1SVYA

Severin domain 2, 1.75 angstrom crystal structure
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
102
structure length
101
Chain Sequence
EYKPRLLHISGDKNAKVAEVPLATSSLNSGDCFLLDAGLTIYQFNGSKSSPQEKNKAAEVARAIDAERKGLPKVEVFETDSDIPAEFWKLLGGKGAIAAKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mapping the functional surface of domain 2 in the gelsolin superfamily.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Actin-binding protein
molecule keywords SEVERIN
total genus 28
structure length 101
sequence length 102
ec nomenclature
pdb deposition date 1998-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1svyA00
5KYXA 2FF3A 1HQZ1 3EFOB 1COFA 5KYYB 1M4JA 1NMDG 2LJ8A 1JHWA 1PCXA 1M2VB 3CJCG 4LIZA 2NUPB 3EGDA 5DD2A 2FH3A 1ESVS 1SVRA 2QTVA 2FH2A 1KCQA 1TMWA 4BEX1 5KYNA 1AK6A 2MOTA 5KYUA 4KEDA 2FH4A 3FFKA 3FG7A 1AK7A 1WM4A 1YAGG 2VIKA 4KEFA 2NUTA 3DAWB 3A5MS 2FF6G 1V6FA 4PKHB 4PKGG 5FAEA 3EG9B 1J72A 3EGDB 1TVJA 3Q2BA 5KYWB 1UDMA 1M2VA 3EGXB 3FG6A 2XF1A 2LLFA 5KYUB 1SVQA 2XFAA 1T44G 1P8XA 4S10C 3EFOA 5KYYA 3TU5B 4JD2H 3A5OS 3CI5G 1D4XG 4CBWG 1DEJS 3EG9A 3A5LS 2I2QA 3EH2A 1H1VG 1AHQA 5L6WC 1CNUA 1F7SA 5A1MA 1NPHA 2NUTB 5FAFA 1RGIG 4CBUG 5HVKD 2FGHA 1VKKA 1Q8XA 1D0NA 1MDUA 1VFQA 1T3XA 1X67A 2L72A 4CBXG 1EQYS 1T3YA 1QPVA 5KYXB 2LXXA 1NM1G 1CFYA 2VACA 4Z94G 3CJBG 1YVNG 2W0IA 1WFSA 2D8BA 2MV2A 3FFNA 2KVKA 1SVYA 2NUPA 5IVUA 2FH1A 5KYWA 1C0FS 3CIPG 4PKIG 1PD1A 3L50A 1NLVG 2VILA 1Q8GA 3A5NS 1T2LA 4KEEA 1WNJA 1PD0A 3EH1A 2HD7A 3EGXA 1P8ZG 1M2OA 2MP4A 1C0GS 5HVKB
chains in the Genus database with same CATH superfamily
5KYXA 2FF3A 1HQZ1 3EFOB 1COFA 5KYYB 1M4JA 1NMDG 2LJ8A 1JHWA 1PCXA 1M2VB 3CJCG 4LIZA 2NUPB 3EGDA 5DD2A 2FH3A 1ESVS 1SVRA 2QTVA 2FH2A 1KCQA 1TMWA 4BEX1 5KYNA 1AK6A 2MOTA 5KYUA 4KEDA 2FH4A 3FFKA 3FG7A 1AK7A 1WM4A 1YAGG 2VIKA 4KEFA 2NUTA 3DAWB 3A5MS 2FF6G 1V6FA 4PKHB 4PKGG 5FAEA 3EG9B 1J72A 3EGDB 1TVJA 3Q2BA 5KYWB 1UDMA 1M2VA 3EGXB 3FG6A 2XF1A 2LLFA 5KYUB 1SVQA 2XFAA 1T44G 1P8XA 4S10C 3EFOA 5KYYA 3TU5B 4JD2H 3A5OS 3CI5G 1D4XG 4CBWG 1DEJS 3EG9A 3A5LS 2I2QA 3EH2A 1H1VG 1AHQA 5L6WC 1CNUA 1F7SA 5A1MA 1NPHA 2NUTB 5FAFA 1RGIG 4CBUG 5HVKD 2FGHA 1VKKA 1Q8XA 1D0NA 1MDUA 1VFQA 3DA7A 1T3XA 1X67A 2L72A 4CBXG 1EQYS 1T3YA 1QPVA 5KYXB 2LXXA 1NM1G 1CFYA 2VACA 4Z94G 3CJBG 1YVNG 2W0IA 1WFSA 2D8BA 2MV2A 3FFNA 2KVKA 1SVYA 2NUPA 5IVUA 2FH1A 5KYWA 1C0FS 3CIPG 4PKIG 1PD1A 3L50A 1NLVG 2VILA 1Q8GA 3A5NS 1T2LA 4KEEA 1WNJA 1PD0A 3EH1A 2HD7A 3EGXA 1P8ZG 1M2OA 2MP4A 1C0GS 5HVKB
chains in the Genus database with same CATH topology
