1SW1A

Crystal structure of prox from archeoglobus fulgidus in complex with proline betaine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
270
structure length
270
Chain Sequence
ERVVIGSKPFNEQYILANMIAILLEENGYKAEVKEGLGGTLVNYEALKRNDIQLYVEYTGTAYNVILRKQPPELWDQQYIFDEVKKGLLEADGVVVAAKLGFRDDYALAVRADWAEENGVEKISDLAEFADQLVFGSDPEFASRPDGLPQIKKVYGFEFKEVKQMEPTLMYEAIKNKQVDVIPAYTTDSRVDLFNLKILEDDKGALPPYDAIIIVNGNTAKDEKLISVLKLLEDRIDTDTMRALNYQYDVEKKDAREIAMSFLKEQGLVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords osmoprotection protein (proX)
publication title Structural basis for the binding of compatible solutes by ProX from the hyperthermophilic archaeon Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Protein binding
total genus 93
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1sw1A01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 1sw1A02
3R7XA 2YPNA 5H8HB 5ICTA 1MG1A 4WXJA 4FATA 2IA4A 1ZJLA 2DQVA 4O3BA 1CE2A 1D9VA 4IGTA 2HXWA 3LSFB 2XXHA 3WAEA 3KN7A 3R26A 1MY4A 3U1OA 4LZ5A 1TFAA 3S9EA 1JETA 3KJ7A 4TLMB 3TQLA 3ZKKA 1B5IA 4JBZA 3CIJA 2F7AA 5H8FB 2R6GE 4F19A 3H6VA 3OO9A 4EF2A 3D4GA 3K6WA 1Y3NA 3O2AA 3V83A 3FJMA 5FHNA 5ISUA 3ZS6A 4DLDA 3IR1A 2OZZA 4BDOA 1M5BA 3MAMA 5AA4A 1O64A 3IX1A 4DXCA 1B52A 1CB6A 4LP2B 1M5CA 1MQJA 1LAXA 1B1XA 1A8FA 4PFYA 1B46A 3N5LA 5JK4A 3IOVA 3VV5A 2G93A 1ELJA 4ZEKA 4NF5B 3VXCA 3MC2A 3C9HA 4F1UA 1ANFA 3MVZA 2RC7A 2F97A 4LQ5A 2VHAA 1P1WA 2GH9A 1QUKA 4F18A 2P2AA 3KZGA 4H6DA 4RXLA 4G4PA 1A55A 5J1DA 4RNSA 3G3KA 2CZLA 1HSJA 1I6AA 3PUWE 3T9VA 1XT8A 5CBSA 3RLFE 4H65A 2ZXTA 1VR5A 4IO3A 1UQWA 4X48A 4GWOA 2Q8JA 4KCCA 5CI5A 4XIGQ 4DE8A 4ISUA 1I6BA 4G8HA 1SW2A 1A99A 1MQIA 3MVXA 3S9NC 1ZKBA 1IUDA 3UA8A 4R9FA 3TELA 3QUJA 1MY1A 1B9JA 3QAXA 3QSLA 2HAVA 3FVNA 4OTEA 2P0SA 1P1QA 3KG2A 5HBCA 1FTMA 5AA3A 4IO6A 3FVGA 5LOMA 2OWTA 1B58A 3UP9A 3SKPA 1IXCA 1H44A 3K1NA 1BKAA 1MPCA 4OESA 4F22A 5AE4A 4E0WA 4N6PA 3TCGA 5A5XA 3N94A 1DPEA 4KPTA 3B7DA 4ZZEA 1ZLQA 4HCYA 1B5JA 4FE8A 2OK2A 4YB5A 2VOZA 1IEJA 5BWJA 2PMSA 4O3CA 1PEBA 3B6QA 3B6WA 1I69A 1IXHA 1P1NA 3SETA 2ZYNA 4YB7A 4GL8A 1SDXA 4MFIA 4MLQA 2AYSA 2RCBA 4ZEDA 3EF7A 2HZLA 4R9GA 4F2QA 5TP9A 1TWYA 2B3FA 1MY2A 5HPQA 4GXAA 1I6QA 3QUFA 1BP5A 4YU0A 1URDA 3TUSA 1R1NA 3BFTA 5DT6A 3DM0A 2H98A 1MDQA 3KOSA 2DSFA 3Q25A 3G3IA 1NH8A 3MZBA 4F3BA 4MF3A 3TKDA 1IZ1A 1LAGE 3OSQA 4DDDA 2UYEA 4IO2A 1LFGA 3OOAA 3P7IA 4ZZAA 3HHFA 1SW1A 4BDLA 4JXIA 5FHMA 2NXOA 3TTMA 2B3BA 4G68B 1PBQA 5L9OA 2PYYA 5I58A 1B5HA 5F7VA 1MH4A 4QF9A 1PC3A 3I6VA 4I1DA 1IIWA 4F2OA 4F31B 4NF6B 3EHSA 3LBSA 1LBBA 3TZAA 1AH5A 1L5TA 3C33A 4JDFA 3M3LA 3LSLA 1UIUA 5TPAA 3MPKA 1HSLA 5I2NA 1B3EA 3K6VA 3KN3A 2H99A 4JWOA 4OEVA 1TXFA 2OCUA 2XD3A 2X7PA 3MBPA 3EHUA 1AOVA 2DVCA 4KYSA 1QUJA 4YZZA 1OLAA 4ZDMA 4NF8B 3U93A 2DWIA 3KSJA 2Z8EA 1FCKA 5ITPA 3SDFA 1IXGA 4OEUA 1JVXA 3V89B 1J1NA 1Q1KA 3TCHA 4QSCA 1P99A 3KFMA 4HCWA 3WAFA 2XXXA 3C36A 1ATGA 3G3JA 1GGGA 2I6EA 5H8HA 4OVJA 3IB2A 4ZS9A 3IB0A 3Q27A 3PMXA 5IAIA 3QXMA 1D3KA 3RTFB 2QJEA 1MS7A 5I58B 2VP1A 1A8EA 4IY6A 3K01A 4X1BA 5I57B 1Y3QA 4MBPA 3AXFA 1B32A 3RPWA 4R6HA 3SESA 3MQ9A 4GFRA 4E0XA 1PB9A 3H6TA 5FTHA 1EZ9A 5H8FA 2REJA 4H67A 3K1PA 3T93B 1GVCA 3K6XA 5TPAB 4GQOA 2YLNA 3PPOA 5I2NB 1QUIA 4OHNA 2XXWA 3VXBA 3U8QA 4RK9A 3RN8A 2Z8DA 2R71A 3G7WA 5H8NB 2RF1A 4R6KA 4FAJA 2UVGA 2AL4A 5JEIA 2O51A 5B70A 3O6GA 1B7HA 5CBRA 3L6GA 4NF5A 4OWDA 1Y9UA 2XXTA 1MM6A 3IAZA 5AA2B 3RQTA 2HZKA 1Q35A 1FQDA 3ZKLA 3OEKA 2Q2CA 1USYH 3MWBA 5KDTB 4KFQA 5I84A 3CG1A 4KCDA 3RT6B 3IL1B 1FQFA 5HM4B 3A3UA 1NNPA 1MQHA 2F7CA 1SI1A 4I9DA 1T0KA 1QKBA 2ANJA 4MLVA 4G8MA 4JSOA 4TLLB 4BDRA 4ELOA 2F8DA 4WKMA 3N6TA 4ESWA 3TCFA 4EUOA 3EN3A 4ELQA 4IO4A 2NOOA 5EHMA 4ZE9A 4IGRA 4U21A 3IOTA 3TODA 4G77A 1Z7ME 3PD8A 2GHBA 1PB7A 2Q9TA 3TFLA 4TQUQ 1OMPA 3CVGA 3G3FA 3S9MC 1PBPA 3TQWA 1FTOA 2NWJA 1B3FA 4DIGA 1ZMGA 3IB1A 2UYFA 4LUBA 1XVXA 2BJJX 4AQ4A 1SYIA 3RT8A 4RYAA 2QPQA 3U92A 2O84X 3PUYE 3VE1B 1SBPA 4U1OA 2I4CA 4GD5A 3SEUA 4NE4A 4YKPA 3PV0E 1FQEA 3I3VA 1Z7NE 3CFXA 1IITA 1DSNA 4POWA 3MVYA 1A54A 2PX1A 1ZIUA 2ZYKA 1Y3PA 5CC2A 2O7UA 1MXWA 4YKJA 5DYHA 2UXAA 3TTKA 1BLFA 3ONMA 3K2DA 1TT1A 3E9XA 4X9TA 1EZPA 4UA8A 2I49A 3VDFA 3ILUB 3MVWA 3M3KA 1US4A 4JB7A 4X1DA 4FEBA 3V8XB 2G29A 1B0LA 4GVOA 1LSTA 5L9SA 1OIBA 1H76A 5AA1A 2NUVA 3DELB 1N04A 1KWHA 5L8DA 3EPEA 4G68A 2OLBA 3FXQA 1MXVA 1DTZA 2HCAA 5TU0A 3JYRA 2XXQA 3HN0A 3FVKA 2XXPA 2XXYA 2DOJA 2AIXA 1NNKA 2O1LA 4F3PA 3FD3A 1B3HA 4XXUA 1Y4TA 2QS3A 3HPIA 3MP1A 3THIA 4NF6A 4OENA 3CFLA 3PMVA 1LB8A 5I56B 4GL0A 2OBGA 3Q26A 3Q28A 4XKQA 4PFUA 3ODBA 3GXAA 4DXBA 3CG3A 2DE3A 3IK6B 3UK4A 2CMOA 1JW4A 2Y7IA 2ONSA 3SEXA 4EF1A 1AL3A 5M2VA 1FW0A 1RKMA 2O7IA 4EXLA 5ICQA 3H6WA 1SW5A 1WDNA 2IEEA 3MJNA 4H8JA 3KJTA 1FTKA 4XTCQ 1B51A 4OERA 1GTKA 3ECRA 4F3SA 4R75A 3FV1A 1XC1A 3O6HA 4R74A 1B3GA 3MUQA 4WEDA 4H5GA 4KQPA 4QFOA 5KCJB 4U4SA 4NF8A 4IB2A 1YAEA 3GBBA 3ILTB 1BIYA 2X26A 1LGBC 4MH5A 3VFJA 2QS2A 4EDPA 4R6YA 2PT2A 1WVJA 1R9QA 1TFDA 2H25A 4BDMA 4LA9A 5H8QB 5JTYA 2Z8FA 5DEXB 2I4BA 4Q0CA 1MXZA 3H3GA 2D21A 3F11A 3IO4A 1LCFA 3CSBA 2FNCA 3IOUA 3PUZE 4EQBA 2ZNSA 4BDNA 3T9UA 1JNFA 3O97A 1HSEA 2DYXA 3BKIB 2XXVA 2GHAA 2V3UA 1R9LA 4POXA 4U4XA 1BTJA 2LAOA 1ZU0A 5L9MA 1FTJA 4FIMA 4RA1A 4OFOA 5CMMA 2XX9A 5I57A 1D9YA 3DLNA 1H43A 3TEPA 3I5OA 3MP8A 3SEYA 2F6GA 1S50A 4GOTA 4QFKA 1USYE 1NKXA 4HW8A 3TYHA 4LQ2A 4OXVA 2W7YA 2ONKE 3EHTA 2O1MA 3LSWA 1URGA 4KR5A 1N0TA 3T9HB 1B4ZA 4U23A 2REGA 1QULA 3SEVA 2DVZA 2RINA 2RCAA 1B05A 2E0SA 3H6UA 5H8NA 5FTIA 1MPDA 4ZEIA 3C34A 3FASA 4H5FA 1LCTA 3OEMA 2P1SA 1R6ZA 4RJZA 4XKPA 3CRBA 4AB5A 4ESXA 3GBAA 4TOZA 1GV8A 4NMYA 3GLBA 4RPOA 1GR2A 4H1XA 5AA2A 5JTYB 4PFWA 3OMBA 1P1UA 4PETA 2PVUA 5KDTA 4PQJA 1Y1ZA 2QSXA 3LUYA 4R2BA 3MPLA 3CI8A 4Q8RA 3FIRA 3C35A 3KBRA 4LVQA 1YCJA 2V3QA 4KI0E 2DS9A 3QK6A 4PFTA 1SI0A 3MP6A 3PD9A 1MPBA 2A5TB 4OQOA 4QSEA 2OJTA 4R2FA 1MH3A 2B65A 1MQGA 3G3HA 4GLIA 1JW5A 5DVIA 3OO7A 4P0IA 2V84A 5CMCA 5ITOA 3UORA 4YKIA 5DTBA 4ZEBA 1A40A 2RC9A 2XX7A 1N7XA 1SQYA 3M8UA 4U22A 5K2YA 4O3AA 1XOCA 4F3GA 4I62A 3TDJA 2Q2AA 2DWJA 3T66A 5K2XA 4QHQA 1SVXB 3N26A 1LAHE 1SD3A 3IOWA 2HQ0A 3DP6A 3S2VA 1RYXA 4GXSB 3LC8A 4YICA 3ZSFA 2F36A 2ESNA 1H3DA 4OMBA 1OQGA 4K3FA 2UVJA 2D3IA 2YJPA 3H4ZA 4GF8A 1SYHA 4BDQA 2F5XA 3FJGA 3Q29A 1YTVA 2DWHA 1ZTYA 2F35A 2PT1A 4RY1A 4F29A 3RNNA 1POTA 3IJOB 1MXUA 3VLWA 1PB8A 3C32A 1Y1MA 1QW0A 3BFUA 5F1QA 3KN8A 1XVYA 4NTLA 4XKNA 5B7DA 4OZ9A 2PBWA 1VE4A 1DPPA 3K02A 3RGYA 4IY5A 2ZNUA 2DE4A 1DTGA 1B6HA 1MY0A 3O9PA 4ND9A 2A5SA 1NH7A 5EYFA 4G2ZA 2O69A 