1SVQA

Structure of severin domain 2 in solution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
94
structure length
94
Chain Sequence
EYKPRLLHISGDKNAKVAEVPLATSSLNSGDCFLLDAGLTIYQFNGSKSSPQEKNKAAEVARAIDAERKGLPKVEVFCETDSDIPAEFWKLLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of severin domain 2 in solution.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Actin-binding
molecule keywords SEVERIN
total genus 17
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 1994-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1svqA00
1H1VG 3EFOB 4PKHB 1D4XG 1ESVS 1Q8XA 2I2QA 2NUPA 1NPHA 5L6WC 1TVJA 4PKIG 3CIPG 3Q2BA 2FH4A 1SVYA 3EFOA 2NUPB 5KYXB 1AK7A 2FH1A 5FAFA 1M2VA 4BEX1 3EG9A 3L50A 1T3YA 1P8ZG 1PD0A 3CJBG 2LLFA 3EH2A 1NM1G 2FF6G 5KYXA 2MOTA 3A5MS 2MV2A 2HD7A 4LIZA 1C0FS 5KYYA 1SVRA 2W0IA 1QPVA 3DAWB 2NUTB 1UDMA 2FGHA 1V6FA 1TMWA 4KEEA 1F7SA 3FFNA 5DD2A 1NMDG 2FH2A 1P8XA 5KYWA 3FG6A 3EH1A 2NUTA 1DEJS 1AHQA 2D8BA 1CNUA 5KYYB 1WM4A 4CBUG 3A5OS 2FF3A 1JHWA 1M2OA 1RGIG 2XF1A 3CI5G 1D0NA 1Q8GA 1YAGG 4CBWG 3EGXA 1CFYA 1EQYS 3A5NS 1YVNG 1AK6A 3EGDA 1WNJA 4KEFA 5IVUA 1T44G 1C0GS 1NLVG 1T3XA 3FFKA 4Z94G 5KYUB 5KYNA 2L72A 3EGDB 1VFQA 1J72A 2XFAA 3CJCG 3EGXB 4JD2H 1PD1A 2MP4A 5HVKB 1M4JA 2KVKA 4CBXG 2LXXA 4KEDA 1VKKA 1WFSA 2QTVA 1KCQA 4S10C 1PCXA 5KYUA 3TU5B 4PKGG 2VIKA 1X67A 1HQZ1 1MDUA 1SVQA 3A5LS 3FG7A 5A1MA 5KYWB 2VILA 3EG9B 5HVKD 2LJ8A 2VACA 1M2VB 1COFA 5FAEA 1T2LA 2FH3A
chains in the Genus database with same CATH superfamily
1H1VG 3EFOB 4PKHB 1D4XG 1ESVS 1Q8XA 2I2QA 2NUPA 1NPHA 5L6WC 1TVJA 4PKIG 3CIPG 3Q2BA 2FH4A 1SVYA 3EFOA 2NUPB 5KYXB 1AK7A 2FH1A 5FAFA 1M2VA 4BEX1 3EG9A 3L50A 1T3YA 1P8ZG 1PD0A 3CJBG 2LLFA 3EH2A 1NM1G 2FF6G 5KYXA 2MOTA 3A5MS 2MV2A 2HD7A 4LIZA 1C0FS 5KYYA 1SVRA 2W0IA 1QPVA 3DAWB 2NUTB 1UDMA 3DA7A 2FGHA 1V6FA 1TMWA 4KEEA 1F7SA 3FFNA 5DD2A 1NMDG 2FH2A 1P8XA 5KYWA 3FG6A 3EH1A 2NUTA 1DEJS 1AHQA 2D8BA 1CNUA 5KYYB 1WM4A 4CBUG 3A5OS 2FF3A 1JHWA 1M2OA 1RGIG 2XF1A 3CI5G 1D0NA 1Q8GA 1YAGG 4CBWG 3EGXA 1CFYA 1EQYS 3A5NS 1YVNG 1AK6A 3EGDA 1WNJA 4KEFA 5IVUA 1T44G 1C0GS 1NLVG 1T3XA 3FFKA 4Z94G 5KYUB 5KYNA 2L72A 3EGDB 1VFQA 1J72A 2XFAA 3CJCG 3EGXB 4JD2H 1PD1A 2MP4A 5HVKB 1M4JA 2KVKA 4CBXG 2LXXA 4KEDA 1VKKA 1WFSA 2QTVA 1KCQA 4S10C 1PCXA 5KYUA 3TU5B 4PKGG 2VIKA 1X67A 1HQZ1 1MDUA 1SVQA 3A5LS 3FG7A 5A1MA 5KYWB 2VILA 3EG9B 5HVKD 2LJ8A 2VACA 1M2VB 1COFA 5FAEA 1T2LA 2FH3A
chains in the Genus database with same CATH topology
