1SVYA

Severin domain 2, 1.75 angstrom crystal structure
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
102
structure length
101
Chain Sequence
EYKPRLLHISGDKNAKVAEVPLATSSLNSGDCFLLDAGLTIYQFNGSKSSPQEKNKAAEVARAIDAERKGLPKVEVFETDSDIPAEFWKLLGGKGAIAAKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mapping the functional surface of domain 2 in the gelsolin superfamily.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Actin-binding protein
molecule keywords SEVERIN
total genus 28
structure length 101
sequence length 102
ec nomenclature
pdb deposition date 1998-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1svyA00
1Q8GA 3L50A 4KEEA 3EFOA 3CJBG 1MDUA 2FH3A 3DAWB 2NUPB 1T44G 3FFNA 4CBUG 1D4XG 5HVKB 2XFAA 1NM1G 1SVYA 3CJCG 3EGXB 1WM4A 2KVKA 1AK6A 1VKKA 5KYXA 3EH1A 3A5OS 4KEFA 3CIPG 2W0IA 5KYWA 2NUTA 1M2OA 1TMWA 2MOTA 1H1VG 4KEDA 2FGHA 1M2VB 5DD2A 2NUPA 2QTVA 3A5MS 5KYXB 1QPVA 2FF6G 1X67A 3FFKA 1T2LA 2XF1A 1T3YA 2MP4A 3CI5G 5KYUA 1C0GS 1VFQA 1D0NA 1UDMA 1NPHA 2I2QA 1PCXA 3EFOB 1AK7A 1NLVG 2MV2A 1TVJA 2VILA 4Z94G 3EGDA 5IVUA 4CBXG 1WFSA 2FH2A 2LLFA 1P8ZG 1C0FS 4PKHB 5HVKD 1YVNG 4JD2H 3A5LS 3Q2BA 5A1MA 1PD1A 3FG6A 3EGXA 4PKIG 2VACA 3FG7A 1SVQA 3A5NS 1YAGG 1DEJS 2FH1A 2NUTB 2LXXA 1PD0A 3TU5B 1JHWA 1P8XA 2D8BA 5FAFA 5KYUB 4LIZA 1CNUA 1COFA 1KCQA 4CBWG 1V6FA 2HD7A 3EH2A 4S10C 1M4JA 1HQZ1 1CFYA 1J72A 1ESVS 1T3XA 4BEX1 5KYWB 4PKGG 2FH4A 1WNJA 1M2VA 3EG9A 2LJ8A 5KYYB 3EGDB 5L6WC 1F7SA 5FAEA 1NMDG 1Q8XA 1SVRA 1EQYS 1RGIG 2FF3A 2VIKA 5KYYA 1AHQA 5KYNA 3EG9B 2L72A
chains in the Genus database with same CATH superfamily
1Q8GA 3L50A 4KEEA 3EFOA 3CJBG 1MDUA 2FH3A 3DAWB 2NUPB 1T44G 3FFNA 4CBUG 1D4XG 5HVKB 2XFAA 1NM1G 1SVYA 3CJCG 3EGXB 1WM4A 2KVKA 1AK6A 1VKKA 5KYXA 3EH1A 3A5OS 4KEFA 3CIPG 2W0IA 5KYWA 2NUTA 1M2OA 1TMWA 2MOTA 1H1VG 4KEDA 2FGHA 1M2VB 5DD2A 2NUPA 2QTVA 3A5MS 5KYXB 1QPVA 2FF6G 1X67A 3FFKA 1T2LA 2XF1A 1T3YA 2MP4A 3CI5G 5KYUA 1C0GS 1VFQA 1D0NA 1UDMA 1NPHA 2I2QA 1PCXA 3EFOB 1AK7A 1NLVG 2MV2A 1TVJA 2VILA 4Z94G 3EGDA 5IVUA 4CBXG 1WFSA 2FH2A 2LLFA 1P8ZG 1C0FS 4PKHB 5HVKD 1YVNG 4JD2H 3A5LS 3Q2BA 5A1MA 1PD1A 3FG6A 3EGXA 4PKIG 2VACA 3FG7A 1SVQA 3A5NS 1YAGG 1DEJS 2FH1A 2NUTB 2LXXA 1PD0A 3TU5B 1JHWA 1P8XA 2D8BA 5FAFA 5KYUB 4LIZA 1CNUA 1COFA 1KCQA 4CBWG 1V6FA 2HD7A 3DA7A 3EH2A 4S10C 1M4JA 1HQZ1 1CFYA 1J72A 1ESVS 1T3XA 4BEX1 5KYWB 4PKGG 2FH4A 1WNJA 1M2VA 3EG9A 2LJ8A 5KYYB 3EGDB 5L6WC 1F7SA 5FAEA 1NMDG 1Q8XA 1SVRA 1EQYS 1RGIG 2FF3A 2VIKA 5KYYA 1AHQA 5KYNA 3EG9B 2L72A
chains in the Genus database with same CATH topology