1M5FA 2E1SA 1OVBA 2Y84A 3MZ1A 4Z0IA 2F7BA 4JWXA 4LATA 4QFNA 5I56A 4U1ZA 2DWAA 1FQBA 4FORA 4N13A 1B4HA 3HHGA 3QIMA 4C1TA 1EZOA 4U2RA 3CFZA 4GIZA 4G68C 3PGFA 3U94A 2DXRA 4PP0A 1NNFA 4ZE8A 1XHYA 2Z22A 3HCQA 2QS4A 4F1VA 1II5A 3W9WA 4Q30B 3KOTA 3E4RA 5DVJA 4LZ8A 3PMWA 4P11A 3FATA 3FJ7A 4YAHX 3PU5A 4R73A 2Z23A 2I3WA 3FXRA 5KCJA 4ZEFA 4NWCA 1FQAA 3JZJA 1POY1 2I0CA 4IO7A 2OWSA 4ZECA 2VGQA 1UIVA 5H8QA 4WEPA 1JEVA 2Q88A 4P0GA 5DEXA 3OO6A 1UTBA 4LZ7A 1VSOA 4FEDA 3PPPA 4HTGA 1PDAA 4ONYA 3S4UA 5I2KB 3VVEA 4OFLA 4NF4B 3T9XB 4JWYA 3MW0A 3SEWA 1MY3A 1QVSA 1NFTA 1FQCA 2FYIA 3LSXA 3PPNA 2VD2A 3OD7A 1D4NA 3FVOA 3R6UA 2D5WA 3FZVA 3K6UA 3H7MA 1O7TA 2DP8A 3HO7A 3K0VA 1EU8A 5I59A 4JSDA 4GRKA 3UN6A 4NEDA 2QL3A 2I48A 2HFBA 3T22A 1FTLA 1B1HA 4H8IA 4ELPA 3CR9A 4KD5A 1OLCA 1M5DA 3O66A 5BUUA 5AA4B 4EXKA 3FV2A 2KLFA 2DE2A 3DP4A 4YKKA 4ELRA 3IJXB 2WKYA 2XX8A 3TAJA 1JQFA 1B3LA 2RC8A 2Y7PA 3RUMA 1MRPA 2RKMA 5FHOA 4OETA 1LBCA 1MDP1 5DVFA 1QKAA 3OSRA 3USDA 1B0HA 1IQ7A 4R72A 3UGWA 3H03A 5ELVA 2DXYA 1UTBB 1JVYA 1LLSA 1MM7A 1NNTA 3FGSA 2QMWA 3K4UA 2GFEA 5CRYA 5EHSA 3VLVA 5H8SA 1UTHA 2O6AA 3L6HA 2XXUA 2HAUA 4DZ1A 1MXXA 1XS5A 4L17A 4F39A 2X7QA 1Y4CA 2A5TA 3TMGA 4F1YA 4LONB 3VLUA 1IXIA 1ZBMA 3FUZA 1S9TA 3PPQA 1A7LA 2V3TA 3TTNA 4NWDA 3C31A 3VVFA 4DXUA 1B7UA 5CM6A 2ALUA 4KYDA 3T96B 2I0BA 4HS7A 3JV9A 5I59B 3TTLA 3MZ9A 2Y7KA 3E3KA 3M3FA 1N3XA 4M4GA 1MQDA 4H0WA 3KGCA 3W9VA 3EQ1A 2ZMBA 2THIA 3DP8A 3N6UA 3IORA 4QRZA 3OELA 3U72A 3O29A 1DOTA 1SW4A 3B6TA 3H06B 4EQ7A 3K1MA 3RY3A 1M5EA 3SERA 4Q5TA 4G8NA 1LB9A 3S9LC 5A5XB 5AA2D 4DCYA 1DMBA 4C1UA 3W15C 1LFIA 2XXIA 3TTRA 2V25A 3O28A 2AL5A 4KYEA 2UVHA 4OFJA 4YMAA 2H9BA 4FJPA 1US5A 1Y20A 4QFPA 3OXNA 4QSDA 4KHZE 2QMXA 4THIA 5TP9B 3PUXE 2NVUB 3HV1A 3A09A 2F78A 1QJMA 2H4IA 1VFEA 1UTHB 2R9JA 2HEUA 1NL5A 1F9BA 4DCXA 5CMBA 1MXYA 3FXUA 3K00A 3OO8A 2QRYA 3OENA 1B7ZA 3VVDA 4PE5B 1AMFA 3QYTA 3TPAA 4YMBA 2M8CA 2XHDA 3UIFA 2Q89A 3C4MA 1URSA 3D4CA 4M1VA 1S7YA 2ABHA 4RPNA 4XKRA 1LFHA 2O68A 1N84A 2ONRA 1LAFE 4FECA 5IKBA 3RTWB 1JW1A 2QS1A 3A3CA 1B2HA 3E13X 2I58A 4N07A 4Z7EA 3CSGA 4I8CA 2FA7A 4YB6A 4RK2A 2ZYOA 3HSTA 1N7WA 2Y7WA 3O6IA 3IO6A 5KZTA 2VD3A 4UACA 4QFLA 1EH3A 1B40A 3KSXA 4EQ9A 2I3VA 3PPRA 3V5AA 1N3WA 2H5YA 1YPNA 2ZYMA 4OYVA 3GZGA 1AIVA 1H45A 5CMKA 1WODA 3G3GA 4IO5A 2V93A 3KEIA 2XD2A 1P1OA 2Y7RA 3LR1A 4BLAA 1OQHA 1O63A 2ZNTA 2F34A 1N76A 4AB6A 2UVIA 3PUVE 2GRVA 2F6PA 4C0RA 5I2KA 4NF4A 2XXRA 1RYOA 1OVTA 3BBRA 1NMUA 1JEUA 4ECFA 1VFDA
chains in the Genus database with same CATH superfamily
3KBZA 3R7XA 2YPNA 5H8HB 5ICTA 1MG1A 4WXJA 4FATA 5EQAA 2IA4A 1ZJLA 2DQVA 1FBDA 1LBVA 4O3BA 1CE2A 1D9VA 1FBCA 4IGTA 2HXWA 3LSFB 2XXHA 1FSAA 1NI9A 3WAEA 3KN7A 3R26A 1MY4A 3U1OA 4LZ5A 1TFAA 3S9EA 1JETA 3KJ7A 4TLMB 3TQLA 3ZKKA 1B5IA 4JBZA 3CIJA 2F7AA 5H8FB 2R6GE 4F19A 3H6VA 3OO9A 4EF2A 1QGXA 3D4GA 1LBWA 3K6WA 1Y3NA 3O2AA 3V83A 3FJMA 5FHNA 5ISUA 3ZS6A 4DLDA 3IR1A 4N6KA 2OZZA 4BDOA 3A29A 4QXDA 1FPJA 1M5BA 3MAMA 5AA4A 1O64A 4JVIA 2QFLA 3IX1A 4DXCA 3MSTA 1B52A 1CB6A 4LP2B 1M5CA 1MQJA 4N6DA 1LAXA 1FPDA 1B1XA 1A8FA 4PFYA 1B46A 4MMPA 3N5LA 1DK4A 5JK4A 3IOVA 3VV5A 2G93A 1ELJA 4ZEKA 4NF5B 3NOHA 3VXCA 3MC2A 1YYZA 3C9HA 4F1UA 1ANFA 3MVZA 3U65A 2RC7A 2F97A 2WBDA 4DI4B 4LQ5A 2VHAA 1P1WA 2GH9A 1QUKA 4F18A 2P2AA 3KZGA 4H6DA 4GWZA 4RXLA 4G4PA 2HHMA 1A55A 5J1DA 4RNSA 2WBBA 3G3KA 1NV1A 2CZLA 1HSJA 1I6AA 3PUWE 3T9VA 1XT8A 1IMFA 5CBSA 3RLFE 4H65A 2ZXTA 1VR5A 4IO3A 1UQWA 1FBEA 4X48A 4GWOA 2Q8JA 4KCCA 5CI5A 4XIGQ 4DE8A 4ISUA 1I6BA 4G8HA 1SW2A 1A99A 1MQIA 3MVXA 3S9NC 1ZKBA 1IUDA 3UA8A 4R9FA 4PFIA 3TELA 3QUJA 1MY1A 4GBWA 1B9JA 3QAXA 3QSLA 2HAVA 2Y5KA 3FVNA 4OTEA 2P0SA 1P1QA 3KG2A 5HBCA 1FTMA 2R8TA 5AA3A 1LBXA 4IO6A 3FVGA 5LOMA 2OWTA 1B58A 3UP9A 2P3NA 3SKPA 1IXCA 1H44A 1INPA 3K1NA 1BKAA 2FIEA 1MPCA 4OESA 4F22A 5AE4A 1SPIA 4E0WA 2HPGA 4N6PA 4FBPA 3TCGA 5A5XA 3N94A 1DPEA 4KPTA 3B7DA 4ZZEA 1ZLQA 4HCYA 1B5JA 4FE8A 4GX6A 2OK2A 4YB5A 2VOZA 1IEJA 5BWJA 2PMSA 4XEQA 4O3CA 1K9YA 4NX1A 1PEBA 3B6QA 2WYKA 3B6WA 1FBPA 1IXHA 1I69A 1P1NA 3SETA 1CNQA 4MHFA 2ZYNA 4YB7A 4GL8A 1SDXA 4MFIA 4MLQA 2AYSA 2RCBA 4ZEDA 3EF7A 2HZLA 4R9GA 4F2QA 5TP9A 1TWYA 2B3FA 1MY2A 5HPQA 4GXAA 1I6QA 3QUFA 1BP5A 4YU0A 1URDA 3TUSA 1R1NA 3BFTA 5DT6A 3DM0A 2H98A 1MDQA 3KOSA 2DSFA 4KXPA 3Q25A 3G3IA 1NH8A 3MZBA 4F3BA 4MF3A 3TKDA 1IZ1A 5A5LA 1FPKA 1LAGE 3OSQA 4DDDA 2UYEA 4IO2A 1LFGA 3OOAA 3P7IA 4ZZAA 3HHFA 1SW1A 4BDLA 4JXIA 5FHMA 5IGAA 2NXOA 2PCRA 3TTMA 2B3BA 4G68B 1PBQA 2BJIA 5L9OA 2XXKA 2PYYA 5I58A 1B5HA 4LN5A 5F7VA 3HFUA 1MH4A 4QF9A 1PC3A 3I6VA 4I1DA 1IIWA 4F2OA 2DDKA 4F31B 4NG7A 4NF6B 3EHSA 3LBSA 1LBBA 3TZAA 1AH5A 4PGPA 1L5TA 4MNPA 3C33A 4JDFA 3M3LA 3LSLA 1UIUA 5TPAA 3MPKA 1HSLA 5I2NA 1B3EA 3K6VA 3KN3A 2H99A 4JWOA 2ZZVA 4OEVA 1TXFA 4P3LA 2OCUA 2XD3A 2X7PA 3MBPA 4MAGA 3T1BA 3EHUA 1AOVA 2DVCA 3E79A 4KYSA 1QUJA 4YZZA 1OLAA 5ET8A 4ZDMA 4NF8B 3U93A 2DWIA 3KSJA 2Z8EA 4AS5A 1RDXA 1G0IA 1FCKA 5ITPA 3SDFA 1FBHA 1IXGA 4OEUA 1JVXA 3V89B 1J1NA 1FJ6A 1Q1KA 3TCHA 4QSCA 1P99A 3KFMA 4HCWA 3WAFA 2XXXA 2CEYA 3C36A 1ATGA 1NV2A 3G3JA 2B4MA 1GGGA 2I6EA 4HE2A 5H8HA 4OVJA 4UABA 3IB2A 4ZS9A 3IB0A 3Q27A 3PMXA 5IAIA 3QXMA 1D3KA 3RTFB 2QJEA 1MS7A 5I58B 2CZKA 2VP1A 1A8EA 4IY6A 3K01A 4X1BA 4H46A 5I57B 1Y3QA 4MBPA 3AXFA 1B32A 3RPWA 5LTCA 4R6HA 3D1RA 3SESA 5EQ8A 4PDHA 3MQ9A 4GFRA 5I3SA 4E0XA 1PB9A 3H6TA 1XI6A 5FTHA 1EZ9A 5H8FA 2REJA 4H67A 3K1PA 3T93B 1GVCA 3K6XA 5TPAB 3GYYA 4GQOA 2YLNA 3PPOA 5I2NB 1QUIA 4OHNA 4MIJA 2XXWA 3VXBA 3U8QA 4RK9A 3RN8A 2Z8DA 2R71A 3G7WA 3QMFA 5H8NB 2RF1A 3RYDA 2Y5LA 4R6KA 4FAJA 2UVGA 2AL4A 1FPEA 4OVTA 5JEIA 1DCUA 2O51A 5B70A 3O6GA 2CEXA 1B7HA 5CBRA 1K9ZA 3L6GA 4NF5A 4OWDA 1Y9UA 2XXTA 1MM6A 3IAZA 4QBAA 5EQ9A 5AA2B 4GBVA 3RQTA 2HZKA 1Q35A 1FQDA 3ZKLA 3LUZA 3OEKA 2Q2CA 1USYH 3MWBA 4GWYA 5KDTB 4KFQA 5I84A 1D9QA 3CG1A 4KCDA 3RT6B 3IL1B 1FQFA 3RPLB 5HM4B 3A3UA 1NNPA 1MQHA 2F7CA 1SI1A 4I9DA 2CZIA 1T0KA 1QKBA 2ANJA 4MLVA 4G8MA 4JSOA 4TLLB 1Q9DA 2Q74A 4GX4A 4HXVA 1VDWA 4BDRA 4ELOA 1YXIA 3SZPA 2F8DA 4WKMA 3N6TA 4ESWA 3TCFA 4EUOA 2ZZWA 3EN3A 4PBHA 4ELQA 4IO4A 2NOOA 5EHMA 4ZE9A 1KA1A 4IGRA 4U21A 5ET7A 3IOTA 3TODA 4G77A 5ET6A 1Z7ME 3PD8A 2GHBA 1PB7A 2XA5A 2Q9TA 3TFLA 5F24A 4TQUQ 1FPIA 4OVRA 1OMPA 4MNCA 3CVGA 3G3FA 3S9MC 3BIHA 1PBPA 3TQWA 1FTOA 2NWJA 1B3FA 4DIGA 2XWIA 1ZMGA 3IB1A 2UYFA 4LUBA 1XVXA 2BJJX 2ZZXA 4AQ4A 1SYIA 3RT8A 4RYAA 2QPQA 3U92A 2O84X 3PUYE 3VE1B 4IR8A 1SBPA 4U1OA 1NV5A 2I4CA 4I3EA 4GD5A 3SEUA 3BIGA 4NE4A 4YKPA 2OX3A 3PV0E 1FQEA 3I3VA 1Z7NE 3CFXA 1IITA 1DSNA 4POWA 3MVYA 4NAPA 1RDYA 1A54A 4PCDA 