5KYXA 2FF3A 1HQZ1 3EFOB 1COFA 5KYYB 1M4JA 1NMDG 2LJ8A 1JHWA 1PCXA 1M2VB 3CJCG 4LIZA 2NUPB 3EGDA 5DD2A 2FH3A 1ESVS 1SVRA 2QTVA 2FH2A 1KCQA 1TMWA 4BEX1 5KYNA 1AK6A 2MOTA 5KYUA 4KEDA 2FH4A 3FFKA 3FG7A 1AK7A 1WM4A 1YAGG 2VIKA 4KEFA 2NUTA 3DAWB 3A5MS 2FF6G 1V6FA 4PKHB 4PKGG 5FAEA 3EG9B 1J72A 3EGDB 1TVJA 3Q2BA 5KYWB 1UDMA 1M2VA 3EGXB 3FG6A 2XF1A 2LLFA 5KYUB 1SVQA 2XFAA 1T44G 1P8XA 4S10C 3EFOA 5KYYA 3TU5B 4JD2H 3A5OS 3CI5G 1D4XG 4CBWG 1DEJS 3EG9A 3A5LS 2I2QA 3EH2A 1H1VG 1AHQA 5L6WC 1CNUA 1F7SA 5A1MA 1NPHA 2NUTB 5FAFA 1RGIG 4CBUG 5HVKD 2FGHA 1VKKA 1Q8XA 1D0NA 1MDUA 1VFQA 3DA7A 1T3XA 1X67A 2L72A 4CBXG 1EQYS 1T3YA 1QPVA 5KYXB 2LXXA 1NM1G 1CFYA 2VACA 4Z94G 3CJBG 1YVNG 2W0IA 1WFSA 2D8BA 2MV2A 3FFNA 2KVKA 1SVYA 2NUPA 5IVUA 2FH1A 5KYWA 1C0FS 3CIPG 4PKIG 1PD1A 3L50A 1NLVG 2VILA 1Q8GA 3A5NS 1T2LA 4KEEA 1WNJA 1PD0A 3EH1A 2HD7A 3EGXA 1P8ZG 1M2OA 2MP4A 1C0GS 5HVKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KYX A;  2FF3 A;  1HQZ 1;  3EFO B;  1COF A;  5KYY B;  1M4J A;  1NMD G;  2LJ8 A;  1JHW A;  1PCX A;  1M2V B;  3CJC G;  4LIZ A;  2NUP B;  3EGD A;  5DD2 A;  2FH3 A;  1ESV S;  1SVR A;  2QTV A;  2FH2 A;  1KCQ A;  1TMW A;  4BEX 1;  5KYN A;  1AK6 A;  2MOT A;  5KYU A;  4KED A;  2FH4 A;  3FFK A;  3FG7 A;  1AK7 A;  1WM4 A;  1YAG G;  2VIK A;  4KEF A;  2NUT A;  3DAW B;  3A5M S;  2FF6 G;  1V6F A;  4PKH B;  4PKG G;  5FAE A;  3EG9 B;  1J72 A;  3EGD B;  1TVJ A;  3Q2B A;  5KYW B;  1UDM A;  1M2V A;  3EGX B;  3FG6 A;  2XF1 A;  2LLF A;  5KYU B;  1SVQ A;  2XFA A;  1T44 G;  1P8X A;  4S10 C;  3EFO A;  5KYY A;  3TU5 B;  4JD2 H;  3A5O S;  3CI5 G;  1D4X G;  4CBW G;  1DEJ S;  3EG9 A;  3A5L S;  2I2Q A;  3EH2 A;  1H1V G;  1AHQ A;  5L6W C;  1CNU A;  1F7S A;  5A1M A;  1NPH A;  2NUT B;  5FAF A;  1RGI G;  4CBU G;  5HVK D;  2FGH A;  1VKK A;  1Q8X A;  1D0N A;  1MDU A;  1VFQ A;  1T3X A;  1X67 A;  2L72 A;  4CBX G;  1EQY S;  1T3Y A;  1QPV A;  5KYX B;  2LXX A;  1NM1 G;  1CFY A;  2VAC A;  4Z94 G;  3CJB G;  1YVN G;  2W0I A;  1WFS A;  2D8B A;  2MV2 A;  3FFN A;  2KVK A;  1SVY A;  2NUP A;  5IVU A;  2FH1 A;  5KYW A;  1C0F S;  3CIP G;  4PKI G;  1PD1 A;  3L50 A;  1NLV G;  2VIL A;  1Q8G A;  3A5N S;  1T2L A;  4KEE A;  1WNJ A;  1PD0 A;  3EH1 A;  2HD7 A;  3EGX A;  1P8Z G;  1M2O A;  2MP4 A;  1C0G S;  5HVK B; 
#chains in the Genus database with same CATH topology
