA 1JIIA 1QIGA 1A72A 2HXYA 3RC2A 2IYTA 2AEEA 2AUNA 1IBKB 3V1YA 3HJTA 4K28A 1QV6A 5JAHA 4MYUA 5CX4A 1Y82A 2DPXA 2Y1OA 1MC1A 1TM5E 2GSDA 4DRXB 4O4LF 2NXJA 2OGZA 2QTVB 3SR4A 5HTOA 4AI6A 4Q39A 2BELA 5I7FA 4G63A 4QQFA 4GGPA 3U17A 3ID6C 1MQAA 1MHTA 5EJ4A 3PD7A 5JHHB 4ENVA 2ILTA 4TSFD 5HOEA 5JS8A 1GZ5A 1WUHS 5T4HA 1UOQA 2XUHA 1NKTA 4FFVA 4XASA 5IC6A 2C9DA 1AIPA 1T9ZA 2VXOA 2WJIA 3EJ6A 3UXYA 4YMHA 4XB6B 2WDZA 4L16A 2CZQA 4ZGGA 1X2BA 2WYIA 1SCNE 1N2GA 4YJFB 2UYOA 1WSWA 2PT9A 2PZAA 2HJSA 1CF9A 5HJ2A 1RI3A 2OZLB 3LWNA 2VJQA 3V5NA 3RGWS 1SBIA 1VBFA 4CLEA 5H7XA 3FMFA 1A8PA 3JQGA 5HMMA 1GO2A 1N6OA 3VDQA 2DR0A 4Q1AA 2GZDA 4DKJA 1GV1A 1KO4A 5IYZB 4FFRA 1YACA 1VB3A 1HQYE 3GLHE 3PI7A 3BXHA 3WB9A 5B1EA 2A9PA 3AC0A 2GXSA 4FHGA 2IZ7A 3ML1A 5KVCA 4MICA 1EH5A 2FR8C 4Q3OA 2GRUA 3JYQA 2X9NA 2OHVA 4HUJA 4Z7NB 1Z4IA 5CG1A 3IR7A 2BFAA 4IHKA 3P9RA 4CL0A 3VO2A 5JD4A 2I33A 2ZDQA 4MVJI 3EVCA 5A3SA 2YY6A 5AKZA 3X1KA 3EXIA 3WGVA 3C6YA 2V3CC 2WK1A 1SOAA 4R2XA 2RHRA 3RTGA 5AIAA 1MPXA 2DHRA 3EZ7A 1IXKA 2YV4A 1OFTA 1L7DA 2ZUCA 3G2HA 4GM0A 3U1TA 2GPNA 4BKRA 2IEGA 3B1ZA 4R2JA 1VJTA 2JGMA 3DBOB 3OX1A 4AKTA 821PA 2FMHA 4PX9A 2X0KA 3DNPA 3IPLA 5EXEA 3WWDA 1PFVA 2V6FA 4JYAB 3LPCA 1BVYF 4DYDA 2GBLA 3TW8A 3SP1A 4CZ2A 2QUKA 2PZEA 4FJ2A 4NIMA 4NV0A 4FB4A 4FT4A 3RNOA 4E5PA 4DW8A 2WSBA 3H1GA 2IYQA 4CLHA 4MR8A 4BQFA 3KNZA 1SA0B 2YZ7A 3G23A 3DE4X 2JGKA 2WG2A 2QR3A 3DG9A 4FWTA 5DBFA 3A4MA 3QPUA 4KXUA 1ZVQA 3H8SA 4YN3A 1LRLA 1JJBA 2P3LA 3GEIA 2VQSA 4JBIA 5BQ5A 3K6SB 4ZQHA 2X8BA 3A6PC 4H1WA 4G8JA 2CVHA 4I9FA 1C30B 1KXJA 1KI3A 2P2ZA 2BRUC 2JPDA 4BNJA 3FCYA 1EGMB 2CXQA 3EQ9A 3KS9A 1OPXA 1NW9B 2EJWA 1K0FA 2FWIA 4OSPA 4XM2A 3FMGA 4HNVA 3BFKA 2I6TA 1EI9A 1V4NA 3BCHA 2WTBA 1X70A 3LYAA 2H2AA 3CZRA 2F1KA 2O2GA 3MILA 4Q1EA 3WHIA 3P9IA 4X94A 3ZE8A 3CLSD 1WBBA 4MYRA 1FDIA 2IJGX 4XVQA 4GZMA 5JRZA 2NQTA 3OTOB 4U6NA 1F6DA 1C8KA 4EG1A 4EL0A 3N07A 1PRYA 4UM7A 3SNHA 1K1EA 1H93A 4NYMQ 4OXRA 4HGZA 3ZE1B 1RHRA 1H2HA 5EXSA 2UZAA 2IZZA 2QV7A 2VDJA 4L51A 4BQRA 4X1KB 2JH8A 4GPD1 3EMVA 1XV5A 4N4AA 3MFYA 3KR0A 1VMAA 1A7AA 4V38A 4F2GA 3DQQA 1H8ED 4WBSA 1EWQA 2H1IA 1U0RA 2H8GA 3D6HA 3UUEA 3LGAA 4G81A 4Q3BA 2DR3A 2NXWA 4CDNA 1PDOA 2YASA 1O95C 5AXAA 4B3FX 2VPTA 4OBWA 4EW1A 3GJ5A 3PR2B 4WCDA 3KSZO 5CT5A 4FKBA 2X1HA 3LVRE 1LSUA 3NUQA 4XM1A 5KNBD 1M0EA 2B7CA 5LZ4A 1KYZA 2GI4A 4I36A 1ADJA 2IOHA 1VMIA 3H1BA 4YJDA 3A4NA 