2PX1A 1ZIUA 2ZYKA 3ISPA 1Y3PA 5CC2A 2O7UA 1MXWA 4YKJA 5IZ3A 5DYHA 2UXAA 3TTKA 1BLFA 3ONMA 3K2DA 1TT1A 3E9XA 4X9TA 1EZPA 4UA8A 4PTKA 2I49A 2HXRA 3VDFA 2QVRA 4P9KA 3ILUB 3MVWA 3M3KA 1US4A 4JB7A 4X1DA 4FEBA 3V8XB 2G29A 1B0LA 4GVOA 1LSTA 5L9SA 1NV4A 1LBYA 1OIBA 2FBPA 1H76A 5AA1A 2NUVA 3DELB 4PF6A 1N04A 1KWHA 5L8DA 2KQZA 3EPEA 4G68A 2OLBA 3FXQA 1MXVA 1DTZA 2HCAA 5TU0A 3JYRA 2XXQA 3HN0A 3FVKA 2XXPA 2XXYA 4H45A 2DOJA 2AIXA 1NNKA 2O1LA 4F3PA 3FD3A 1B3HA 4XXUA 1Y4TA 2QS3A 3HPIA 3MP1A 3THIA 4NF6A 4OENA 3CFLA 3PMVA 4GWWA 1LB8A 5I56B 4GL0A 1KZ8A 2OBGA 4PAKA 3Q26A 3Q28A 4XKQA 4PFUA 3ODBA 3GXAA 4OVPA 2CZHA 4DXBA 4X8RA 4NQ8A 3CG3A 2DE3A 3IK6B 3UK4A 2CMOA 1JW4A 2Y7IA 2ONSA 3SEXA 4EF1A 1AL3A 5M2VA 1FW0A 1RKMA 2O7IA 4EXLA 5ICQA 3H6WA 1SW5A 4AS4A 1WDNA 2IEEA 3MJNA 4H8JA 4PBQA 3KJTA 1FTKA 4OA4A 4XTCQ 4PFBA 1B51A 4OERA 1GTKA 3ECRA 4F3SA 4R75A 3FV1A 1XC1A 4O8MA 3O6HA 4R74A 4N8GA 1KA0A 1B3GA 3MUQA 4WEDA 4H5GA 4KQPA 4QFOA 5KCJB 4U4SA 4O7IA 4NF8A 4IB2A 1YAEA 3GBBA 3ILTB 1BIYA 2X26A 1LGBC 4MH5A 3VFJA 2QS2A 1IMAA 4EDPA 3IFCA 4R6YA 4NGUA 2PT2A 5IZ3B 1WVJA 1R9QA 1TFDA 2H25A 4BDMA 1FPLA 4LA9A 5H8QB 5JTYA 2Z8FA 5IM2A 5DEXB 2I4BA 4Q0CA 1MXZA 3H3GA 2D21A 3F11A 4XF5A 3IO4A 1LCFA 3CSBA 4MCOA 2FNCA 3IOUA 3PUZE 4EQBA 2ZNSA 4BDNA 3T9UA 1JNFA 3O97A 1HSEA 2DYXA 3BKIB 2XXVA 2GHAA 5I7IA 2V3UA 1R9LA 4POXA 4U4XA 1BTJA 2LAOA 1ZU0A 3FXBA 5L9MA 1FTJA 4FIMA 4RA1A 4OFOA 5CMMA 2WX9A 2XX9A 5I57A 1D9YA 3DLNA 1H43A 3TEPA 2VT5A 3I5OA 5IZ1A 3MP8A 3SEYA 2F6GA 1S50A 4GOTA 4QFKA 1USYE 3ROJA 1NKXA 4HW8A 3TYHA 5LDZA 4LQ2A 4OXVA 4PC9A 4HE1A 2W7YA 2WEFA 2ONKE 3EHTA 2O1MA 3LSWA 1URGA 4GX3A 4KR5A 1N0TA 3T9HB 1B4ZA 4U23A 2REGA 1QULA 3SEVA 2V4CA 2DVZA 2RINA 2RCAA 1B05A 2E0SA 3H6UA 5H8NA 5FTIA 1MPDA 4ZEIA 3C34A 3FASA 4H5FA 1LCTA 3OEMA 2P1SA 4P47A 1NUZA 1R6ZA 4RJZA 4XKPA 1DBZA 2F3BA 3CRBA 4DI3D 4AB5A 4ESXA 3GBAA 4TOZA 1GV8A 4NMYA 1NUWA 3GLBA 4RPOA 1GR2A 4H1XA 5DW8A 1IMBA 5AA2A 5JTYB 4PFWA 3OMBA 1P1UA 4PETA 4OVSA 2PVUA 5KDTA 1AWBA 4PQJA 1Y1ZA 2QSXA 3LUYA 4X04A 3RPLA 4R2BA 3MPLA 3CI8A 4Q8RA 3FIRA 3C35A 3KBRA 4LVQA 1YCJA 2V3QA 4KI0E 2DS9A 3QK6A 4PFTA 1SI0A 3MP6A 3PD9A 1MPBA 2A5TB 4OQOA 4N8YA 4QSEA 2OJTA 4R2FA 1YZ0A 1MH3A 5J16A 2B65A 1MQGA 3G3HA 4GLIA 4NN3A 4N81A 1JW5A 5DVIA 3OO7A 4P0IA 2V84A 1NV3A 5CMCA 5ITOA 3UORA 1EYIA 4YKIA 5DTBA 1G0HA 4ZEBA 1A40A 2RC9A 2XX7A 1RDZA 1N7XA 2QVVA 1SQYA 3LV0A 3M8UA 4U22A 5K2YA 4O3AA 1XOCA 4I40A 4F3GA 4I62A 3TDJA 2Q2AA 2L5VA 4JVCA 2DWJA 3T66A 5K2XA 4QHQA 1SVXB 3N26A 1LAHE 1SD3A 3IOWA 2HQ0A 3DP6A 3S2VA 1RYXA 2OWZA 4GXSB 3LC8A 4YICA 3ZSFA 2F36A 2ESNA 1H3DA 4OMBA 1OQGA 4K3FA 2UVJA 2D3IA 2YJPA 3H4ZA 5I5PA 4GF8A 1SYHA 4BDQA 4N17A 4GWSA 2F5XA 4P1EA 3FJGA 3Q29A 4MEVA 1YTVA 2DWHA 1ZTYA 4GWXA 2F35A 2PT1A 4RY1A 4F29A 3RNNA 1POTA 3IJOB 3B50A 1MXUA 3VLWA 1PB8A 3C32A 1Y1MA 1QW0A 3KC0A 3BFUA 5F1QA 3KN8A 1XVYA 4NTLA 4XKNA 5B7DA 4OZ9A 2PBWA 1VE4A 1DPPA 1NUYA 1FJ9A 3K02A 3RGYA 4IY5A 2ZNUA 2DE4A 1DTGA 1B6HA 1MY0A 3O9PA 4ND9A 2A5SA 1NH7A 5EYFA 4G2ZA 2O69A 3CHGA 4GWUA 1M5FA 2E1SA 1OVBA 2Y84A 3MZ1A 4Z0IA 2F7BA 4JWXA 4LATA 4QFNA 5I56A 2FHYA 4U1ZA 2DWAA 4N13A 1FQBA 3PTYA 4FORA 1B4HA 3HHGA 3QIMA 4C1TA 1EZOA 4U2RA 3CFZA 5EYHA 4GIZA 4G68C 3PGFA 3U94A 2DXRA 4P8BA 1NNFA 4PP0A 4ZE8A 1XHYA 2Z22A 2FIXA 3HCQA 4MJOA 2QS4A 2KR0A 3E78A 4F1VA 1II5A 3W9WA 4Q30B 3KOTA 3E4RA 5DVJA 4LZ8A 3PMWA 4P11A 3FATA 3FJ7A 2GQ1A 4YAHX 3PU5A 4R73A 2Z23A 2I3WA 1IMDA 3FXRA 5KCJA 4ZEFA 4NWCA 1FQAA 3MYUA 3JZJA 1POY1 2I0CA 4IO7A 5T3JA 2OWSA 4P1LA 1LBZA 4ZECA 2VGQA 1UIVA 5H8QA 4WEPA 1JEVA 2Q88A 5ET5A 1JP4A 4P56A 4P0GA 5DEXA 3OO6A 1UTBA 4LZ7A 1VSOA 1NV7A 4FEDA 5FBPA 3B8BA 3PPPA 1NUXA 4HTGA 4NF0A 1PDAA 4ONYA 3S4UA 5I2KB 3VVEA 4OFLA 1FRPA 4NF4B 2XWKA 3T9XB 4PAFA 4JWYA 3MW0A 3SEWA 1MY3A 1QVSA 1NFTA 1FQCA 5EQ7A 2FYIA 2F3DA 3LSXA 3PPNA 2VD2A 3OD7A 1D4NA 3FVOA 3R6UA 3T0JA 2D5WA 3FZVA 4PFRA 4PF8A 3K6UA 4XFEA 3H7MA 1O7TA 2DP8A 3HO7A 3K0VA 1EU8A 1IMCA 5I59A 4JSDA 4GRKA 3UN6A 4I3YA 4NEDA 2QL3A 2I48A 2HFBA 3T22A 1FTLA 1B1HA 4H8IA 4ELPA 3CR9A 4KD5A 1OLCA 1M5DA 3O66A 5BUUA 5AA4B 4EXKA 3FV2A 2KLFA 2DE2A 3DP4A 3FBPA 3IFAA 4YKKA 4ELRA 4HE0A 4N15A 3IJXB 2WKYA 2XX8A 1FPBA 3TAJA 1JQFA 1B3LA 2RC8A 5EYGA 4N91A 2Y7PA 3RUMA 1MRPA 2RKMA 2VPNA 5FHOA 4OETA 3KC1A 1LBCA 1MDP1 5DVFA 3EKIA 1QKAA 3OSRA 3USDA 1B0HA 1FBGA 1IQ7A 4R72A 3UGWA 3H03A 4PE3A 5ELVA 2DXYA 1UTBB 1JVYA 1LLSA 1MM7A 1NNTA 3FGSA 2QMWA 3K4UA 1EYKA 2GFEA 5CRYA 5EHSA 3VLVA 5H8SA 1UTHA 2O6AA 1EYJA 3L6HA 2XXUA 2HAUA 4DZ1A 1MXXA 1XS5A 4L17A 4F39A 2X7QA 1Y4CA 2A5TA 3TMGA 4F1YA 4LONB 3VLUA 1IXIA 1ZBMA 3FUZA 1FBFA 1S9TA 3PPQA 1A7LA 2V3TA 3TTNA 4NWDA 3C31A 3VVFA 4DXUA 1B7UA 2B4LA 5CM6A 2ALUA 4KYDA 4PGNA 3T96B 2I0BA 1FPFA 4HS7A 3JV9A 5I59B 4NHBA 3TTLA 3MZ9A 2Y7KA 3E3KA 4OVQA 3M3FA 1N3XA 4M4GA 1MQDA 4H0WA 3KGCA 4G61A 3W9VA 3EQ1A 2ZMBA 2THIA 3DP8A 3N6UA 4PAIA 3IORA 4QRZA 3OELA 3U72A 3O29A 1DOTA 1SW4A 3B6TA 3H06B 4EQ7A 3K1MA 3RY3A 1M5EA 3SERA 4Q5TA 4G8NA 1LB9A 3S9LC 5A5XB 5AA2D 4DCYA 1DMBA 4C1UA 3W15C 1LFIA 2XXIA 4O94A 3TTRA 2V25A 3O28A 2AL5A 4KYEA 2UVHA 4OFJA 2Q8MA 4YMAA 2H9BA 4FJPA 1US5A 1Y20A 4QFPA 3OXNA 4QSDA 4KHZE 2QMXA 4THIA 5TP9B 3PUXE 2NVUB 3HV1A 3A09A 1IMEA 2F78A 1QJMA 2H4IA 1VFEA 2XWOA 1UTHB 2R9JA 2HEUA 1NL5A 1F9BA 4DCXA 5CMBA 1MXYA 3FXUA 3K00A 3OO8A 4O7MA 2QRYA 3OENA 1BK4A 1B7ZA 3VVDA 4PE5B 1AMFA 3QYTA 3TPAA 4YMBA 2M8CA 2XHDA 3UIFA 2Q89A 3C4MA 1URSA 3D4CA 4M1VA 1S7YA 2ABHA 4PDDA 4RPNA 4XKRA 1LFHA 2O68A 1N84A 2ONRA 1LAFE 4FECA 5IKBA 3RTWB 4OANA 1JW1A 2QS1A 3A3CA 1B2HA 3E13X 2VPOA 2I58A 2WYPA 2XWVA 4N07A 1LEVA 4Z7EA 2PFZA 3CSGA 4I8CA 2FA7A 4YB6A 4RK2A 2ZYOA 3HSTA 1N7WA 1NV6A 2Y7WA 3O6IA 3IO6A 5KZTA 2VD3A 4MNIA 4UACA 4QFLA 1EH3A 1B40A 3KSXA 4EQ9A 2I3VA 3PPRA 3V5AA 1N3WA 2H5YA 2JJKA 1YPNA 5ESYA 2ZYMA 4OYVA 3GZGA 1AIVA 1H45A 5CMKA 1WODA 3G3GA 4IO5A 2V93A 3KEIA 2XD2A 1P1OA 2Y7RA 4JVDA 3LR1A 4BLAA 1OQHA 1O63A 2QVUA 2PFYA 2ZNTA 1FTAA 2MKZA 5IZZA 2F34A 1N76A 4AB6A 2UVIA 3PUVE 2GRVA 2P3VA 2F6PA 4C0RA 5I2KA 1FPGA 4MX6A 4NF4A 1NV0A 2FVZA 2XXRA 1RYOA 1OVTA 3BBRA 1NMUA 4N4UA 1JEUA 4ECFA 1VFDA
chains in the Genus database with same CATH topology