1Q8GA 3L50A 4KEEA 3EFOA 3CJBG 1MDUA 2FH3A 3DAWB 2NUPB 1T44G 3FFNA 4CBUG 1D4XG 5HVKB 2XFAA 1NM1G 1SVYA 3CJCG 3EGXB 1WM4A 2KVKA 1AK6A 1VKKA 5KYXA 3EH1A 3A5OS 4KEFA 3CIPG 2W0IA 5KYWA 2NUTA 1M2OA 1TMWA 2MOTA 1H1VG 4KEDA 2FGHA 1M2VB 5DD2A 2NUPA 2QTVA 3A5MS 5KYXB 1QPVA 2FF6G 1X67A 3FFKA 1T2LA 2XF1A 1T3YA 2MP4A 3CI5G 5KYUA 1C0GS 1VFQA 1D0NA 1UDMA 1NPHA 2I2QA 1PCXA 3EFOB 1AK7A 1NLVG 2MV2A 1TVJA 2VILA 4Z94G 3EGDA 5IVUA 4CBXG 1WFSA 2FH2A 2LLFA 1P8ZG 1C0FS 4PKHB 5HVKD 1YVNG 4JD2H 3A5LS 3Q2BA 5A1MA 1PD1A 3FG6A 3EGXA 4PKIG 2VACA 3FG7A 1SVQA 3A5NS 1YAGG 1DEJS 2FH1A 2NUTB 2LXXA 1PD0A 3TU5B 1JHWA 1P8XA 2D8BA 5FAFA 5KYUB 4LIZA 1CNUA 1COFA 1KCQA 4CBWG 1V6FA 2HD7A 3DA7A 3EH2A 4S10C 1M4JA 1HQZ1 1CFYA 1J72A 1ESVS 1T3XA 4BEX1 5KYWB 4PKGG 2FH4A 1WNJA 1M2VA 3EG9A 2LJ8A 5KYYB 3EGDB 5L6WC 1F7SA 5FAEA 1NMDG 1Q8XA 1SVRA 1EQYS 1RGIG 2FF3A 2VIKA 5KYYA 1AHQA 5KYNA 3EG9B 2L72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q8G A;  3L50 A;  4KEE A;  3EFO A;  3CJB G;  1MDU A;  2FH3 A;  3DAW B;  2NUP B;  1T44 G;  3FFN A;  4CBU G;  1D4X G;  5HVK B;  2XFA A;  1NM1 G;  1SVY A;  3CJC G;  3EGX B;  1WM4 A;  2KVK A;  1AK6 A;  1VKK A;  5KYX A;  3EH1 A;  3A5O S;  4KEF A;  3CIP G;  2W0I A;  5KYW A;  2NUT A;  1M2O A;  1TMW A;  2MOT A;  1H1V G;  4KED A;  2FGH A;  1M2V B;  5DD2 A;  2NUP A;  2QTV A;  3A5M S;  5KYX B;  1QPV A;  2FF6 G;  1X67 A;  3FFK A;  1T2L A;  2XF1 A;  1T3Y A;  2MP4 A;  3CI5 G;  5KYU A;  1C0G S;  1VFQ A;  1D0N A;  1UDM A;  1NPH A;  2I2Q A;  1PCX A;  3EFO B;  1AK7 A;  1NLV G;  2MV2 A;  1TVJ A;  2VIL A;  4Z94 G;  3EGD A;  5IVU A;  4CBX G;  1WFS A;  2FH2 A;  2LLF A;  1P8Z G;  1C0F S;  4PKH B;  5HVK D;  1YVN G;  4JD2 H;  3A5L S;  3Q2B A;  5A1M A;  1PD1 A;  3FG6 A;  3EGX A;  4PKI G;  2VAC A;  3FG7 A;  1SVQ A;  3A5N S;  1YAG G;  1DEJ S;  2FH1 A;  2NUT B;  2LXX A;  1PD0 A;  3TU5 B;  1JHW A;  1P8X A;  2D8B A;  5FAF A;  5KYU B;  4LIZ A;  1CNU A;  1COF A;  1KCQ A;  4CBW G;  1V6F A;  2HD7 A;  3EH2 A;  4S10 C;  1M4J A;  1HQZ 1;  1CFY A;  1J72 A;  1ESV S;  1T3X A;  4BEX 1;  5KYW B;  4PKG G;  2FH4 A;  1WNJ A;  1M2V A;  3EG9 A;  2LJ8 A;  5KYY B;  3EGD B;  5L6W C;  1F7S A;  5FAE A;  1NMD G;  1Q8X A;  1SVR A;  1EQY S;  1RGI G;  2FF3 A;  2VIK A;  5KYY A;  1AHQ A;  5KYN A;  3EG9 B;  2L72 A; 
#chains in the Genus database with same CATH topology