4EO9A 4R98A 4TXNA 1TVKB 1VRWA 2CHVA 4BC0A 1WZCA 2O8DB 4FKMA 3R3WA 4DWOA 3L6BA 3RHTA 1E79A 4MUBA 3D5QA 1V96A 5KKNB 5JFOA 4EHIA 5HQTA 3GFTA 3LPDA 1J9EA 1GM5A 5JROA 1WR8A 4C7MA 1JAIA 1ES9A 1OXUA 3EE6A 3V6MA 3OE5A 1M6VA 2B2XA 2AKYA 1DIAA 2WHPB 5K0EA 4IO1A 3ZK9A 1N2SA 5FI1B 1YXMA 3K9NA 4BFUA 3LCMA 3K20A 3ER8A 4K26A 1XF9A 1VQ1A 3LD9A 4JVMA 4FN5A 1N1DA 2ZB7A 1PG0A 1XAJA 3E53A 1FDRA 5F52A 5IK2A 4H0FA 2BHSA 4Z3OA 1DU4A 1SKMA 3NM5A 4HFRA 2AJ8A 2QTZA 1GZ6A 4PR3A 4AJ1A 1DX9A 1KJJA 4FWIB 2WOJA 1WD7A 4BL5A 5D3ZA 4J0QA 3PC3A 5B2ZA 1Y6ZA 5I9NA 3RC8A 3JQGB 3IKTA 4LNAA 3PLAE 5LR6A 3DMTA 2WTXA 1X1RA 5DI9A 1M6NA 2V0CA 4JZKA 3VPDA 1P2VA 3OPNA 1JMVA 4E31A 4F11A 3GLIE 5LSAA 2PSJA 2CV2A 4PQEA 2ISCA 1RRFA 4JOSA 3RWOA 3CKKA 5KYUA 5P8WA 3RG2A 1NC1A 3GVPA 1JE1A 2ZRFA 3P96A 2FN8A 2YOFA 3BE8A 4OBBA 1P9NA 1V43A 4WCVA 3WY9A 4DDVA 3OOEA 1N92A 3ETEA 4OHVA 3EEQA 1V2GA 2PYDA 3EQ8A 2QD2A 4GO1A 3T4EA 3HFJA 2JBAA 3EXIB 3QMMA 1C29B 1MJGA 3ABSB 1R1DA 2E4AA 4PG6A 4EVSA 2H57A 3U62A 1ZR4A 3DE0X 3M1LA 2H59A 2LR0A 2GTPA 1KC1A 1T0IA 3BH7A 2QORA 1QS0A 1DUVG 2ERXA 4LMAA 1AJEA 4UASA 3GLKA 2C58A 1HL3A 2J9XB 1IBRA 4QTYA 3OJEA 3AJ9A 4LE0A 3T35A 5A5VA 1SIWA 4C7XA 2IOFA 4DLZA 2H1SA 4FCWA 1JVNA 2I7XA 3TW8B 4G0WA 1PJTA 3UV7A 4I4TB 4JUDX 1U6JA 4GIBA 4KVAA 1P7ZA 3CN9A 4WGGA 3WVNA 3ZNOA 1TPYA 2D1QA 1U02A 4L4UA 2DHDA 4MR8B 1QDUA 3TBKA 1JTVA 1G4AE 1LX6A 1HL7A 1MXHA 1T9DA 4Q18A 4UQPA 4CKXA 3GPBA 3ASYA 4PZZA 1Q1EA 4D9JA 1ZJWA 4TRMA 2C0QA 1Q16A 3EGVA 5H68A 5L51A 1DO0A 3AT1A 3ZQKA 4M1TA 1FNSA 1TT5A 2C9MA 2XCQA 3E8XA 3ESYA 3PHIA 2YQ4A 4HR7A 1XCPA 5HGJA 1JKXA 4AO8A 2YN2A 5B2FA 4N0EA 1F2TB 4OKNA 3QEAZ 5J2UB 3AKEA 1W9MA 1WUKS 1RJEA 2PL5A 3Q1KA 3DMYA 4ZO6A 3ZV7A 1D2GA 4EO7A 1OWLA 3S1LA 1K6IA 2O0KA 4A6XA 4MP8A 4Y1EA 5AW9A 1FNNA 3GJSA 1GAQA 3OPYI 4EHBA 2CXRA 1VCMA 1L6IA 2IGBA 2ERYA 2LKCA 2QAIA 1CS4C 4Y2JA 2Y3IA 3EWNA 5D84A 2IE0A 1RTTA 3QX9A 5LP6A 1I51A 5B6PA 1JBKA 1S6YA 1ZIXA 4GSLA 4UCFA 5DBOA 1T8WA 3M82A 4CIDA 3OE4A 3SKVA 4Q3DA 2L82A 5KSZA 5TRTA 4G5FA 4DJJA 1EWKA 2Q8QA 4RTSA 4BMDA 4EGJA 1D2HA 1YA8A 3OLYA 3JQ9C 4AC9A 4Z6KA 5KOHA 1S2GA 3ZCUA 1TM2A 1EUCA 3U3ZA 1AU9A 5LP1A 2ZK7A 5LOVF 5M3BA 3FOWA 3CTMA 4KQWA 1OXXK 3AUKA 3OIVA 2O05A 4NY1A 3CE6A 3ETCA 3FFTA 3OE7A 4V1CA 4UU0A 3TGPA 5FBKA 3JU3A 3E3OA 1PKEA 1ENZA 1KHTA 5LL6P 5FA6A 4TQUS 3OCJA 2RD2A 4GL2A 1E2MA 5FPPA 1MEJA 1COWA 3OH8A 3HBAA 2HHHB 3STHA 4QFDA 4BX2A 