3R7XA 2YPNA 5H8HB 5ICTA 1MG1A 4WXJA 4FATA 2IA4A 1ZJLA 2DQVA 4O3BA 1CE2A 1D9VA 4IGTA 2HXWA 3LSFB 2XXHA 3WAEA 3KN7A 3R26A 1MY4A 3U1OA 4LZ5A 1TFAA 3S9EA 1JETA 3KJ7A 4TLMB 3TQLA 3ZKKA 1B5IA 4JBZA 3CIJA 2F7AA 5H8FB 2R6GE 4F19A 3H6VA 3OO9A 4EF2A 3D4GA 3K6WA 1Y3NA 3O2AA 3V83A 3FJMA 5FHNA 5ISUA 3ZS6A 4DLDA 3IR1A 2OZZA 4BDOA 1M5BA 3MAMA 5AA4A 1O64A 3IX1A 4DXCA 1B52A 1CB6A 4LP2B 1M5CA 1MQJA 1LAXA 1B1XA 1A8FA 4PFYA 1B46A 3N5LA 5JK4A 3IOVA 3VV5A 2G93A 1ELJA 4ZEKA 4NF5B 3VXCA 3MC2A 3C9HA 4F1UA 1ANFA 3MVZA 2RC7A 2F97A 4LQ5A 2VHAA 1P1WA 2GH9A 1QUKA 4F18A 2P2AA 3KZGA 4H6DA 4RXLA 4G4PA 1A55A 5J1DA 4RNSA 3G3KA 2CZLA 1HSJA 1I6AA 3PUWE 3T9VA 1XT8A 5CBSA 3RLFE 4H65A 2ZXTA 1VR5A 4IO3A 1UQWA 4X48A 4GWOA 2Q8JA 4KCCA 5CI5A 4XIGQ 4DE8A 4ISUA 1I6BA 4G8HA 1SW2A 1A99A 1MQIA 3MVXA 3S9NC 1ZKBA 1IUDA 3UA8A 4R9FA 3TELA 3QUJA 1MY1A 1B9JA 3QAXA 3QSLA 2HAVA 3FVNA 4OTEA 2P0SA 1P1QA 3KG2A 5HBCA 1FTMA 5AA3A 4IO6A 3FVGA 5LOMA 2OWTA 1B58A 3UP9A 3SKPA 1IXCA 1H44A 3K1NA 1BKAA 1MPCA 4OESA 4F22A 5AE4A 4E0WA 4N6PA 3TCGA 5A5XA 3N94A 1DPEA 4KPTA 3B7DA 4ZZEA 1ZLQA 4HCYA 1B5JA 4FE8A 2OK2A 4YB5A 2VOZA 1IEJA 5BWJA 2PMSA 4O3CA 1PEBA 3B6QA 3B6WA 1I69A 1IXHA 1P1NA 3SETA 2ZYNA 4YB7A 4GL8A 1SDXA 4MFIA 4MLQA 2AYSA 2RCBA 4ZEDA 3EF7A 2HZLA 4R9GA 4F2QA 5TP9A 1TWYA 2B3FA 1MY2A 5HPQA 4GXAA 1I6QA 3QUFA 1BP5A 4YU0A 1URDA 3TUSA 1R1NA 3BFTA 5DT6A 3DM0A 2H98A 1MDQA 3KOSA 2DSFA 3Q25A 3G3IA 1NH8A 3MZBA 4F3BA 4MF3A 3TKDA 1IZ1A 1LAGE 3OSQA 4DDDA 2UYEA 4IO2A 1LFGA 3OOAA 3P7IA 4ZZAA 3HHFA 1SW1A 4BDLA 4JXIA 5FHMA 2NXOA 3TTMA 2B3BA 4G68B 1PBQA 5L9OA 2PYYA 5I58A 1B5HA 5F7VA 1MH4A 4QF9A 1PC3A 3I6VA 4I1DA 1IIWA 4F2OA 4F31B 4NF6B 3EHSA 3LBSA 1LBBA 3TZAA 1AH5A 1L5TA 3C33A 4JDFA 3M3LA 3LSLA 1UIUA 5TPAA 3MPKA 1HSLA 5I2NA 1B3EA 3K6VA 3KN3A 2H99A 4JWOA 4OEVA 1TXFA 2OCUA 2XD3A 2X7PA 3MBPA 3EHUA 1AOVA 2DVCA 4KYSA 1QUJA 4YZZA 1OLAA 4ZDMA 4NF8B 3U93A 2DWIA 3KSJA 2Z8EA 1FCKA 5ITPA 3SDFA 1IXGA 4OEUA 1JVXA 3V89B 1J1NA 1Q1KA 3TCHA 4QSCA 1P99A 3KFMA 4HCWA 3WAFA 2XXXA 3C36A 1ATGA 3G3JA 1GGGA 2I6EA 5H8HA 4OVJA 3IB2A 4ZS9A 3IB0A 3Q27A 3PMXA 5IAIA 3QXMA 1D3KA 3RTFB 2QJEA 1MS7A 5I58B 2VP1A 1A8EA 4IY6A 3K01A 4X1BA 5I57B 1Y3QA 4MBPA 3AXFA 1B32A 3RPWA 4R6HA 3SESA 3MQ9A 4GFRA 4E0XA 1PB9A 3H6TA 5FTHA 1EZ9A 5H8FA 2REJA 4H67A 3K1PA 3T93B 1GVCA 3K6XA 5TPAB 4GQOA 2YLNA 3PPOA 5I2NB 1QUIA 4OHNA 2XXWA 3VXBA 3U8QA 4RK9A 3RN8A 2Z8DA 2R71A 3G7WA 5H8NB 2RF1A 4R6KA 4FAJA 2UVGA 2AL4A 5JEIA 2O51A 5B70A 3O6GA 1B7HA 5CBRA 3L6GA 4NF5A 4OWDA 1Y9UA 2XXTA 1MM6A 3IAZA 5AA2B 3RQTA 2HZKA 1Q35A 1FQDA 3ZKLA 3OEKA 2Q2CA 1USYH 3MWBA 5KDTB 4KFQA 5I84A 3CG1A 4KCDA 3RT6B 3IL1B 1FQFA 5HM4B 3A3UA 1NNPA 1MQHA 2F7CA 1SI1A 4I9DA 1T0KA 1QKBA 2ANJA 4MLVA 4G8MA 4JSOA 4TLLB 4BDRA 4ELOA 2F8DA 4WKMA 3N6TA 4ESWA 3TCFA 4EUOA 3EN3A 4ELQA 4IO4A 2NOOA 5EHMA 4ZE9A 4IGRA 4U21A 3IOTA 3TODA 4G77A 1Z7ME 3PD8A 2GHBA 1PB7A 2Q9TA 3TFLA 4TQUQ 1OMPA 3CVGA 3G3FA 3S9MC 1PBPA 3TQWA 1FTOA 2NWJA 1B3FA 4DIGA 1ZMGA 3IB1A 2UYFA 4LUBA 1XVXA 2BJJX 4AQ4A 1SYIA 3RT8A 4RYAA 2QPQA 3U92A 2O84X 3PUYE 3VE1B 1SBPA 4U1OA 2I4CA 4GD5A 3SEUA 4NE4A 4YKPA 3PV0E 1FQEA 3I3VA 1Z7NE 3CFXA 1IITA 1DSNA 4POWA 3MVYA 1A54A 2PX1A 1ZIUA 2ZYKA 1Y3PA 5CC2A 2O7UA 1MXWA 4YKJA 5DYHA 2UXAA 3TTKA 1BLFA 3ONMA 3K2DA 1TT1A 3E9XA 4X9TA 1EZPA 4UA8A 2I49A 3VDFA 3ILUB 3MVWA 3M3KA 1US4A 4JB7A 4X1DA 4FEBA 3V8XB 2G29A 1B0LA 4GVOA 1LSTA 5L9SA 1OIBA 1H76A 5AA1A 2NUVA 3DELB 1N04A 1KWHA 5L8DA 3EPEA 4G68A 2OLBA 3FXQA 1MXVA 1DTZA 2HCAA 5TU0A 3JYRA 2XXQA 3HN0A 3FVKA 2XXPA 2XXYA 2DOJA 2AIXA 1NNKA 2O1LA 4F3PA 3FD3A 1B3HA 4XXUA 1Y4TA 2QS3A 3HPIA 3MP1A 3THIA 4NF6A 4OENA 3CFLA 3PMVA 1LB8A 5I56B 4GL0A 2OBGA 3Q26A 3Q28A 4XKQA 4PFUA 3ODBA 3GXAA 4DXBA 3CG3A 2DE3A 3IK6B 3UK4A 2CMOA 1JW4A 2Y7IA 2ONSA 3SEXA 4EF1A 1AL3A 5M2VA 1FW0A 1RKMA 2O7IA 4EXLA 5ICQA 3H6WA 1SW5A 1WDNA 2IEEA 3MJNA 4H8JA 3KJTA 1FTKA 4XTCQ 1B51A 4OERA 1GTKA 3ECRA 4F3SA 4R75A 3FV1A 1XC1A 3O6HA 4R74A 1B3GA 3MUQA 4WEDA 4H5GA 4KQPA 4QFOA 5KCJB 4U4SA 4NF8A 4IB2A 1YAEA 3GBBA 3ILTB 1BIYA 2X26A 1LGBC 4MH5A 3VFJA 2QS2A 4EDPA 4R6YA 2PT2A 1WVJA 1R9QA 1TFDA 2H25A 4BDMA 4LA9A 5H8QB 5JTYA 2Z8FA 5DEXB 2I4BA 4Q0CA 1MXZA 3H3GA 2D21A 3F11A 3IO4A 1LCFA 3CSBA 2FNCA 3IOUA 3PUZE 4EQBA 2ZNSA 4BDNA 3T9UA 1JNFA 3O97A 1HSEA 2DYXA 3BKIB 2XXVA 2GHAA 2V3UA 1R9LA 4POXA 4U4XA 1BTJA 2LAOA 1ZU0A 5L9MA 1FTJA 4FIMA 4RA1A 4OFOA 5CMMA 2XX9A 5I57A 1D9YA 3DLNA 1H43A 3TEPA 3I5OA 3MP8A 3SEYA 2F6GA 1S50A 4GOTA 4QFKA 1USYE 1NKXA 4HW8A 3TYHA 4LQ2A 4OXVA 2W7YA 2ONKE 3EHTA 2O1MA 3LSWA 1URGA 4KR5A 1N0TA 3T9HB 1B4ZA 4U23A 2REGA 1QULA 3SEVA 2DVZA 2RINA 2RCAA 1B05A 2E0SA 3H6UA 5H8NA 5FTIA 1MPDA 4ZEIA 3C34A 3FASA 4H5FA 1LCTA 3OEMA 2P1SA 1R6ZA 4RJZA 4XKPA 3CRBA 4AB5A 4ESXA 3GBAA 4TOZA 1GV8A 4NMYA 3GLBA 4RPOA 1GR2A 4H1XA 5AA2A 5JTYB 4PFWA 3OMBA 1P1UA 4PETA 2PVUA 5KDTA 4PQJA 1Y1ZA 2QSXA 3LUYA 4R2BA 3MPLA 3CI8A 4Q8RA 3FIRA 3C35A 3KBRA 4LVQA 1YCJA 2V3QA 4KI0E 2DS9A 3QK6A 4PFTA 1SI0A 3MP6A 3PD9A 1MPBA 2A5TB 4OQOA 4QSEA 2OJTA 4R2FA 1MH3A 2B65A 1MQGA 3G3HA 4GLIA 1JW5A 5DVIA 3OO7A 4P0IA 2V84A 5CMCA 5ITOA 3UORA 4YKIA 5DTBA 4ZEBA 1A40A 2RC9A 2XX7A 1N7XA 1SQYA 3M8UA 4U22A 5K2YA 4O3AA 1XOCA 4F3GA 4I62A 3TDJA 2Q2AA 2DWJA 3T66A 5K2XA 4QHQA 1SVXB 3N26A 1LAHE 1SD3A 3IOWA 2HQ0A 3DP6A 3S2VA 1RYXA 4GXSB 3LC8A 4YICA 3ZSFA 2F36A 2ESNA 1H3DA 4OMBA 1OQGA 4K3FA 2UVJA 2D3IA 2YJPA 3H4ZA 4GF8A 1SYHA 4BDQA 2F5XA 3FJGA 3Q29A 1YTVA 2DWHA 1ZTYA 2F35A 2PT1A 4RY1A 4F29A 3RNNA 1POTA 3IJOB 1MXUA 3VLWA 1PB8A 3C32A 1Y1MA 1QW0A 3BFUA 5F1QA 3KN8A 1XVYA 4NTLA 4XKNA 5B7DA 4OZ9A 2PBWA 1VE4A 1DPPA 3K02A 3RGYA 4IY5A 2ZNUA 2DE4A 1DTGA 1B6HA 1MY0A 3O9PA 4ND9A 2A5SA 1NH7A 5EYFA 4G2ZA 2O69A 1M5FA 2E1SA 1OVBA 2Y84A 3MZ1A 4Z0IA 2F7BA 4JWXA 4LATA 4QFNA 5I56A 4U1ZA 2DWAA 1FQBA 4FORA 4N13A 1B4HA 3HHGA 3QIMA 4C1TA 1EZOA 4U2RA 3CFZA 4GIZA 4G68C 3PGFA 3U94A 2DXRA 4PP0A 1NNFA 4ZE8A 1XHYA 2Z22A 3HCQA 2QS4A 4F1VA 1II5A 3W9WA 4Q30B 3KOTA 3E4RA 5DVJA 4LZ8A 3PMWA 4P11A 3FATA 3FJ7A 4YAHX 3PU5A 4R73A 2Z23A 2I3WA 3FXRA 5KCJA 4ZEFA 4NWCA 1FQAA 3JZJA 1POY1 2I0CA 4IO7A 2OWSA 4ZECA 2VGQA 1UIVA 5H8QA 4WEPA 1JEVA 2Q88A 4P0GA 5DEXA 3OO6A 1UTBA 4LZ7A 1VSOA 4FEDA 3PPPA 4HTGA 1PDAA 4ONYA 3S4UA 5I2KB 3VVEA 4OFLA 4NF4B 3T9XB 4JWYA 3MW0A 3SEWA 1MY3A 1QVSA 1NFTA 1FQCA 2FYIA 3LSXA 3PPNA 2VD2A 3OD7A 1D4NA 3FVOA 3R6UA 2D5WA 3FZVA 3K6UA 3H7MA 1O7TA 2DP8A 3HO7A 3K0VA 1EU8A 5I59A 4JSDA 4GRKA 3UN6A 4NEDA 2QL3A 2I48A 2HFBA 3T22A 1FTLA 1B1HA 4H8IA 4ELPA 3CR9A 4KD5A 1OLCA 1M5DA 3O66A 5BUUA 5AA4B 4EXKA 3FV2A 2KLFA 2DE2A 3DP4A 4YKKA 4ELRA 3IJXB 2WKYA 2XX8A 3TAJA 1JQFA 1B3LA 2RC8A 2Y7PA 3RUMA 1MRPA 2RKMA 5FHOA 4OETA 1LBCA 1MDP1 5DVFA 1QKAA 3OSRA 3USDA 1B0HA 1IQ7A 4R72A 3UGWA 3H03A 5ELVA 2DXYA 1UTBB 1JVYA 1LLSA 1MM7A 1NNTA 3FGSA 2QMWA 3K4UA 2GFEA 5CRYA 5EHSA 3VLVA 5H8SA 1UTHA 2O6AA 3L6HA 2XXUA 2HAUA 4DZ1A 1MXXA 1XS5A 4L17A 4F39A 2X7QA 1Y4CA 2A5TA 3TMGA 4F1YA 4LONB 3VLUA 1IXIA 1ZBMA 3FUZA 1S9TA 3PPQA 1A7LA 2V3TA 3TTNA 4NWDA 3C31A 3VVFA 4DXUA 1B7UA 5CM6A 2ALUA 4KYDA 3T96B 2I0BA 4HS7A 3JV9A 5I59B 