 1Q8G A;  3L50 A;  4KEE A;  3EFO A;  3CJB G;  1MDU A;  2FH3 A;  3DAW B;  2NUP B;  1T44 G;  3FFN A;  4CBU G;  1D4X G;  5HVK B;  2XFA A;  1NM1 G;  1SVY A;  3CJC G;  3EGX B;  1WM4 A;  2KVK A;  1AK6 A;  1VKK A;  5KYX A;  3EH1 A;  3A5O S;  4KEF A;  3CIP G;  2W0I A;  5KYW A;  2NUT A;  1M2O A;  1TMW A;  2MOT A;  1H1V G;  4KED A;  2FGH A;  1M2V B;  5DD2 A;  2NUP A;  2QTV A;  3A5M S;  5KYX B;  1QPV A;  2FF6 G;  1X67 A;  3FFK A;  1T2L A;  2XF1 A;  1T3Y A;  2MP4 A;  3CI5 G;  5KYU A;  1C0G S;  1VFQ A;  1D0N A;  1UDM A;  1NPH A;  2I2Q A;  1PCX A;  3EFO B;  1AK7 A;  1NLV G;  2MV2 A;  1TVJ A;  2VIL A;  4Z94 G;  3EGD A;  5IVU A;  4CBX G;  1WFS A;  2FH2 A;  2LLF A;  1P8Z G;  1C0F S;  4PKH B;  5HVK D;  1YVN G;  4JD2 H;  3A5L S;  3Q2B A;  5A1M A;  1PD1 A;  3FG6 A;  3EGX A;  4PKI G;  2VAC A;  3FG7 A;  1SVQ A;  3A5N S;  1YAG G;  1DEJ S;  2FH1 A;  2NUT B;  2LXX A;  1PD0 A;  3TU5 B;  1JHW A;  1P8X A;  2D8B A;  5FAF A;  5KYU B;  4LIZ A;  1CNU A;  1COF A;  1KCQ A;  4CBW G;  1V6F A;  2HD7 A;  3DA7 A;  3EH2 A;  4S10 C;  1M4J A;  1HQZ 1;  1CFY A;  1J72 A;  1ESV S;  1T3X A;  4BEX 1;  5KYW B;  4PKG G;  2FH4 A;  1WNJ A;  1M2V A;  3EG9 A;  2LJ8 A;  5KYY B;  3EGD B;  5L6W C;  1F7S A;  5FAE A;  1NMD G;  1Q8X A;  1SVR A;  1EQY S;  1RGI G;  2FF3 A;  2VIK A;  5KYY A;  1AHQ A;  5KYN A;  3EG9 B;  2L72 A; 
#chains in the Genus database with same CATH homology
 1Q8G A;  3L50 A;  4KEE A;  3EFO A;  3CJB G;  1MDU A;  2FH3 A;  3DAW B;  2NUP B;  1T44 G;  3FFN A;  4CBU G;  1D4X G;  5HVK B;  2XFA A;  1NM1 G;  1SVY A;  3CJC G;  3EGX B;  1WM4 A;  2KVK A;  1AK6 A;  1VKK A;  5KYX A;  3EH1 A;  3A5O S;  4KEF A;  3CIP G;  2W0I A;  5KYW A;  2NUT A;  1M2O A;  1TMW A;  2MOT A;  1H1V G;  4KED A;  2FGH A;  1M2V B;  5DD2 A;  2NUP A;  2QTV A;  3A5M S;  5KYX B;  1QPV A;  2FF6 G;  1X67 A;  3FFK A;  1T2L A;  2XF1 A;  1T3Y A;  2MP4 A;  3CI5 G;  5KYU A;  1C0G S;  1VFQ A;  1D0N A;  1UDM A;  1NPH A;  2I2Q A;  1PCX A;  3EFO B;  1AK7 A;  1NLV G;  2MV2 A;  1TVJ A;  2VIL A;  4Z94 G;  3EGD A;  5IVU A;  4CBX G;  1WFS A;  2FH2 A;  2LLF A;  1P8Z G;  1C0F S;  4PKH B;  5HVK D;  1YVN G;  4JD2 H;  3A5L S;  3Q2B A;  5A1M A;  1PD1 A;  3FG6 A;  3EGX A;  4PKI G;  2VAC A;  3FG7 A;  1SVQ A;  3A5N S;  1YAG G;  1DEJ S;  2FH1 A;  2NUT B;  2LXX A;  1PD0 A;  3TU5 B;  1JHW A;  1P8X A;  2D8B A;  5FAF A;  5KYU B;  4LIZ A;  1CNU A;  1COF A;  1KCQ A;  4CBW G;  1V6F A;  2HD7 A;  3DA7 A;  3EH2 A;  4S10 C;  1M4J A;  1HQZ 1;  1CFY A;  1J72 A;  1ESV S;  1T3X A;  4BEX 1;  5KYW B;  4PKG G;  2FH4 A;  1WNJ A;  1M2V A;  3EG9 A;  2LJ8 A;  5KYY B;  3EGD B;  5L6W C;  1F7S A;  5FAE A;  1NMD G;  1Q8X A;  1SVR A;  1EQY S;  1RGI G;  2FF3 A;  2VIK A;  5KYY A;  1AHQ A;  5KYN A;  3EG9 B;  2L72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...