3E9EA 2WIGA 1Z8HA 2V3WA 4ZT7A 3LUAA 4DRZA 1W34A 1JPJA 3NGXA 3QA3E 4OBEA 1USUA 3P0HA 3CLUD 4J6FA 1I2CA 2OYCA 4LF5B 1NMQA 1LV7A 2JZCA 3K0CC 2OPHA 2GCOA 3BSWA 3DOHA 4NVRA 4ZJPA 1Z8DA 3T95A 2L0XA 1H42A 1U3WA 2GF9A 3B51X 1UBOS 3E7FA 4KX5A 4CWAA 1DAOA 3L1JA 4G0XA 3FPBA 4CNBA 4D46A 4YYEA 1M8GA 1NY5A 2JKZA 4RS3A 1KYQA 5KCZA 1R18A 3TTWA 4LSMA 3G85A 2AA3A 2NLOA 5JPIA 4HKTA 4MUHA 4N39A 2QM7A 4URVR 1YR1A 1IN5A 1X0XA 4B3CA 2BOVA 3HEMA 1CB7A 4KGZA 1JNYA 3RUAA 2VXCA 2Z4RA 4PAQA 3GA7A 3OZTA 5KBYA 5EKUA 3HWRA 2EC5A 4P5PA 3X1JA 5HR5A 1I3OA 1MBZA 2E2WA 2GKSA 3T94A 1RM3A 1VL8A 1WB6A 4NU5A 5KX5F 4TZ0A 2JGNA 4TTPA 3V1MA 1NVAA 3BS4A 1N5MA 1FRFS 4MR9A 2G25A 3Q3VA 3MTEA 3U9TA 5D3MB 4AMYA 1ZHHA 4O5OA 1U2GC 1WTAA 2ORWA 3CFYA 5A4DA 1VPWA 2HHAA 1NVBA 1D6SA 3FZYA 3K9WA 3O7WA 4JUBA 3S2UA 3GU3A 3T7CA 5BWMA 3RYIA 2NYAA 3WLIA 1QBKC 2ZFUA 5A0VA 2ZROA 4WH0A 3VHXA 5KYUB 4DQXA 1NRWA 4BGDA 2W4IA 2JIZA 3MBKA 4YB8A 3R3YA 2VP5A 3ANLA 4IWYA 5AKEA 3AHGA 1VHWA 3KTAA 2HBQA 4E5YA 3ZVKA 2VK8A 2GESA 1EB9A 5P21A 1W1WA 2JBAB 3FUWA 1PZXA 2PLRA 3IB6A 3H1AA 3PTZA 4PM4A 4R9UC 1ZC4A 2ZIGA 4AUMA 4D80A 5BRAA 4KWTA 4L57A 5E4JA 2AZTA 1NN1A 3B52X 3IDFA 1V5EA 2PX2A 1E9BA 3DE1X 4CKBB 4LYFA 2DPMA 1C7RA 3HNRA 4UEOA 1U9IA 4KLZA 3WRYC 1QS0B 4FGLA 2HK8A 1BQ4A 3KKPA 5EWLA 5LXTF 1JG3A 4BFSA 4Q7JB 4P92A 4DMGA 5F7ZA 4JLDA 5HDBB 1H9BA 1AS3A 5AHOA 5MF6A 5EXPA 1I0ZA 4GICA 1NVVR 3IQXA 5LBUA 1FX1A 2FEXA 1KA9H 2NXNA 4E5MA 3J81k 2B9EA 1HOXA 5T4FA 4P2BA 4B6QA 4DKXA 5K6TA 2M1XA 3CF4A 3QU4A 1BGXT 3DZCA 3NV7A 3GMDA 1TJPB 4OP1A 3CLHA 5ALMA 1N7HA 2P5UA 1RVDA 1ESZA 5BY2A 1PJAA 4UNNA 3D3WB 1L5WA 3VC2A 4XIYA 2C83A 3TAXA 4EJ0A 2KQUA 4AUEA 1EP1B 1XMPA 1LU9A 3Q7EA 4OK3A 4F9GA 2R6JA 2A84A 3FYUB 4G0QA 4D8UA 5C7OO 1TT5B 4GYWA 1ZCJA 2R60A 4XKJA 3D3EA 1Z0SA 3DL0A 4QGGA 4G1VA 4COKA 5IXSA 1UFKA 4LX8A 1T9GS 3CZ5A 4H3VA 2ZUEA 1XCGB 1E7QA 1TVMA 2K6GA 4II3A 3EDCA 4LQCA 3DEZA 4X20B 3C6MA 3VR5D 1KJIA 3UJBA 1SB9A 2OUIA 1OREA 4J91A 1B15A 4JENA 1GPMA 4LK2A 4DR3B 1WCYA 4C0LA 5HZKA 3F90A 2H92A 3UG7A 4Z9AA 2FZKA 1UOOA 3G0IA 1XGKA 3P9QA 3EWIA 3I04A 3RKRA 5EHXA 5JSFA 5LP6B 5HRUA 3DWEX 2VR1A 3E61A 3DF9A 5LM3A 2Q46A 3F7NA 4JXXA 4P34A 1ZA2A 2CVPA 3ZOKA 5IT5A 5IWCA 1ZR2A 1S3IA 2JLSA 1N9KA 4K2AA 3RJTA 5KOHB 3FR7A 1EUCB 3L7JA 1DWPA 3W9YA 3EVAA 3NYWA 2ZIZA 2UZ1A 2ZRBA 6PFKA 3N1UA 1CFJA 1L7AA 3JWHA 4MVCA 5B37A 2CL0X 2WU4A 4G37A 5DHAA 3RC7A 3SHOA 4CDRA 