3TTLA 3MZ9A 2Y7KA 3E3KA 3M3FA 1N3XA 4M4GA 1MQDA 4H0WA 3KGCA 3W9VA 3EQ1A 2ZMBA 2THIA 3DP8A 3N6UA 3IORA 4QRZA 3OELA 3U72A 3O29A 1DOTA 1SW4A 3B6TA 3H06B 4EQ7A 3K1MA 3RY3A 1M5EA 3SERA 4Q5TA 4G8NA 1LB9A 3S9LC 5A5XB 5AA2D 4DCYA 1DMBA 4C1UA 3W15C 1LFIA 2XXIA 3TTRA 2V25A 3O28A 2AL5A 4KYEA 2UVHA 4OFJA 4YMAA 2H9BA 4FJPA 1US5A 1Y20A 4QFPA 3OXNA 4QSDA 4KHZE 2QMXA 4THIA 5TP9B 3PUXE 2NVUB 3HV1A 3A09A 2F78A 1QJMA 2H4IA 1VFEA 1UTHB 2R9JA 2HEUA 1NL5A 1F9BA 4DCXA 5CMBA 1MXYA 3FXUA 3K00A 3OO8A 2QRYA 3OENA 1B7ZA 3VVDA 4PE5B 1AMFA 3QYTA 3TPAA 4YMBA 2M8CA 2XHDA 3UIFA 2Q89A 3C4MA 1URSA 3D4CA 4M1VA 1S7YA 2ABHA 4RPNA 4XKRA 1LFHA 2O68A 1N84A 2ONRA 1LAFE 4FECA 5IKBA 3RTWB 1JW1A 2QS1A 3A3CA 1B2HA 3E13X 2I58A 4N07A 4Z7EA 3CSGA 4I8CA 2FA7A 4YB6A 4RK2A 2ZYOA 3HSTA 1N7WA 2Y7WA 3O6IA 3IO6A 5KZTA 2VD3A 4UACA 4QFLA 1EH3A 1B40A 3KSXA 4EQ9A 2I3VA 3PPRA 3V5AA 1N3WA 2H5YA 1YPNA 2ZYMA 4OYVA 3GZGA 1AIVA 1H45A 5CMKA 1WODA 3G3GA 4IO5A 2V93A 3KEIA 2XD2A 1P1OA 2Y7RA 3LR1A 4BLAA 1OQHA 1O63A 2ZNTA 2F34A 1N76A 4AB6A 2UVIA 3PUVE 2GRVA 2F6PA 4C0RA 5I2KA 4NF4A 2XXRA 1RYOA 1OVTA 3BBRA 1NMUA 1JEUA 4ECFA 1VFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7X A;  2YPN A;  5H8H B;  5ICT A;  1MG1 A;  4WXJ A;  4FAT A;  2IA4 A;  1ZJL A;  2DQV A;  4O3B A;  1CE2 A;  1D9V A;  4IGT A;  2HXW A;  3LSF B;  2XXH A;  3WAE A;  3KN7 A;  3R26 A;  1MY4 A;  3U1O A;  4LZ5 A;  1TFA A;  3S9E A;  1JET A;  3KJ7 A;  4TLM B;  3TQL A;  3ZKK A;  1B5I A;  4JBZ A;  3CIJ A;  2F7A A;  5H8F B;  2R6G E;  4F19 A;  3H6V A;  3OO9 A;  4EF2 A;  3D4G A;  3K6W A;  1Y3N A;  3O2A A;  3V83 A;  3FJM A;  5FHN A;  5ISU A;  3ZS6 A;  4DLD A;  3IR1 A;  2OZZ A;  4BDO A;  1M5B A;  3MAM A;  5AA4 A;  1O64 A;  3IX1 A;  4DXC A;  1B52 A;  1CB6 A;  4LP2 B;  1M5C A;  1MQJ A;  1LAX A;  1B1X A;  1A8F A;  4PFY A;  1B46 A;  3N5L A;  5JK4 A;  3IOV A;  3VV5 A;  2G93 A;  1ELJ A;  4ZEK A;  4NF5 B;  3VXC A;  3MC2 A;  3C9H A;  4F1U A;  1ANF A;  3MVZ A;  2RC7 A;  2F97 A;  4LQ5 A;  2VHA A;  1P1W A;  2GH9 A;  1QUK A;  4F18 A;  2P2A A;  3KZG A;  4H6D A;  4RXL A;  4G4P A;  1A55 A;  5J1D A;  4RNS A;  3G3K A;  2CZL A;  1HSJ A;  1I6A A;  3PUW E;  3T9V A;  1XT8 A;  5CBS A;  3RLF E;  4H65 A;  2ZXT A;  1VR5 A;  4IO3 A;  1UQW A;  4X48 A;  4GWO A;  2Q8J A;  4KCC A;  5CI5 A;  4XIG Q;  4DE8 A;  4ISU A;  1I6B A;  4G8H A;  1SW2 A;  1A99 A;  1MQI A;  3MVX A;  3S9N C;  1ZKB A;  1IUD A;  3UA8 A;  4R9F A;  3TEL A;  3QUJ A;  1MY1 A;  1B9J A;  3QAX A;  3QSL A;  2HAV A;  3FVN A;  4OTE A;  2P0S A;  1P1Q A;  3KG2 A;  5HBC A;  1FTM A;  5AA3 A;  4IO6 A;  3FVG A;  5LOM A;  2OWT A;  1B58 A;  3UP9 A;  3SKP A;  1IXC A;  1H44 A;  3K1N A;  1BKA A;  1MPC A;  4OES A;  4F22 A;  5AE4 A;  4E0W A;  4N6P A;  3TCG A;  5A5X A;  3N94 A;  1DPE A;  4KPT A;  3B7D A;  4ZZE A;  1ZLQ A;  4HCY A;  1B5J A;  4FE8 A;  2OK2 A;  4YB5 A;  2VOZ A;  1IEJ A;  5BWJ A;  2PMS A;  4O3C A;  1PEB A;  3B6Q A;  3B6W A;  1I69 A;  1IXH A;  1P1N A;  3SET A;  2ZYN A;  4YB7 A;  4GL8 A;  1SDX A;  4MFI A;  4MLQ A;  2AYS A;  2RCB A;  4ZED A;  3EF7 A;  2HZL A;  4R9G A;  4F2Q A;  5TP9 A;  1TWY A;  2B3F A;  1MY2 A;  5HPQ A;  4GXA A;  1I6Q A;  3QUF A;  1BP5 A;  4YU0 A;  1URD A;  3TUS A;  1R1N A;  3BFT A;  5DT6 A;  3DM0 A;  2H98 A;  1MDQ A;  3KOS A;  2DSF A;  3Q25 A;  3G3I A;  1NH8 A;  3MZB A;  4F3B A;  4MF3 A;  3TKD A;  1IZ1 A;  1LAG E;  3OSQ A;  4DDD A;  2UYE A;  4IO2 A;  1LFG A;  3OOA A;  3P7I A;  4ZZA A;  3HHF A;  1SW1 A;  4BDL A;  4JXI A;  5FHM A;  2NXO A;  3TTM A;  2B3B A;  4G68 B;  1PBQ A;  5L9O A;  2PYY A;  5I58 A;  1B5H A;  5F7V A;  1MH4 A;  4QF9 A;  1PC3 A;  3I6V A;  4I1D A;  1IIW A;  4F2O A;  4F31 B;  4NF6 B;  3EHS A;  3LBS A;  1LBB A;  3TZA A;  1AH5 A;  1L5T A;  3C33 A;  4JDF A;  3M3L A;  3LSL A;  1UIU A;  5TPA A;  3MPK A;  1HSL A;  5I2N A;  1B3E A;  3K6V A;  3KN3 A;  2H99 A;  4JWO A;  4OEV A;  1TXF A;  2OCU A;  2XD3 A;  2X7P A;  3MBP A;  3EHU A;  1AOV A;  2DVC A;  4KYS A;  1QUJ A;  4YZZ A;  1OLA A;  4ZDM A;  4NF8 B;  3U93 A;  2DWI A;  3KSJ A;  2Z8E A;  1FCK A;  5ITP A;  3SDF A;  1IXG A;  4OEU A;  1JVX A;  3V89 B;  1J1N A;  1Q1K A;  3TCH A;  4QSC A;  1P99 A;  3KFM A;  4HCW A;  3WAF A;  2XXX A;  3C36 A;  1ATG A;  3G3J A;  1GGG A;  2I6E A;  5H8H A;  4OVJ A;  3IB2 A;  4ZS9 A;  3IB0 A;  3Q27 A;  3PMX A;  5IAI A;  3QXM A;  1D3K A;  3RTF B;  2QJE A;  1MS7 A;  5I58 B;  2VP1 A;  1A8E A;  4IY6 A;  3K01 A;  4X1B A;  5I57 B;  1Y3Q A;  4MBP A;  3AXF A;  1B32 A;  3RPW A;  4R6H A;  3SES A;  3MQ9 A;  4GFR A;  4E0X A;  1PB9 A;  3H6T A;  5FTH A;  1EZ9 A;  5H8F A;  2REJ A;  4H67 A;  3K1P A;  3T93 B;  1GVC A;  3K6X A;  5TPA B;  4GQO A;  2YLN A;  3PPO A;  5I2N B;  1QUI A;  4OHN A;  2XXW A;  3VXB A;  3U8Q A;  4RK9 A;  3RN8 A;  2Z8D A;  2R71 A;  3G7W A;  5H8N B;  2RF1 A;  4R6K A;  4FAJ A;  2UVG A;  2AL4 A;  5JEI A;  2O51 A;  5B70 A;  3O6G A;  1B7H A;  5CBR A;  3L6G A;  4NF5 A;  4OWD A;  1Y9U A;  2XXT A;  1MM6 A;  3IAZ A;  5AA2 B;  3RQT A;  2HZK A;  1Q35 A;  1FQD A;  3ZKL A;  3OEK A;  2Q2C A;  1USY H;  3MWB A;  5KDT B;  4KFQ A;  5I84 A;  3CG1 A;  4KCD A;  3RT6 B;  3IL1 B;  1FQF A;  5HM4 B;  3A3U A;  1NNP A;  1MQH A;  2F7C A;  1SI1 A;  4I9D A;  1T0K A;  1QKB A;  2ANJ A;  4MLV A;  4G8M A;  4JSO A;  4TLL B;  4BDR A;  4ELO A;  2F8D A;  4WKM A;  3N6T A;  4ESW A;  3TCF A;  4EUO A;  3EN3 A;  4ELQ A;  4IO4 A;  2NOO A;  5EHM A;  4ZE9 A;  4IGR A;  4U21 A;  3IOT A;  3TOD A;  4G77 A;  1Z7M E;  3PD8 A;  2GHB A;  1PB7 A;  2Q9T A;  3TFL A;  4TQU Q;  1OMP A;  3CVG A;  3G3F A;  3S9M C;  1PBP A;  3TQW A;  1FTO A;  2NWJ A;  1B3F A;  4DIG A;  1ZMG A;  3IB1 A;  2UYF A;  4LUB A;  1XVX A;  2BJJ X;  4AQ4 A;  1SYI A;  3RT8 A;  4RYA A;  2QPQ A;  3U92 A;  2O84 X;  3PUY E;  3VE1 B;  1SBP A;  4U1O A;  2I4C A;  4GD5 A;  3SEU A;  4NE4 A;  4YKP A;  3PV0 E;  1FQE A;  3I3V A;  1Z7N E;  3CFX A;  1IIT A;  1DSN A;  4POW A;  3MVY A;  1A54 A;  2PX1 A;  1ZIU A;  2ZYK A;  1Y3P A;  5CC2 A;  2O7U A;  1MXW A;  4YKJ A;  5DYH A;  2UXA A;  3TTK A;  1BLF A;  3ONM A;  3K2D A;  1TT1 A;  3E9X A;  4X9T A;  1EZP A;  4UA8 A;  2I49 A;  3VDF A;  3ILU B;  3MVW A;  3M3K A;  1US4 A;  4JB7 A;  4X1D A;  4FEB A;  3V8X B;  2G29 A;  1B0L A;  4GVO A;  1LST A;  5L9S A;  1OIB A;  1H76 A;  5AA1 A;  2NUV A;  3DEL B;  1N04 A;  1KWH A;  5L8D A;  3EPE A;  4G68 A;  2OLB A;  3FXQ A;  1MXV A;  1DTZ A;  2HCA A;  5TU0 A;  3JYR A;  2XXQ A;  3HN0 A;  3FVK A;  2XXP A;  2XXY A;  2DOJ A;  2AIX A;  1NNK A;  2O1L A;  4F3P A;  3FD3 A;  1B3H A;  4XXU A;  1Y4T A;  2QS3 A;  