1H1VG 3EFOB 4PKHB 1D4XG 1ESVS 1Q8XA 2I2QA 2NUPA 1NPHA 5L6WC 1TVJA 4PKIG 3CIPG 3Q2BA 2FH4A 1SVYA 3EFOA 2NUPB 5KYXB 1AK7A 2FH1A 5FAFA 1M2VA 4BEX1 3EG9A 3L50A 1T3YA 1P8ZG 1PD0A 3CJBG 2LLFA 3EH2A 1NM1G 2FF6G 5KYXA 2MOTA 3A5MS 2MV2A 2HD7A 4LIZA 1C0FS 5KYYA 1SVRA 2W0IA 1QPVA 3DAWB 2NUTB 1UDMA 3DA7A 2FGHA 1V6FA 1TMWA 4KEEA 1F7SA 3FFNA 5DD2A 1NMDG 2FH2A 1P8XA 5KYWA 3FG6A 3EH1A 2NUTA 1DEJS 1AHQA 2D8BA 1CNUA 5KYYB 1WM4A 4CBUG 3A5OS 2FF3A 1JHWA 1M2OA 1RGIG 2XF1A 3CI5G 1D0NA 1Q8GA 1YAGG 4CBWG 3EGXA 1CFYA 1EQYS 3A5NS 1YVNG 1AK6A 3EGDA 1WNJA 4KEFA 5IVUA 1T44G 1C0GS 1NLVG 1T3XA 3FFKA 4Z94G 5KYUB 5KYNA 2L72A 3EGDB 1VFQA 1J72A 2XFAA 3CJCG 3EGXB 4JD2H 1PD1A 2MP4A 5HVKB 1M4JA 2KVKA 4CBXG 2LXXA 4KEDA 1VKKA 1WFSA 2QTVA 1KCQA 4S10C 1PCXA 5KYUA 3TU5B 4PKGG 2VIKA 1X67A 1HQZ1 1MDUA 1SVQA 3A5LS 3FG7A 5A1MA 5KYWB 2VILA 3EG9B 5HVKD 2LJ8A 2VACA 1M2VB 1COFA 5FAEA 1T2LA 2FH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H1V G;  3EFO B;  4PKH B;  1D4X G;  1ESV S;  1Q8X A;  2I2Q A;  2NUP A;  1NPH A;  5L6W C;  1TVJ A;  4PKI G;  3CIP G;  3Q2B A;  2FH4 A;  1SVY A;  3EFO A;  2NUP B;  5KYX B;  1AK7 A;  2FH1 A;  5FAF A;  1M2V A;  4BEX 1;  3EG9 A;  3L50 A;  1T3Y A;  1P8Z G;  1PD0 A;  3CJB G;  2LLF A;  3EH2 A;  1NM1 G;  2FF6 G;  5KYX A;  2MOT A;  3A5M S;  2MV2 A;  2HD7 A;  4LIZ A;  1C0F S;  5KYY A;  1SVR A;  2W0I A;  1QPV A;  3DAW B;  2NUT B;  1UDM A;  2FGH A;  1V6F A;  1TMW A;  4KEE A;  1F7S A;  3FFN A;  5DD2 A;  1NMD G;  2FH2 A;  1P8X A;  5KYW A;  3FG6 A;  3EH1 A;  2NUT A;  1DEJ S;  1AHQ A;  2D8B A;  1CNU A;  5KYY B;  1WM4 A;  4CBU G;  3A5O S;  2FF3 A;  1JHW A;  1M2O A;  1RGI G;  2XF1 A;  3CI5 G;  1D0N A;  1Q8G A;  1YAG G;  4CBW G;  3EGX A;  1CFY A;  1EQY S;  3A5N S;  1YVN G;  1AK6 A;  3EGD A;  1WNJ A;  4KEF A;  5IVU A;  1T44 G;  1C0G S;  1NLV G;  1T3X A;  3FFK A;  4Z94 G;  5KYU B;  5KYN A;  2L72 A;  3EGD B;  1VFQ A;  1J72 A;  2XFA A;  3CJC G;  3EGX B;  4JD2 H;  1PD1 A;  2MP4 A;  5HVK B;  1M4J A;  2KVK A;  4CBX G;  2LXX A;  4KED A;  1VKK A;  1WFS A;  2QTV A;  1KCQ A;  4S10 C;  1PCX A;  5KYU A;  3TU5 B;  4PKG G;  2VIK A;  1X67 A;  1HQZ 1;  1MDU A;  1SVQ A;  3A5L S;  3FG7 A;  5A1M A;  5KYW B;  2VIL A;  3EG9 B;  5HVK D;  2LJ8 A;  2VAC A;  1M2V B;  1COF A;  5FAE A;  1T2L A;  2FH3 A; 
#chains in the Genus database with same CATH topology