4V1CB 4HNGA 4OAPA 3TR6A 3M6MD 3I58A 5A7GA 1EXVA 4OUKX 1UMCA 1CV2A 1N4DA 3Q2IA 2YC2C 3PA8A 5F5NA 2PVSA 3I8SA 4EO4A 2WKRA 3GJXC 1RRMA 3NNNA 4BFWA 5K20A 3DZKA 3OJLA 3IE1A 4C03A 4LZZA 1X14A 3GJZA 2PO5A 5DMXA 3D8HA 3RHFA 4GGMX 3HCDA 1P4HA 1HG0A 4R1OA 4YAOA 2VDMB 2EGGA 3UXMA 4AKIA 4IDEA 4DLNA 2QROA 4JOQA 3I1FA 2LKDA 1X6VA 3IMGA 1S7CA 1HMPA 2OM2A 2OP1A 3R4VA 5LQKA 2C42A 4P4TA 4DWWA 3ROPA 5KX5A 2YNMA 2UUCB 4BPBA 1IZ7A 4DLBA 1M74A 3OF5A 4JBXA 5LFAA 3E9NA 1VM6A 1KJYA 3GRKA 4IHJF 4QSMA 4X41A 1Z88A 2VDLB 4B6PA 2BH2A 2F1JA 3U80A 3FCCA 4X7BA 1I13A 2X9VA 4FI3C 3ZQUA 1Y80A 3T9AA 1AZTA 2A1IA 2PJZA 3PRHA 4O59O 2EP8A 4GI1A 2Q28A 3X1DA 2OENG 3ZLTA 4A5OA 5K99A 3KZCA 1NZJA 1D7AA 1T8UA 4AF6A 1IHUA 2FPSA 3AIOA 1J09A 3ZX4A 4BN0A 4PO9A 1E96A 3FOAA 2GK4A 2UVQA 2FWPA 5HX7A 1S8FA 1V48A 2HDHA 3ZV4A 1DG1G 2JFGA 3SJCA 3HY6A 3ZZMA 1DELA 2QQ0A 2O7SA 3G2JA 3RUEA 4ZVVA 3ERCA 5GJBA 4M76B 1RD4A 3ZGXA 1SBHA 2HA6A 2QQEA 3AIMA 3HMKA 4CQNA 2H2DA 5E1DA 4UM9D 2Q9UA 2I7CA 3HDHA 3TEJA 1NVXQ 2BJHA 3FDXA 2N46A 4JLSA 1GL9B 3CE9A 5HQ3B 4OHFA 3U40A 4GHWA 1PWZA 5JUWA 2G07A 3NDJA 3BJIC 2VXYA 4MVJG 4PQFA 3P9PA 3RYIB 1I7LA 3WGZA 1Y3HA 4UQOA 3V1UA 3VHXB 4ZZ1A 4K9PA 3AHDA 4YMSA 3CY6A 5GONA 4J9VA 1RSZA 3WA6A 1XD9A 3KTAB 1ZNZA 3EQ6A 5HUJA 4G41A 1H65A 3MGCA 3HDGA 3E9RA 1MX1A 3ZLVA 2R11A 3AOEA 2B21A 3MS7A 2CJXA 3R20A 3W3AA 1YZNA 4MI1A 5GINE 1DFIA 1HOTA 1WEKA 3LCJA 3RABA 3I34X 3ZE9A 1P9RA 1XQYA 2WU1A 4M1KA 2FN3A 4LHVA 1BDMA 3A6FA 2W11A 2YMMA 4UAJA 3R3VA 5EWLB 4B7XA 2C5GA 2ZI5A 3MJDA 1SVSA 3Q7TA 5JCOA 3KQNA 2O8FB 3EFOA 4JCCA 3STUA 2IHBA 3G9TA 4UXIA 4OJNA 1E1LA 4LOAA 3RARA 3F6CA 5IXYA 3DZGA 4CMAA 3VV3A 3VOBA 3CNNA 3ZJTA 2A88A 4WINA 5L3VA 5THXA 4JV5B 4R2HA 5I8ZA 4ZYZA 2QD4A 2Y1FA 3ZE0B 1FP4A 4R8KA 4BFVA 5GVSA 3NALA 4BNTA 1L1FA 1J8QA 4JJ7A 1FFDA 4A8JC 1GAWA 3FPKA 5JQGB 4L76A 1N6RA 3U9SA 2H4WA 2EHDA 1E9SA 2R6CA 2ZI9A 1XX6A 3E1GA 1WHSB 1ZNYA 1U0SY 4KLAA 1ZD5A 1MP0A 1R9NA 1XZAA 1TO6A 2CDBA 1TKBA 2ZBPA 3PXAA 4I5GA 4I4IA 2GHRA 2OBLA 4U2EA 2FPMA 5JMPA 1TZCA 1R0YA 1RAHA 2WSLA 4NLLA 4B7CA 3NATA 2NUBA 1TA4A 2AF3C 1OFHA 4PG5A 5HDQA 4F46A 3R3JA 4ID9A 2NUAA 4BVAA 4NBKA 4YT8A 1TM7E 2JJ1D 4HPJB 4RW0A 1Q0HA 2Q6OA 1O94A 3IFSA 3QSYA 5F98A 4ON9A 2I55A 4U3JA 1NSYA 5ELXA 2O8FA 4NRDA 5ILGA 2OCGA 1FPQA 5CB6A 1AN0A 2JCBA 2ZSBA 3FG9A 3M6VA 4L07A 5HIMA 3WJ2A 2ET6A 1TUBB 4G5YA 4WN9A 5E2AA 4EWLA 5K0JA 3JD1A 1SC4A 4Y6PA 