3HPI A;  3MP1 A;  3THI A;  4NF6 A;  4OEN A;  3CFL A;  3PMV A;  1LB8 A;  5I56 B;  4GL0 A;  2OBG A;  3Q26 A;  3Q28 A;  4XKQ A;  4PFU A;  3ODB A;  3GXA A;  4DXB A;  3CG3 A;  2DE3 A;  3IK6 B;  3UK4 A;  2CMO A;  1JW4 A;  2Y7I A;  2ONS A;  3SEX A;  4EF1 A;  1AL3 A;  5M2V A;  1FW0 A;  1RKM A;  2O7I A;  4EXL A;  5ICQ A;  3H6W A;  1SW5 A;  1WDN A;  2IEE A;  3MJN A;  4H8J A;  3KJT A;  1FTK A;  4XTC Q;  1B51 A;  4OER A;  1GTK A;  3ECR A;  4F3S A;  4R75 A;  3FV1 A;  1XC1 A;  3O6H A;  4R74 A;  1B3G A;  3MUQ A;  4WED A;  4H5G A;  4KQP A;  4QFO A;  5KCJ B;  4U4S A;  4NF8 A;  4IB2 A;  1YAE A;  3GBB A;  3ILT B;  1BIY A;  2X26 A;  1LGB C;  4MH5 A;  3VFJ A;  2QS2 A;  4EDP A;  4R6Y A;  2PT2 A;  1WVJ A;  1R9Q A;  1TFD A;  2H25 A;  4BDM A;  4LA9 A;  5H8Q B;  5JTY A;  2Z8F A;  5DEX B;  2I4B A;  4Q0C A;  1MXZ A;  3H3G A;  2D21 A;  3F11 A;  3IO4 A;  1LCF A;  3CSB A;  2FNC A;  3IOU A;  3PUZ E;  4EQB A;  2ZNS A;  4BDN A;  3T9U A;  1JNF A;  3O97 A;  1HSE A;  2DYX A;  3BKI B;  2XXV A;  2GHA A;  2V3U A;  1R9L A;  4POX A;  4U4X A;  1BTJ A;  2LAO A;  1ZU0 A;  5L9M A;  1FTJ A;  4FIM A;  4RA1 A;  4OFO A;  5CMM A;  2XX9 A;  5I57 A;  1D9Y A;  3DLN A;  1H43 A;  3TEP A;  3I5O A;  3MP8 A;  3SEY A;  2F6G A;  1S50 A;  4GOT A;  4QFK A;  1USY E;  1NKX A;  4HW8 A;  3TYH A;  4LQ2 A;  4OXV A;  2W7Y A;  2ONK E;  3EHT A;  2O1M A;  3LSW A;  1URG A;  4KR5 A;  1N0T A;  3T9H B;  1B4Z A;  4U23 A;  2REG A;  1QUL A;  3SEV A;  2DVZ A;  2RIN A;  2RCA A;  1B05 A;  2E0S A;  3H6U A;  5H8N A;  5FTI A;  1MPD A;  4ZEI A;  3C34 A;  3FAS A;  4H5F A;  1LCT A;  3OEM A;  2P1S A;  1R6Z A;  4RJZ A;  4XKP A;  3CRB A;  4AB5 A;  4ESX A;  3GBA A;  4TOZ A;  1GV8 A;  4NMY A;  3GLB A;  4RPO A;  1GR2 A;  4H1X A;  5AA2 A;  5JTY B;  4PFW A;  3OMB A;  1P1U A;  4PET A;  2PVU A;  5KDT A;  4PQJ A;  1Y1Z A;  2QSX A;  3LUY A;  4R2B A;  3MPL A;  3CI8 A;  4Q8R A;  3FIR A;  3C35 A;  3KBR A;  4LVQ A;  1YCJ A;  2V3Q A;  4KI0 E;  2DS9 A;  3QK6 A;  4PFT A;  1SI0 A;  3MP6 A;  3PD9 A;  1MPB A;  2A5T B;  4OQO A;  4QSE A;  2OJT A;  4R2F A;  1MH3 A;  2B65 A;  1MQG A;  3G3H A;  4GLI A;  1JW5 A;  5DVI A;  3OO7 A;  4P0I A;  2V84 A;  5CMC A;  5ITO A;  3UOR A;  4YKI A;  5DTB A;  4ZEB A;  1A40 A;  2RC9 A;  2XX7 A;  1N7X A;  1SQY A;  3M8U A;  4U22 A;  5K2Y A;  4O3A A;  1XOC A;  4F3G A;  4I62 A;  3TDJ A;  2Q2A A;  2DWJ A;  3T66 A;  5K2X A;  4QHQ A;  1SVX B;  3N26 A;  1LAH E;  1SD3 A;  3IOW A;  2HQ0 A;  3DP6 A;  3S2V A;  1RYX A;  4GXS B;  3LC8 A;  4YIC A;  3ZSF A;  2F36 A;  2ESN A;  1H3D A;  4OMB A;  1OQG A;  4K3F A;  2UVJ A;  2D3I A;  2YJP A;  3H4Z A;  4GF8 A;  1SYH A;  4BDQ A;  2F5X A;  3FJG A;  3Q29 A;  1YTV A;  2DWH A;  1ZTY A;  2F35 A;  2PT1 A;  4RY1 A;  4F29 A;  3RNN A;  1POT A;  3IJO B;  1MXU A;  3VLW A;  1PB8 A;  3C32 A;  1Y1M A;  1QW0 A;  3BFU A;  5F1Q A;  3KN8 A;  1XVY A;  4NTL A;  4XKN A;  5B7D A;  4OZ9 A;  2PBW A;  1VE4 A;  1DPP A;  3K02 A;  3RGY A;  4IY5 A;  2ZNU A;  2DE4 A;  1DTG A;  1B6H A;  1MY0 A;  3O9P A;  4ND9 A;  2A5S A;  1NH7 A;  5EYF A;  4G2Z A;  2O69 A;  1M5F A;  2E1S A;  1OVB A;  2Y84 A;  3MZ1 A;  4Z0I A;  2F7B A;  4JWX A;  4LAT A;  4QFN A;  5I56 A;  4U1Z A;  2DWA A;  1FQB A;  4FOR A;  4N13 A;  1B4H A;  3HHG A;  3QIM A;  4C1T A;  1EZO A;  4U2R A;  3CFZ A;  4GIZ A;  4G68 C;  3PGF A;  3U94 A;  2DXR A;  4PP0 A;  1NNF A;  4ZE8 A;  1XHY A;  2Z22 A;  3HCQ A;  2QS4 A;  4F1V A;  1II5 A;  3W9W A;  4Q30 B;  3KOT A;  3E4R A;  5DVJ A;  4LZ8 A;  3PMW A;  4P11 A;  3FAT A;  3FJ7 A;  4YAH X;  3PU5 A;  4R73 A;  2Z23 A;  2I3W A;  3FXR A;  5KCJ A;  4ZEF A;  4NWC A;  1FQA A;  3JZJ A;  1POY 1;  2I0C A;  4IO7 A;  2OWS A;  4ZEC A;  2VGQ A;  1UIV A;  5H8Q A;  4WEP A;  1JEV A;  2Q88 A;  4P0G A;  5DEX A;  3OO6 A;  1UTB A;  4LZ7 A;  1VSO A;  4FED A;  3PPP A;  4HTG A;  1PDA A;  4ONY A;  3S4U A;  5I2K B;  3VVE A;  4OFL A;  4NF4 B;  3T9X B;  4JWY A;  3MW0 A;  3SEW A;  1MY3 A;  1QVS A;  1NFT A;  1FQC A;  2FYI A;  3LSX A;  3PPN A;  2VD2 A;  3OD7 A;  1D4N A;  3FVO A;  3R6U A;  2D5W A;  3FZV A;  3K6U A;  3H7M A;  1O7T A;  2DP8 A;  3HO7 A;  3K0V A;  1EU8 A;  5I59 A;  4JSD A;  4GRK A;  3UN6 A;  4NED A;  2QL3 A;  2I48 A;  2HFB A;  3T22 A;  1FTL A;  1B1H A;  4H8I A;  4ELP A;  3CR9 A;  4KD5 A;  1OLC A;  1M5D A;  3O66 A;  5BUU A;  5AA4 B;  4EXK A;  3FV2 A;  2KLF A;  2DE2 A;  3DP4 A;  4YKK A;  4ELR A;  3IJX B;  2WKY A;  2XX8 A;  3TAJ A;  1JQF A;  1B3L A;  2RC8 A;  2Y7P A;  3RUM A;  1MRP A;  2RKM A;  5FHO A;  4OET A;  1LBC A;  1MDP 1;  5DVF A;  1QKA A;  3OSR A;  3USD A;  1B0H A;  1IQ7 A;  4R72 A;  3UGW A;  3H03 A;  5ELV A;  2DXY A;  1UTB B;  1JVY A;  1LLS A;  1MM7 A;  1NNT A;  3FGS A;  2QMW A;  3K4U A;  2GFE A;  5CRY A;  5EHS A;  3VLV A;  5H8S A;  1UTH A;  2O6A A;  3L6H A;  2XXU A;  2HAU A;  4DZ1 A;  1MXX A;  1XS5 A;  4L17 A;  4F39 A;  2X7Q A;  1Y4C A;  2A5T A;  3TMG A;  4F1Y A;  4LON B;  3VLU A;  1IXI A;  1ZBM A;  3FUZ A;  1S9T A;  3PPQ A;  1A7L A;  2V3T A;  3TTN A;  4NWD A;  3C31 A;  3VVF A;  4DXU A;  1B7U A;  5CM6 A;  2ALU A;  4KYD A;  3T96 B;  2I0B A;  4HS7 A;  3JV9 A;  5I59 B;  3TTL A;  3MZ9 A;  2Y7K A;  3E3K A;  3M3F A;  1N3X A;  4M4G A;  1MQD A;  4H0W A;  3KGC A;  3W9V A;  3EQ1 A;  2ZMB A;  2THI A;  3DP8 A;  3N6U A;  3IOR A;  4QRZ A;  3OEL A;  3U72 A;  3O29 A;  1DOT A;  1SW4 A;  3B6T A;  3H06 B;  4EQ7 A;  3K1M A;  3RY3 A;  1M5E A;  3SER A;  4Q5T A;  4G8N A;  1LB9 A;  3S9L C;  5A5X B;  5AA2 D;  4DCY A;  1DMB A;  4C1U A;  3W15 C;  1LFI A;  2XXI A;  3TTR A;  2V25 A;  3O28 A;  2AL5 A;  4KYE A;  2UVH A;  4OFJ A;  4YMA A;  2H9B A;  4FJP A;  1US5 A;  1Y20 A;  4QFP A;  3OXN A;  4QSD A;  4KHZ E;  2QMX A;  4THI A;  5TP9 B;  3PUX E;  2NVU B;  3HV1 A;  3A09 A;  2F78 A;  1QJM A;  2H4I A;  1VFE A;  1UTH B;  2R9J A;  2HEU A;  1NL5 A;  1F9B A;  4DCX A;  5CMB A;  1MXY A;  3FXU A;  3K00 A;  3OO8 A;  2QRY A;  3OEN A;  1B7Z A;  3VVD A;  4PE5 B;  1AMF A;  3QYT A;  3TPA A;  4YMB A;  2M8C A;  2XHD A;  3UIF A;  2Q89 A;  3C4M A;  1URS A;  3D4C A;  4M1V A;  1S7Y A;  2ABH A;  4RPN A;  4XKR A;  1LFH A;  2O68 A;  1N84 A;  2ONR A;  1LAF E;  4FEC A;  5IKB A;  3RTW B;  1JW1 A;  2QS1 A;  3A3C A;  1B2H A;  3E13 X;  2I58 A;  4N07 A;  4Z7E A;  3CSG A;  4I8C A;  2FA7 A;  4YB6 A;  4RK2 A;  2ZYO A;  3HST A;  1N7W A;  2Y7W A;  3O6I A;  3IO6 A;  5KZT A;  2VD3 A;  4UAC A;  4QFL A;  1EH3 A;  1B40 A;  3KSX A;  4EQ9 A;  2I3V A;  3PPR A;  3V5A A;  1N3W A;  2H5Y A;  1YPN A;  2ZYM A;  4OYV A;  3GZG A;  1AIV A;  1H45 A;  5CMK A;  1WOD A;  3G3G A;  4IO5 A;  2V93 A;  3KEI A;  2XD2 A;  1P1O A;  2Y7R A;  3LR1 A;  4BLA A;  1OQH A;  1O63 A;  2ZNT A;  2F34 A;  1N76 A;  4AB6 A;  2UVI A;  3PUV E;  2GRV A;  2F6P A;  4C0R A;  5I2K A;  4NF4 A;  2XXR A;  1RYO A;  1OVT A;  3BBR A;  1NMU A;  1JEU A;  4ECF A;  1VFD A; 