 5KYX A;  2FF3 A;  1HQZ 1;  3EFO B;  1COF A;  5KYY B;  1M4J A;  1NMD G;  2LJ8 A;  1JHW A;  1PCX A;  1M2V B;  3CJC G;  4LIZ A;  2NUP B;  3EGD A;  5DD2 A;  2FH3 A;  1ESV S;  1SVR A;  2QTV A;  2FH2 A;  1KCQ A;  1TMW A;  4BEX 1;  5KYN A;  1AK6 A;  2MOT A;  5KYU A;  4KED A;  2FH4 A;  3FFK A;  3FG7 A;  1AK7 A;  1WM4 A;  1YAG G;  2VIK A;  4KEF A;  2NUT A;  3DAW B;  3A5M S;  2FF6 G;  1V6F A;  4PKH B;  4PKG G;  5FAE A;  3EG9 B;  1J72 A;  3EGD B;  1TVJ A;  3Q2B A;  5KYW B;  1UDM A;  1M2V A;  3EGX B;  3FG6 A;  2XF1 A;  2LLF A;  5KYU B;  1SVQ A;  2XFA A;  1T44 G;  1P8X A;  4S10 C;  3EFO A;  5KYY A;  3TU5 B;  4JD2 H;  3A5O S;  3CI5 G;  1D4X G;  4CBW G;  1DEJ S;  3EG9 A;  3A5L S;  2I2Q A;  3EH2 A;  1H1V G;  1AHQ A;  5L6W C;  1CNU A;  1F7S A;  5A1M A;  1NPH A;  2NUT B;  5FAF A;  1RGI G;  4CBU G;  5HVK D;  2FGH A;  1VKK A;  1Q8X A;  1D0N A;  1MDU A;  1VFQ A;  3DA7 A;  1T3X A;  1X67 A;  2L72 A;  4CBX G;  1EQY S;  1T3Y A;  1QPV A;  5KYX B;  2LXX A;  1NM1 G;  1CFY A;  2VAC A;  4Z94 G;  3CJB G;  1YVN G;  2W0I A;  1WFS A;  2D8B A;  2MV2 A;  3FFN A;  2KVK A;  1SVY A;  2NUP A;  5IVU A;  2FH1 A;  5KYW A;  1C0F S;  3CIP G;  4PKI G;  1PD1 A;  3L50 A;  1NLV G;  2VIL A;  1Q8G A;  3A5N S;  1T2L A;  4KEE A;  1WNJ A;  1PD0 A;  3EH1 A;  2HD7 A;  3EGX A;  1P8Z G;  1M2O A;  2MP4 A;  1C0G S;  5HVK B; 
#chains in the Genus database with same CATH homology
 5KYX A;  2FF3 A;  1HQZ 1;  3EFO B;  1COF A;  5KYY B;  1M4J A;  1NMD G;  2LJ8 A;  1JHW A;  1PCX A;  1M2V B;  3CJC G;  4LIZ A;  2NUP B;  3EGD A;  5DD2 A;  2FH3 A;  1ESV S;  1SVR A;  2QTV A;  2FH2 A;  1KCQ A;  1TMW A;  4BEX 1;  5KYN A;  1AK6 A;  2MOT A;  5KYU A;  4KED A;  2FH4 A;  3FFK A;  3FG7 A;  1AK7 A;  1WM4 A;  1YAG G;  2VIK A;  4KEF A;  2NUT A;  3DAW B;  3A5M S;  2FF6 G;  1V6F A;  4PKH B;  4PKG G;  5FAE A;  3EG9 B;  1J72 A;  3EGD B;  1TVJ A;  3Q2B A;  5KYW B;  1UDM A;  1M2V A;  3EGX B;  3FG6 A;  2XF1 A;  2LLF A;  5KYU B;  1SVQ A;  2XFA A;  1T44 G;  1P8X A;  4S10 C;  3EFO A;  5KYY A;  3TU5 B;  4JD2 H;  3A5O S;  3CI5 G;  1D4X G;  4CBW G;  1DEJ S;  3EG9 A;  3A5L S;  2I2Q A;  3EH2 A;  1H1V G;  1AHQ A;  5L6W C;  1CNU A;  1F7S A;  5A1M A;  1NPH A;  2NUT B;  5FAF A;  1RGI G;  4CBU G;  5HVK D;  2FGH A;  1VKK A;  1Q8X A;  1D0N A;  1MDU A;  1VFQ A;  3DA7 A;  1T3X A;  1X67 A;  2L72 A;  4CBX G;  1EQY S;  1T3Y A;  1QPV A;  5KYX B;  2LXX A;  1NM1 G;  1CFY A;  2VAC A;  4Z94 G;  3CJB G;  1YVN G;  2W0I A;  1WFS A;  2D8B A;  2MV2 A;  3FFN A;  2KVK A;  1SVY A;  2NUP A;  5IVU A;  2FH1 A;  5KYW A;  1C0F S;  3CIP G;  4PKI G;  1PD1 A;  3L50 A;  1NLV G;  2VIL A;  1Q8G A;  3A5N S;  1T2L A;  4KEE A;  1WNJ A;  1PD0 A;  3EH1 A;  2HD7 A;  3EGX A;  1P8Z G;  1M2O A;  2MP4 A;  1C0G S;  5HVK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...