3T7DA 2JGIA 3GLHA 1IQRA 3GLFE 4X44A 5DXJA 3ADDA 1QHFA 2A78A 5KQPA 2GAIA 1UZUA 4HQLA 4UD6A 4J7CA 1G5PA 3PHGA 5E1BA 1KI2A 2LWIA 2OBNA 2FSUA 2HV8A 1SBTA 1QG0A 4KMOA 2WB2A 3QI7A 4PSCA 3MT7A 2AEJA 3BMQB 1RBZA 4L6AA 3WMEA 4UXJA 5C31A 5DXAA 1Z4NA 3CUEF 1QE3A 4UBLA 1DC7A 1IUOA 1V3UA 3RR2A 4LJSA 3S2EA 3NHBA 1QWSA 2UZ1B 1IJBA 3DDNA 1BFKA 3NIBA 3ICQB 4OGKA 2MHCA 3CEMA 3OVMA 4QRHA 5CA0B 2VN8A 1BG6A 3TQHA 2V7BA 2R6R1 5KC9A 2V7EA 1P1RA 1HT1E 2WJ4A 3GT3A 4RC9A 4E21A 4EGQA 3K9HA 1UMCB 1QONA 2ZDGA 5DYIA 3PC4A 3K96A 3P9SA 4MUIA 4ZCLA 5LD2B 2AKAB 3KB1A 4KUEA 4LI3X 1QANA 1NUTA 1XDSA 2GH1A 2HGZA 2A9RA 2QE7A 3CC8A 4XYGA 4LE2A 2Y0PA 3R74A 3STYA 2D6FA 4C3OB 1H3NA 1N9GA 3FIUA 1R6TA 2QY9A 2QIPA 1G291 2FAXA 2VYND 2NSDA 2NYRA 4I5IA 4KREA 1WSBA 2ONJA 3A3PA 1VMKA 1RT9A 1NBIA 1ND5A 2ZRAA 3GVHA 4H4CA 4HZUA 4X54A 5DWVA 2ZM6B 3VVMA 4YMUA 3G9ZA 3H2SA 5EE3A 2J9FB 3EIXA 4JZYA 5FTLA 1TXGA 4FHEA 1JT2A 3TOVA 3S0JA 3A58B 3B6MA 1YIOA 5EIFA 4ERNA 4YRGA 3AFMA 5AVQA 3LG2A 5K3EA 5KNDD 3TW4A 1I4TD 2H11A 3IPYA 1NLUA 3RVPA 1V7CA 1J8VA 4Q7LA 3KD2A 1EE9A 1THGA 1K63A 2OXIA 1TIBA 4OFZA 2FLKA 2FSFA 2XTMA 4RZ3A 3BREA 2EARA 3AY3A 3NBFA 1K8ZB 5H3LA 4WXHA 3PUXA 1EX1A 2A0WA 3MCZA 1L5LA 1Z7BA 2VJPA 1XQ9A 2PMDA 5CCDA 4ZK2A 2WJZB 1OFGA 3V32A 2EFYA 5FJJA 3U3JA 2PUEA 5HP4A 1QHXA 3KV1A 1KBZA 3KV3O 1EGQA 1W52X 2VJBA 3F5QA 1PQ4A 5H8WA 1ZG3A 3BPSA 3QELA 2YR0A 2VHVA 4B9EA 2R2AA 1R8QA 1YL7A 3TQQA 1YCGA 1OV4A 3A27A 4CMIA 5LLDA 1T4DA 2JGRA 4IIBA 4BWFB 3GAZA 1NMYA 1LH0A 3GAMA 3OFND 4WJKB 1DXHA 1R16A 2W98A 5MN5A 3L84A 1ZAYA 5GONB 2EGHA 2Q1YA 3M6XA 2EFDB 2VEOA 3Q9UA 4K88A 1A7JA 1QHHA 1WSDA 1XP5A 2VOJA 3IA7A 3JYLA 4PZUA 4W1SA 5I4KA 4KXMA 1PL8A 3K2EA 2NVWA 4OD0A 5LA6F 3TN7A 1R4ZA 1T2VA 4AZ3A 1Q95A 1UK7A 4P3YA 4Y0VA 4BQPA 4KN5A 1YR7A 2ORIA 2Y05A 4L8YA 3GJ0A 3H3FA 3R40A 4ZT6A 1EUDA 3R5XA 4MHTA 4CR7A 1L7VC 1Y5NA 2PGJA 1ABFA 2P9YA 3DEAA 2IZ1A 3N2EA 3OCVA 1YJQA 1ICEA 4UUAA 1KQNA 1U8ZA 3IBSA 2YV1A 1VL6A 3VV2A 1E6EA 3A1WA 3OLXA 2MU1A 1GR0A 3FX2A 4B83A 4E2WA 2F1HA 5FPTA 5DCUA 4BFYA 1MOPA 5LQMA 1CQWA 3B13B 4K6GA 3DVSX 4GPIB 2PPLA 3HH8A 4IXNA 3U4MA 1FP4B 2JJMA 2XUFA 4RTNA 4TN1A 4XRRA 5ALOA 1KSFX 5JWHA 2CXXA 2XOKD 4YCLA 3H8VA 7REQA 2RE8A 1LS6A 3NBQA 4MQBA 1KAMA 2XHEA 2XLCA 3P0RA 1ZK4A 3ZD7A 2JZOA 4OHXA 3F8WA 2X4LA 3P2JA 1TLTA 1WIWA 3GGPA 1PAUA 4OY3A 4RM3A 4XD7A 3C3EA 2UXBB 5HK9A 1VE9A 1RWBA 4DRYA 3K9BA 1PGNA 4UATA 3QOWA 