#chains in the Genus database with same CATH topology
 3KBZ A;  3R7X A;  2YPN A;  5H8H B;  5ICT A;  1MG1 A;  4WXJ A;  4FAT A;  5EQA A;  2IA4 A;  1ZJL A;  2DQV A;  1FBD A;  1LBV A;  4O3B A;  1CE2 A;  1D9V A;  1FBC A;  4IGT A;  2HXW A;  3LSF B;  2XXH A;  1FSA A;  1NI9 A;  3WAE A;  3KN7 A;  3R26 A;  1MY4 A;  3U1O A;  4LZ5 A;  1TFA A;  3S9E A;  1JET A;  3KJ7 A;  4TLM B;  3TQL A;  3ZKK A;  1B5I A;  4JBZ A;  3CIJ A;  2F7A A;  5H8F B;  2R6G E;  4F19 A;  3H6V A;  3OO9 A;  4EF2 A;  1QGX A;  3D4G A;  1LBW A;  3K6W A;  1Y3N A;  3O2A A;  3V83 A;  3FJM A;  5FHN A;  5ISU A;  3ZS6 A;  4DLD A;  3IR1 A;  4N6K A;  2OZZ A;  4BDO A;  3A29 A;  4QXD A;  1FPJ A;  1M5B A;  3MAM A;  5AA4 A;  1O64 A;  4JVI A;  2QFL A;  3IX1 A;  4DXC A;  3MST A;  1B52 A;  1CB6 A;  4LP2 B;  1M5C A;  1MQJ A;  4N6D A;  1LAX A;  1FPD A;  1B1X A;  1A8F A;  4PFY A;  1B46 A;  4MMP A;  3N5L A;  1DK4 A;  5JK4 A;  3IOV A;  3VV5 A;  2G93 A;  1ELJ A;  4ZEK A;  4NF5 B;  3NOH A;  3VXC A;  3MC2 A;  1YYZ A;  3C9H A;  4F1U A;  1ANF A;  3MVZ A;  3U65 A;  2RC7 A;  2F97 A;  2WBD A;  4DI4 B;  4LQ5 A;  2VHA A;  1P1W A;  2GH9 A;  1QUK A;  4F18 A;  2P2A A;  3KZG A;  4H6D A;  4GWZ A;  4RXL A;  4G4P A;  2HHM A;  1A55 A;  5J1D A;  4RNS A;  2WBB A;  3G3K A;  1NV1 A;  2CZL A;  1HSJ A;  1I6A A;  3PUW E;  3T9V A;  1XT8 A;  1IMF A;  5CBS A;  3RLF E;  4H65 A;  2ZXT A;  1VR5 A;  4IO3 A;  1UQW A;  1FBE A;  4X48 A;  4GWO A;  2Q8J A;  4KCC A;  5CI5 A;  4XIG Q;  4DE8 A;  4ISU A;  1I6B A;  4G8H A;  1SW2 A;  1A99 A;  1MQI A;  3MVX A;  3S9N C;  1ZKB A;  1IUD A;  3UA8 A;  4R9F A;  4PFI A;  3TEL A;  3QUJ A;  1MY1 A;  4GBW A;  1B9J A;  3QAX A;  3QSL A;  2HAV A;  2Y5K A;  3FVN A;  4OTE A;  2P0S A;  1P1Q A;  3KG2 A;  5HBC A;  1FTM A;  2R8T A;  5AA3 A;  1LBX A;  4IO6 A;  3FVG A;  5LOM A;  2OWT A;  1B58 A;  3UP9 A;  2P3N A;  3SKP A;  1IXC A;  1H44 A;  1INP A;  3K1N A;  1BKA A;  2FIE A;  1MPC A;  4OES A;  4F22 A;  5AE4 A;  1SPI A;  4E0W A;  2HPG A;  4N6P A;  4FBP A;  3TCG A;  5A5X A;  3N94 A;  1DPE A;  4KPT A;  3B7D A;  4ZZE A;  1ZLQ A;  4HCY A;  1B5J A;  4FE8 A;  4GX6 A;  2OK2 A;  4YB5 A;  2VOZ A;  1IEJ A;  5BWJ A;  2PMS A;  4XEQ A;  4O3C A;  1K9Y A;  4NX1 A;  1PEB A;  3B6Q A;  2WYK A;  3B6W A;  1FBP A;  1IXH A;  1I69 A;  1P1N A;  3SET A;  1CNQ A;  4MHF A;  2ZYN A;  4YB7 A;  4GL8 A;  1SDX A;  4MFI A;  4MLQ A;  2AYS A;  2RCB A;  4ZED A;  3EF7 A;  2HZL A;  4R9G A;  4F2Q A;  5TP9 A;  1TWY A;  2B3F A;  1MY2 A;  5HPQ A;  4GXA A;  1I6Q A;  3QUF A;  1BP5 A;  4YU0 A;  1URD A;  3TUS A;  1R1N A;  3BFT A;  5DT6 A;  3DM0 A;  2H98 A;  1MDQ A;  3KOS A;  2DSF A;  4KXP A;  3Q25 A;  3G3I A;  1NH8 A;  3MZB A;  4F3B A;  4MF3 A;  3TKD A;  1IZ1 A;  5A5L A;  1FPK A;  1LAG E;  3OSQ A;  4DDD A;  2UYE A;  4IO2 A;  1LFG A;  3OOA A;  3P7I A;  4ZZA A;  3HHF A;  1SW1 A;  4BDL A;  4JXI A;  5FHM A;  5IGA A;  2NXO A;  2PCR A;  3TTM A;  2B3B A;  4G68 B;  1PBQ A;  2BJI A;  5L9O A;  2XXK A;  2PYY A;  5I58 A;  1B5H A;  4LN5 A;  5F7V A;  3HFU A;  1MH4 A;  4QF9 A;  1PC3 A;  3I6V A;  4I1D A;  1IIW A;  4F2O A;  2DDK A;  4F31 B;  4NG7 A;  4NF6 B;  3EHS A;  3LBS A;  1LBB A;  3TZA A;  1AH5 A;  4PGP A;  1L5T A;  4MNP A;  3C33 A;  4JDF A;  3M3L A;  3LSL A;  1UIU A;  5TPA A;  3MPK A;  1HSL A;  5I2N A;  1B3E A;  3K6V A;  3KN3 A;  2H99 A;  4JWO A;  2ZZV A;  4OEV A;  1TXF A;  4P3L A;  2OCU A;  2XD3 A;  2X7P A;  3MBP A;  4MAG A;  3T1B A;  3EHU A;  1AOV A;  2DVC A;  3E79 A;  4KYS A;  1QUJ A;  4YZZ A;  1OLA A;  5ET8 A;  4ZDM A;  4NF8 B;  3U93 A;  2DWI A;  3KSJ A;  2Z8E A;  4AS5 A;  1RDX A;  1G0I A;  1FCK A;  5ITP A;  3SDF A;  1FBH A;  1IXG A;  4OEU A;  1JVX A;  3V89 B;  1J1N A;  1FJ6 A;  1Q1K A;  3TCH A;  4QSC A;  1P99 A;  3KFM A;  4HCW A;  3WAF A;  2XXX A;  2CEY A;  3C36 A;  1ATG A;  1NV2 A;  3G3J A;  2B4M A;  1GGG A;  2I6E A;  4HE2 A;  5H8H A;  4OVJ A;  4UAB A;  3IB2 A;  4ZS9 A;  3IB0 A;  3Q27 A;  3PMX A;  5IAI A;  3QXM A;  1D3K A;  3RTF B;  2QJE A;  1MS7 A;  5I58 B;  2CZK A;  2VP1 A;  1A8E A;  4IY6 A;  3K01 A;  4X1B A;  4H46 A;  5I57 B;  1Y3Q A;  4MBP A;  3AXF A;  1B32 A;  3RPW A;  5LTC A;  4R6H A;  3D1R A;  3SES A;  5EQ8 A;  4PDH A;  3MQ9 A;  4GFR A;  5I3S A;  4E0X A;  1PB9 A;  3H6T A;  1XI6 A;  5FTH A;  1EZ9 A;  5H8F A;  2REJ A;  4H67 A;  3K1P A;  3T93 B;  1GVC A;  3K6X A;  5TPA B;  3GYY A;  4GQO A;  2YLN A;  3PPO A;  5I2N B;  1QUI A;  4OHN A;  4MIJ A;  2XXW A;  3VXB A;  3U8Q A;  4RK9 A;  3RN8 A;  2Z8D A;  2R71 A;  3G7W A;  3QMF A;  5H8N B;  2RF1 A;  3RYD A;  2Y5L A;  4R6K A;  4FAJ A;  2UVG A;  2AL4 A;  1FPE A;  4OVT A;  5JEI A;  1DCU A;  2O51 A;  5B70 A;  3O6G A;  2CEX A;  1B7H A;  5CBR A;  1K9Z A;  3L6G A;  4NF5 A;  4OWD A;  1Y9U A;  2XXT A;  1MM6 A;  3IAZ A;  4QBA A;  5EQ9 A;  5AA2 B;  4GBV A;  3RQT A;  2HZK A;  1Q35 A;  1FQD A;  3ZKL A;  3LUZ A;  3OEK A;  2Q2C A;  1USY H;  3MWB A;  4GWY A;  5KDT B;  4KFQ A;  5I84 A;  1D9Q A;  3CG1 A;  4KCD A;  3RT6 B;  3IL1 B;  1FQF A;  3RPL B;  5HM4 B;  3A3U A;  1NNP A;  1MQH A;  2F7C A;  1SI1 A;  4I9D A;  2CZI A;  1T0K A;  1QKB A;  2ANJ A;  4MLV A;  4G8M A;  4JSO A;  4TLL B;  1Q9D A;  2Q74 A;  4GX4 A;  4HXV A;  1VDW A;  4BDR A;  4ELO A;  1YXI A;  3SZP A;  2F8D A;  4WKM A;  3N6T A;  4ESW A;  3TCF A;  4EUO A;  2ZZW A;  3EN3 A;  4PBH A;  4ELQ A;  4IO4 A;  2NOO A;  5EHM A;  4ZE9 A;  1KA1 A;  4IGR A;  4U21 A;  5ET7 A;  3IOT A;  3TOD A;  4G77 A;  5ET6 A;  1Z7M E;  3PD8 A;  2GHB A;  1PB7 A;  2XA5 A;  2Q9T A;  3TFL A;  5F24 A;  4TQU Q;  1FPI A;  4OVR A;  1OMP A;  4MNC A;  3CVG A;  3G3F A;  3S9M C;  3BIH A;  1PBP A;  3TQW A;  1FTO A;  2NWJ A;  1B3F A;  4DIG A;  2XWI A;  1ZMG A;  3IB1 A;  2UYF A;  4LUB A;  1XVX A;  2BJJ X;  2ZZX A;  4AQ4 A;  1SYI A;  3RT8 A;  4RYA A;  2QPQ A;  3U92 A;  2O84 X;  3PUY E;  3VE1 B;  4IR8 A;  1SBP A;  4U1O A;  1NV5 A;  2I4C A;  4I3E A;  4GD5 A;  3SEU A;  3BIG A;  4NE4 A;  4YKP A;  2OX3 A;  3PV0 E;  1FQE A;  3I3V A;  1Z7N E;  3CFX A;  1IIT A;  1DSN A;  4POW A;  3MVY A;  4NAP A;  1RDY A;  1A54 A;  4PCD A;  2PX1 A;  1ZIU A;  2ZYK A;  3ISP A;  1Y3P A;  5CC2 A;  2O7U A;  1MXW A;  4YKJ A;  5IZ3 A;  5DYH A;  2UXA A;  3TTK A;  1BLF A;  3ONM A;  3K2D A;  1TT1 A;  3E9X A;  4X9T A;  1EZP A;  4UA8 A;  4PTK A;  