 1H1V G;  3EFO B;  4PKH B;  1D4X G;  1ESV S;  1Q8X A;  2I2Q A;  2NUP A;  1NPH A;  5L6W C;  1TVJ A;  4PKI G;  3CIP G;  3Q2B A;  2FH4 A;  1SVY A;  3EFO A;  2NUP B;  5KYX B;  1AK7 A;  2FH1 A;  5FAF A;  1M2V A;  4BEX 1;  3EG9 A;  3L50 A;  1T3Y A;  1P8Z G;  1PD0 A;  3CJB G;  2LLF A;  3EH2 A;  1NM1 G;  2FF6 G;  5KYX A;  2MOT A;  3A5M S;  2MV2 A;  2HD7 A;  4LIZ A;  1C0F S;  5KYY A;  1SVR A;  2W0I A;  1QPV A;  3DAW B;  2NUT B;  1UDM A;  3DA7 A;  2FGH A;  1V6F A;  1TMW A;  4KEE A;  1F7S A;  3FFN A;  5DD2 A;  1NMD G;  2FH2 A;  1P8X A;  5KYW A;  3FG6 A;  3EH1 A;  2NUT A;  1DEJ S;  1AHQ A;  2D8B A;  1CNU A;  5KYY B;  1WM4 A;  4CBU G;  3A5O S;  2FF3 A;  1JHW A;  1M2O A;  1RGI G;  2XF1 A;  3CI5 G;  1D0N A;  1Q8G A;  1YAG G;  4CBW G;  3EGX A;  1CFY A;  1EQY S;  3A5N S;  1YVN G;  1AK6 A;  3EGD A;  1WNJ A;  4KEF A;  5IVU A;  1T44 G;  1C0G S;  1NLV G;  1T3X A;  3FFK A;  4Z94 G;  5KYU B;  5KYN A;  2L72 A;  3EGD B;  1VFQ A;  1J72 A;  2XFA A;  3CJC G;  3EGX B;  4JD2 H;  1PD1 A;  2MP4 A;  5HVK B;  1M4J A;  2KVK A;  4CBX G;  2LXX A;  4KED A;  1VKK A;  1WFS A;  2QTV A;  1KCQ A;  4S10 C;  1PCX A;  5KYU A;  3TU5 B;  4PKG G;  2VIK A;  1X67 A;  1HQZ 1;  1MDU A;  1SVQ A;  3A5L S;  3FG7 A;  5A1M A;  5KYW B;  2VIL A;  3EG9 B;  5HVK D;  2LJ8 A;  2VAC A;  1M2V B;  1COF A;  5FAE A;  1T2L A;  2FH3 A; 
#chains in the Genus database with same CATH homology
 1H1V G;  3EFO B;  4PKH B;  1D4X G;  1ESV S;  1Q8X A;  2I2Q A;  2NUP A;  1NPH A;  5L6W C;  1TVJ A;  4PKI G;  3CIP G;  3Q2B A;  2FH4 A;  1SVY A;  3EFO A;  2NUP B;  5KYX B;  1AK7 A;  2FH1 A;  5FAF A;  1M2V A;  4BEX 1;  3EG9 A;  3L50 A;  1T3Y A;  1P8Z G;  1PD0 A;  3CJB G;  2LLF A;  3EH2 A;  1NM1 G;  2FF6 G;  5KYX A;  2MOT A;  3A5M S;  2MV2 A;  2HD7 A;  4LIZ A;  1C0F S;  5KYY A;  1SVR A;  2W0I A;  1QPV A;  3DAW B;  2NUT B;  1UDM A;  3DA7 A;  2FGH A;  1V6F A;  1TMW A;  4KEE A;  1F7S A;  3FFN A;  5DD2 A;  1NMD G;  2FH2 A;  1P8X A;  5KYW A;  3FG6 A;  3EH1 A;  2NUT A;  1DEJ S;  1AHQ A;  2D8B A;  1CNU A;  5KYY B;  1WM4 A;  4CBU G;  3A5O S;  2FF3 A;  1JHW A;  1M2O A;  1RGI G;  2XF1 A;  3CI5 G;  1D0N A;  1Q8G A;  1YAG G;  4CBW G;  3EGX A;  1CFY A;  1EQY S;  3A5N S;  1YVN G;  1AK6 A;  3EGD A;  1WNJ A;  4KEF A;  5IVU A;  1T44 G;  1C0G S;  1NLV G;  1T3X A;  3FFK A;  4Z94 G;  5KYU B;  5KYN A;  2L72 A;  3EGD B;  1VFQ A;  1J72 A;  2XFA A;  3CJC G;  3EGX B;  4JD2 H;  1PD1 A;  2MP4 A;  5HVK B;  1M4J A;  2KVK A;  4CBX G;  2LXX A;  4KED A;  1VKK A;  1WFS A;  2QTV A;  1KCQ A;  4S10 C;  1PCX A;  5KYU A;  3TU5 B;  4PKG G;  2VIK A;  1X67 A;  1HQZ 1;  1MDU A;  1SVQ A;  3A5L S;  3FG7 A;  5A1M A;  5KYW B;  2VIL A;  3EG9 B;  5HVK D;  2LJ8 A;  2VAC A;  1M2V B;  1COF A;  5FAE A;  1T2L A;  2FH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...