1UKCA 4C0QC 2V65A 1MD9A 3CH7A 4BC1A 2WF8A 4FHFA 3K5PA 1W5AA 4B43A 4UCWA 2NUAB 1S2OA 4XLZA 2HHCA 3SZGA 4MMXB 5H4HA 4BNFA 1FP1D 1EYZA 1FS6A 5CUQA 4KWHA 5ERGB 4O8CA 2WZDA 2HSZA 3ECSA 3HZOA 1L5MA 1KI6A 2WTNA 4RHEA 1T3SA 1XRQA 4U3JB 5COQA 4F8YA 4BKPA 1JEYA 3I01M 1NLMA 3SQLA 4LRQA 4WN9B 4AECA 4B3SB 3B7PA 1M66A 2POCA 4CU5A 3H5VA 2QTMA 4EYSA 3GLIA 3GFFA 3GLHB 5CMLA 5CLGA 3WBBA 4ALJA 1F3OA 1N75A 3WG9A 1YU9A 2RHWA 5JYBA 1RACA 1RYYA 2HQ1A 3E27A 1ULUA 4EFLA 3TZKA 1I2ZA 2P6MA 2XT6A 5TF4A 3FNEA 3CRQA 4HQ0A 3VR3D 1H4SA 4DM7A 3WYDA 3W9UA 4KP7A 4DCSA 4MRMA 3F2VA 3A1FA 2YWDA 1J8FA 2HA0A 3HGMA 4MQ6A 4C6TA 3EA5A 1VL2A 5B30A 1XZQA 3EIFA 1RKVA 3LT1A 5IBQA 4P9NA 5LIRA 3CR3C 3QUQA 3M0EA 1VHJA 4HQOA 2ZKLA 3ZPXA 4TL7A 4O2AB 2CYBA 4LHWA 3I09A 4FZVA 2XBMA 1O7JA 5L4LA 4JLUA 2XJ4A 2WE7A 3E0QA 3Q3GE 3TKLA 2FMIA 5J2TB 1WEHA 3FFBA 2O14A 2YS7A 3GHYA 3PDIB 4JLAA 4N01A 1HE3A 4KWEA 3MSCA 1M34B 1RWQA 3CTPA 2HIGA 4ZU1X 3U81A 1LDYA 4MUFA 4Q9KA 5JQWA 2B3TA 1YS6A 5JANA 1PO7A 1S2LA 1DPFA 1SOMA 1TCCA 1XZNA 2B5OA 3IPXA 5FB3A 1I2AA 2Q5LA 3ONEA 4NJEB 3WGOA 4FNGA 3GRUA 4XDZA 2XB6A 1N9GB 3VNAA 3TXYA 3OZVA 3QUTA 3O1LA 3X1MA 1JYEA 4NHEA 3B38A 2UYCA 4PC1A 4HZUB 4BRSA 3AV3A 1MNQA 3O3CA 2XAAA 4LC1A 4C78A 1O6ZA 3EF0A 1GRCA 1NMSA 2XCTB 4DV5B 4EB0A 3G2OA 3IPAA 4HFMA 2E4VA 4PGFA 4ZT3A 1CY2A 1XEWX 3DUWA 3V9AA 3FF1A 3KB6A 1EBFA 3GCWA 3MHTA 4UMEA 3MJHA 4DIFA 4NYIR 3L6OO 4G2TA 4JROA 1V95A 4J94A 1GD1O 4M9CA 2G9VA 2KS6A 2CY0A 1GRNA 3ANMA 3T52A 1CUJA 4OGLA 1T9KA 1TIPA 1PVOA 1LNZA 4Q4CA 2W6JD 5CEJA 2KSQA 3IQFA 3V1KA 3H9UA 4PSDA 3E05A 3UUWA 3AVYA 3K70D 1NI5A 2Z3WA 1BCSA 1NSFA 3C3KA 3U37A 3IVAA 3SBXA 2WJYA 1SXJC 2KJQA 5BT8A 4C4AA 2RGNC 3TSYA 3ZCXA 4KO4S 1XWWA 4DARA 2QTGA 4RVNA 5BOSB 2Z6QA 1YVPA 3FI9A 3SM3A 3KQQA 2C07A 4G25A 1N2CB 2ZIUB 3AUJB 3E7PA 4F86A 1Y98A 3VJRA 3WLPA 1QV9A 2AXEA 3C3YA 3QELB 4ZPJA 3PFKA 5ALJA 1ZYUA 5F7OA 5IVKA 1LDBA 3RC1A 1TZKA 4LV6A 1IEWA 5GAJA 1ZD4A 5CXQA 2A33A 4IICA 1UOEA 3RE1A 1W30A 5JHGB 3K1JA 4XGIA 3VOAA 2BGKA 1I4DD 4E51A 3PGKA 2YFKA 5EKDA 3GXOA 4I3FA 2E87A 3T4PA 4TYMA 1CHNA 1T2UA 2Q5IA 2BTQA 4HVCA 4UFPA 2C4KA 3PC8A 3C85A 4AZ3B 1RBYA 1Z6GA 4S1NA 1RZ3A 3VBEA 4JT9A 3UGJA 1D9ZA 4GZ3A 2IHTA 3Q0EA 1G16A 2JAPA 3BFXA 5ALTA 1XE3A 1HV8A 5B55A 5LNK1 3K1ZA 3A0RB 1KE1A 3JQCA 3BIXA 4R41A 1YULA 3T3MB 2AS0A 3CWQA 4Q7KA 1PEAA 3HSYA 3EIQA 4XGRA 1I24A 3FMOB 1YRYE 1XJWA 3N2KA 1P3JA 3JXEA 5K9ZA 4GD3Q 1QYCA 2O59A 2FN7A 4L0QA 1JEQA 2D3WA 1KNXA 3BDAA 1BKYA 1F3LA 2O52A 4OQMA 5INTA 3U4QB 4RK0A 2XNSA 1V7PC 2GILA 2QAJA 3N05A 1P4RA 3W8RA 4PW0A 3A3OA 3OECA 1GPBA 1DINA 5IC5A 1QHSA 4F5ZA 3ILVA 1XK7A 2Z04A 3MHPA 4CBVA 4DLPA 2BDTA 3MB8A 1O5OA 2FEOA 3E4DA 2Q9AA 4Y1RB 2DWCA 3D4NA 5E3JA 3SQOA 2G1JA 4QOIA 1MFZA 3CZQA 3E6AA 3OZGA 3VZPA 3WXMA 4CM4B 1Z4MA 5AVXA 3KDSE 4N49A 5AICA 3HI4A 4XIJA 4F8JA 1VJRA 5A7HA 4DNXA 4O4HF 4Z5XA 4DMKA 5CX1A 3D0OA 3D4IA 1I7SB 1YVRA 1MHPA 2LBPA 3HHPA 3V46A 3X1YA 4YT4A 1KI6B 4HSGA 1FYXA 1YIAA 4WNCA 4WCFA 2ZWAA 5GWXA 4EG0A 1JEYB 2ZAIA 1DAFA 1JFFA 4YV0A 5DT9A 4YXWD 1RXWA 4K3VA 4QM6A 1YR8A 2HLDD 4U2GA 5JG7A 3JPYA 4BMCA 3LM8A 5DU2A 2H65A 3A4LA 3D9QX 2J7KA 3H1EA 3HVHA 4KEAA 4C21A 4LJ9A 4DEXA 4ZXFA 1ORIA 1Q15A 2XUAA 3H8JA 721PA 3EGIA 1YO6A 3PJFA 4IR7A 2D5LA 4PO3X 4CKZA 3V6LA 1GPLA 1KIFA 5LQRA 2G77B 1BW9B 4GVXA 3L1UA 2W2XA 5BR1A 4F3RA 2J3MA 5FHRA 4ACAA 4MQ5A 2Z2ZA 4R2IA 1JR3E 4BO4A 4YR7A 1P4GA 3GT4A 3NKFA 4MRMB 2EXXA 5JEEA 1QIDA 2CLCX 2IXTA 1EFCA 1KEVA 4RABA 4D7AA 2PE5A 3STXA 4TXLA 3KJXA 2CLHB 4M1MA 4Y7CA 3O4RA 5D8DA 3KZVA 4Z1OA 4KXXA 1MT3A 1DJMA 3QU2A 3OSZA 4I8XA 5EUMA 2NU6B 1TQDA 3FLAA 3ZY2A 1TCVA 2GPJA 4J90A 1BVHA 1Y5LA 1AKMA 4JXJA 4FSHA 4PNEA 1BD3A 4YVFA 3AR9A 3WYCA 4L9RA 1NV9A 2IELA 1XU7A 4U7TB 3AB3A 4A5SA 1FFHA 4C0BA 3GCGA 4DCMA 2PGNA 4WBXC 5FORA 2GPAA 4JWTA 4C7JA 1KYVA 2QYOA 2V1XA 3W5VA 3EULA 3WLQA 4REOA 5JDIA 3EJWA 5SICE 3UAOA 4MUMA 3ILHA 1CUCA 1VPVA 3G2IA 2IUFA 4KR0A 3H11A 4QOHA 4XJSA 5DCYA 1NJGA 4OH1A 4MEAA 2IKSA 4DIUA 1DO8A 3Q0TA 1QAOA 4KN9S 4HK4A 4RPCA 3RSSA 1ZHFA 3QOXA 4IDFA 2OBYA 1E3TA 1Z7YA 3OFVA 3OZSA 4K9DA 2FTKE 5FL3A 3T3GA 4C2TA 2H1VA 1N2XA 4H15A 5LYYA 3JVUA 1E61A 1KH1A 5DW0A 5CFQA 1GSAA 1L8LA 3NU1A 3AJDA 4P7JA 2A9KA 3I5MA 1I10A 4BGEA 4CU2A 1GPJA 2VZ0A 2C57A 3IEIA 1LDEA 1KY5A 3LKVA 3R0VA 1JFLA 4YTEA 1LQUA 5BT9A 3T5MA 3TX2A 4RF3A 3ZHZA 1JJIA 1UBHS 2V03A 3C24A 3PCRB 1BCSB 3A6ZA 1ZUHA 4J7AA 1W2WB 3TPCA 4DTCA 4IYRA 1CS0B 3HB4X 1NFRA 1JQBA 2JFOA 4BEWA 1P0FA 4BLUA 4A15A 1IVYA 4DEVA 4F06A 5KWEA 1TF7A 2VP6A 3MGBA 5HKKD 3IP1A 2W2MA 4JC0A 5EG5A 1FVHA 3PJRA 3AEQA 2FMFA 3AGQA 3O47A 2EZ8A 4EVQA 1TJYA 3F47A 1VE3A 4RVGA 1V35A 1EGAA 3ZHRA 2FZVA 3MCAA 4BJHB 1Y4SA 3U3DA 3VBCA 2W37A 1JQAA 3IHLA 1MAWA 2IYPA 4LJLA 1N8TA 3IMFA 1IOZA 5JYDA 2J5XA 2VRCD 1NXOA 4QG7A 4AM8A 5ALVA 1L8QA 2AJDA 1A9QA 1ESMA 3CPJB 1C14A 1KSJA 5FWYB 4TQ9A 2BTQB 1N6LA 3MFQA 1RXEA 4UFOA 1OOEA 3KCNA 3KKQA 1C3VA 1FMTA 2OC9A 2EEZA 3G88A 2RGWA 4GMHA 3PDJA 4MRRA 4KDEA 3AIIA 3BK2A 3WJAA 5EP2A 4EHJA 2CJYA 2IF2A 2A3NA 1MN6A 1TA9A 4QUDA 4FBLA 3M4JA 3N2KB 4K03A 4COOA 1L0BA 1QUEA 4BE7B 1N7JA 2FFRA 2R8PA 1HDOA 4OMUA 3B85A 1JEQB 4YIKA 5HJ7A 3TK1A 3LA6A 2H4ZA 2DUJA 4O4HA 3L6DA 5D3QA 5YASA 4UBIA 5I7OA 5IKMA 3SSMA 4BVBA 4G1EB 4HJXA 4P3NA 3ZXSA 1B93A 3CZ9A 2Z6UA 1J97A 3RFFA 1I0LA 1SCUA 3PF9A 4DXHA 1HKUA 4LWZA 2WM9B 2XQJA 4LYJA 4R54A 1H2XA 1PG5A 3K2QA 2G1AA 4PCUA 1UBRS 4O4IB 5FUBA 2Y1CA 4C04A 4ANFA 1U90A 4DS3A 1P1CA 3HVIA 4QE3A 2XKBA 1PE0A 2FMKA 3GUYA 3SF0A 4CMEC 3KU4A 1IRXA 2X8WA 3ZWOA 3LUFA 2XUOA 2G6BA 3K4HA 4FMDF 5ES3A 5FUVA 4Z1MD 4TWIA 5KTYA 2P2DA 2VG8A 2FEWB 2IXEA 3GJQA 2GLTA 4Q4JA 1KSGA 1IN1A 1ND6A 1OIWA 4HDKB 2MMCA 5BOVA 5FA5A 4DV7B 2GZSA 2O23A 1HNNA 3UQZA 3TOSA 4WCFB 3K6RA 4CMGA 3GZ4A 4HH4A 3F6EX 3MQ4A 5FOQA 1T9AA 1VB5A 5C8VA 3CSDA 4CKYA 1QKKA 3DLBA 3LSTA 1GA6A 1L4GA 2ZVPX 3PUWA 4D3FA 2FFBA 3O9ZA 5E9WA 2ZSKA 3HJBA 2AH5A 4QBFA 1MA3A 3NAQA 3VTFA 1S8OA 3EPHA 2ZRKA 2WVJA 1DQYA 5IDXA 1ZK3A 3P0JA 3EDRA 4XQEA 3G49A 1P1FA 2R751 1QYWA 5A62A 4EHLA 1XRLA 5I6DA 1G5RA 2WZQA 1B6SA 5LQJA 1FZTA 1KQOA 2FCRA 4IFEA 1W36B 3HDTA 2GAOA 5EA2A 1T3TA 3PV0A 2BDEA 4X1OA 4D96A 1EZ1A 3BA1A 3O2QB 1ZZEA 1NV8A 1VJ1A 4JHXA 5D51S 4ZHQB 4K1XA 2OAGA 5HYVA 3ES9A 2YQ5A 1N7IA 4E22A 4QD3A 4BJ3A 3GLGE 4CEJA 1NQWA 5IDYA 4DR4B 3LDGA 1ZRSA 1P33A 1LVUA 3G6WA 4LFBB 5BPHA 3V4LA 2JHCA 3AR2A 4GPAA 4D4IA 1KEZA 1CVRA 4D43A 2E3JA 3QG1A 2ZCJA 5J40A 3B6ZA 3KFXA 3ZGNA 3ROTA 2WUVA 3MTBA 4ND2A 1JEAA 2C8LA 1QSGA 1T9BA 1U11A 1UBEA 2SHKA 1YNOA 2Z5FA 1Z22A 3F8SA 3FYSA 4FLFA 4R16A 3ZKAA 5K0LA 1UWLA 1Y7LA 2X9GA 4GI7A 2KMLA 1VSUA 4GX2A 3SJUA 1Q22A 3B70A 4JN6B 5CIYA 4ZZ2A 4EW6A 1GYQA 2HMTA 3UZUA 1FX0A 4FMCF 4EELA 4J16C 1DHTA 1FYDA 2OHHA 2VKTA 4P4GA 2G7MC 1K88A 1H23A 3DQZA 1QFZA 3HCAA 2J9YB 2IY9A 2YV3A 5JDCC 4XW2A 1B8UA 3JPWA 3JWIA 3CURA 1YUBA 1ZEJA 2Y71A 3D2BA 3KKMA 3OWOA 2XHZA 3KXIA 2VJCA 1HYQA 4ZCPA 1DT5A 3IQGX 2XAUA 4CR6A 2A9OA 3WZLA 1A8UA 4BECA 3WGKA 2ZTSA 2C82A 4NMWA 4BHTA 4PHCA 3INYA 4ETWA 1Z5WA 3LX4A 1RYMA 1TYZA 2GK7A 3DQPA 3LFHA 3OG9A 3I2FA 3WB0A 2MSEB 2QL7A 3I1YA 3OOHA 1MJHA 4Z2YA 5ARCA 4L0MA 2IRWA 5U4QA 1HGXA 3LLMA 3GLFA 4MQMA 2CEAA 4JR2A 4NARA 3WFZA 4P38A 1K08A 2XE6A 1SKYE 3AEQB 1PEYA 3I6QA 2D00A 3CW9A 4CIBA 5HF6A 1GAJA 4MW5A 1OH6A 1WETA 1N2JA