2I49 A;  2HXR A;  3VDF A;  2QVR A;  4P9K A;  3ILU B;  3MVW A;  3M3K A;  1US4 A;  4JB7 A;  4X1D A;  4FEB A;  3V8X B;  2G29 A;  1B0L A;  4GVO A;  1LST A;  5L9S A;  1NV4 A;  1LBY A;  1OIB A;  2FBP A;  1H76 A;  5AA1 A;  2NUV A;  3DEL B;  4PF6 A;  1N04 A;  1KWH A;  5L8D A;  2KQZ A;  3EPE A;  4G68 A;  2OLB A;  3FXQ A;  1MXV A;  1DTZ A;  2HCA A;  5TU0 A;  3JYR A;  2XXQ A;  3HN0 A;  3FVK A;  2XXP A;  2XXY A;  4H45 A;  2DOJ A;  2AIX A;  1NNK A;  2O1L A;  4F3P A;  3FD3 A;  1B3H A;  4XXU A;  1Y4T A;  2QS3 A;  3HPI A;  3MP1 A;  3THI A;  4NF6 A;  4OEN A;  3CFL A;  3PMV A;  4GWW A;  1LB8 A;  5I56 B;  4GL0 A;  1KZ8 A;  2OBG A;  4PAK A;  3Q26 A;  3Q28 A;  4XKQ A;  4PFU A;  3ODB A;  3GXA A;  4OVP A;  2CZH A;  4DXB A;  4X8R A;  4NQ8 A;  3CG3 A;  2DE3 A;  3IK6 B;  3UK4 A;  2CMO A;  1JW4 A;  2Y7I A;  2ONS A;  3SEX A;  4EF1 A;  1AL3 A;  5M2V A;  1FW0 A;  1RKM A;  2O7I A;  4EXL A;  5ICQ A;  3H6W A;  1SW5 A;  4AS4 A;  1WDN A;  2IEE A;  3MJN A;  4H8J A;  4PBQ A;  3KJT A;  1FTK A;  4OA4 A;  4XTC Q;  4PFB A;  1B51 A;  4OER A;  1GTK A;  3ECR A;  4F3S A;  4R75 A;  3FV1 A;  1XC1 A;  4O8M A;  3O6H A;  4R74 A;  4N8G A;  1KA0 A;  1B3G A;  3MUQ A;  4WED A;  4H5G A;  4KQP A;  4QFO A;  5KCJ B;  4U4S A;  4O7I A;  4NF8 A;  4IB2 A;  1YAE A;  3GBB A;  3ILT B;  1BIY A;  2X26 A;  1LGB C;  4MH5 A;  3VFJ A;  2QS2 A;  1IMA A;  4EDP A;  3IFC A;  4R6Y A;  4NGU A;  2PT2 A;  5IZ3 B;  1WVJ A;  1R9Q A;  1TFD A;  2H25 A;  4BDM A;  1FPL A;  4LA9 A;  5H8Q B;  5JTY A;  2Z8F A;  5IM2 A;  5DEX B;  2I4B A;  4Q0C A;  1MXZ A;  3H3G A;  2D21 A;  3F11 A;  4XF5 A;  3IO4 A;  1LCF A;  3CSB A;  4MCO A;  2FNC A;  3IOU A;  3PUZ E;  4EQB A;  2ZNS A;  4BDN A;  3T9U A;  1JNF A;  3O97 A;  1HSE A;  2DYX A;  3BKI B;  2XXV A;  2GHA A;  5I7I A;  2V3U A;  1R9L A;  4POX A;  4U4X A;  1BTJ A;  2LAO A;  1ZU0 A;  3FXB A;  5L9M A;  1FTJ A;  4FIM A;  4RA1 A;  4OFO A;  5CMM A;  2WX9 A;  2XX9 A;  5I57 A;  1D9Y A;  3DLN A;  1H43 A;  3TEP A;  2VT5 A;  3I5O A;  5IZ1 A;  3MP8 A;  3SEY A;  2F6G A;  1S50 A;  4GOT A;  4QFK A;  1USY E;  3ROJ A;  1NKX A;  4HW8 A;  3TYH A;  5LDZ A;  4LQ2 A;  4OXV A;  4PC9 A;  4HE1 A;  2W7Y A;  2WEF A;  2ONK E;  3EHT A;  2O1M A;  3LSW A;  1URG A;  4GX3 A;  4KR5 A;  1N0T A;  3T9H B;  1B4Z A;  4U23 A;  2REG A;  1QUL A;  3SEV A;  2V4C A;  2DVZ A;  2RIN A;  2RCA A;  1B05 A;  2E0S A;  3H6U A;  5H8N A;  5FTI A;  1MPD A;  4ZEI A;  3C34 A;  3FAS A;  4H5F A;  1LCT A;  3OEM A;  2P1S A;  4P47 A;  1NUZ A;  1R6Z A;  4RJZ A;  4XKP A;  1DBZ A;  2F3B A;  3CRB A;  4DI3 D;  4AB5 A;  4ESX A;  3GBA A;  4TOZ A;  1GV8 A;  4NMY A;  1NUW A;  3GLB A;  4RPO A;  1GR2 A;  4H1X A;  5DW8 A;  1IMB A;  5AA2 A;  5JTY B;  4PFW A;  3OMB A;  1P1U A;  4PET A;  4OVS A;  2PVU A;  5KDT A;  1AWB A;  4PQJ A;  1Y1Z A;  2QSX A;  3LUY A;  4X04 A;  3RPL A;  4R2B A;  3MPL A;  3CI8 A;  4Q8R A;  3FIR A;  3C35 A;  3KBR A;  4LVQ A;  1YCJ A;  2V3Q A;  4KI0 E;  2DS9 A;  3QK6 A;  4PFT A;  1SI0 A;  3MP6 A;  3PD9 A;  1MPB A;  2A5T B;  4OQO A;  4N8Y A;  4QSE A;  2OJT A;  4R2F A;  1YZ0 A;  1MH3 A;  5J16 A;  2B65 A;  1MQG A;  3G3H A;  4GLI A;  4NN3 A;  4N81 A;  1JW5 A;  5DVI A;  3OO7 A;  4P0I A;  2V84 A;  1NV3 A;  5CMC A;  5ITO A;  3UOR A;  1EYI A;  4YKI A;  5DTB A;  1G0H A;  4ZEB A;  1A40 A;  2RC9 A;  2XX7 A;  1RDZ A;  1N7X A;  2QVV A;  1SQY A;  3LV0 A;  3M8U A;  4U22 A;  5K2Y A;  4O3A A;  1XOC A;  4I40 A;  4F3G A;  4I62 A;  3TDJ A;  2Q2A A;  2L5V A;  4JVC A;  2DWJ A;  3T66 A;  5K2X A;  4QHQ A;  1SVX B;  3N26 A;  1LAH E;  1SD3 A;  3IOW A;  2HQ0 A;  3DP6 A;  3S2V A;  1RYX A;  2OWZ A;  4GXS B;  3LC8 A;  4YIC A;  3ZSF A;  2F36 A;  2ESN A;  1H3D A;  4OMB A;  1OQG A;  4K3F A;  2UVJ A;  2D3I A;  2YJP A;  3H4Z A;  5I5P A;  4GF8 A;  1SYH A;  4BDQ A;  4N17 A;  4GWS A;  2F5X A;  4P1E A;  3FJG A;  3Q29 A;  4MEV A;  1YTV A;  2DWH A;  1ZTY A;  4GWX A;  2F35 A;  2PT1 A;  4RY1 A;  4F29 A;  3RNN A;  1POT A;  3IJO B;  3B50 A;  1MXU A;  3VLW A;  1PB8 A;  3C32 A;  1Y1M A;  1QW0 A;  3KC0 A;  3BFU A;  5F1Q A;  3KN8 A;  1XVY A;  4NTL A;  4XKN A;  5B7D A;  4OZ9 A;  2PBW A;  1VE4 A;  1DPP A;  1NUY A;  1FJ9 A;  3K02 A;  3RGY A;  4IY5 A;  2ZNU A;  2DE4 A;  1DTG A;  1B6H A;  1MY0 A;  3O9P A;  4ND9 A;  2A5S A;  1NH7 A;  5EYF A;  4G2Z A;  2O69 A;  3CHG A;  4GWU A;  1M5F A;  2E1S A;  1OVB A;  2Y84 A;  3MZ1 A;  4Z0I A;  2F7B A;  4JWX A;  4LAT A;  4QFN A;  5I56 A;  2FHY A;  4U1Z A;  2DWA A;  4N13 A;  1FQB A;  3PTY A;  4FOR A;  1B4H A;  3HHG A;  3QIM A;  4C1T A;  1EZO A;  4U2R A;  3CFZ A;  5EYH A;  4GIZ A;  4G68 C;  3PGF A;  3U94 A;  2DXR A;  4P8B A;  1NNF A;  4PP0 A;  4ZE8 A;  1XHY A;  2Z22 A;  2FIX A;  3HCQ A;  4MJO A;  2QS4 A;  2KR0 A;  3E78 A;  4F1V A;  1II5 A;  3W9W A;  4Q30 B;  3KOT A;  3E4R A;  5DVJ A;  4LZ8 A;  3PMW A;  4P11 A;  3FAT A;  3FJ7 A;  2GQ1 A;  4YAH X;  3PU5 A;  4R73 A;  2Z23 A;  2I3W A;  1IMD A;  3FXR A;  5KCJ A;  4ZEF A;  4NWC A;  1FQA A;  3MYU A;  3JZJ A;  1POY 1;  2I0C A;  4IO7 A;  5T3J A;  2OWS A;  4P1L A;  1LBZ A;  4ZEC A;  2VGQ A;  1UIV A;  5H8Q A;  4WEP A;  1JEV A;  2Q88 A;  5ET5 A;  1JP4 A;  4P56 A;  4P0G A;  5DEX A;  3OO6 A;  1UTB A;  4LZ7 A;  1VSO A;  1NV7 A;  4FED A;  5FBP A;  3B8B A;  3PPP A;  1NUX A;  4HTG A;  4NF0 A;  1PDA A;  4ONY A;  3S4U A;  5I2K B;  3VVE A;  4OFL A;  1FRP A;  4NF4 B;  2XWK A;  3T9X B;  4PAF A;  4JWY A;  3MW0 A;  3SEW A;  1MY3 A;  1QVS A;  1NFT A;  1FQC A;  5EQ7 A;  2FYI A;  2F3D A;  3LSX A;  3PPN A;  2VD2 A;  3OD7 A;  1D4N A;  3FVO A;  3R6U A;  3T0J A;  2D5W A;  3FZV A;  4PFR A;  4PF8 A;  3K6U A;  4XFE A;  3H7M A;  1O7T A;  2DP8 A;  3HO7 A;  3K0V A;  1EU8 A;  1IMC A;  5I59 A;  4JSD A;  4GRK A;  3UN6 A;  4I3Y A;  4NED A;  2QL3 A;  2I48 A;  2HFB A;  3T22 A;  1FTL A;  1B1H A;  4H8I A;  4ELP A;  3CR9 A;  4KD5 A;  1OLC A;  1M5D A;  3O66 A;  5BUU A;  5AA4 B;  4EXK A;  3FV2 A;  2KLF A;  2DE2 A;  3DP4 A;  3FBP A;  3IFA A;  4YKK A;  4ELR A;  4HE0 A;  4N15 A;  3IJX B;  2WKY A;  2XX8 A;  1FPB A;  3TAJ A;  1JQF A;  1B3L A;  2RC8 A;  5EYG A;  4N91 A;  2Y7P A;  3RUM A;  1MRP A;  2RKM A;  2VPN A;  5FHO A;  4OET A;  3KC1 A;  1LBC A;  1MDP 1;  5DVF A;  3EKI A;  1QKA A;  3OSR A;  3USD A;  1B0H A;  1FBG A;  1IQ7 A;  4R72 A;  3UGW A;  3H03 A;  4PE3 A;  5ELV A;  2DXY A;  1UTB B;  1JVY A;  1LLS A;  1MM7 A;  1NNT A;  3FGS A;  2QMW A;  3K4U A;  1EYK A;  2GFE A;  5CRY A;  5EHS A;  3VLV A;  5H8S A;  1UTH A;  2O6A A;  1EYJ A;  3L6H A;  2XXU A;  2HAU A;  4DZ1 A;  1MXX A;  1XS5 A;  4L17 A;  4F39 A;  2X7Q A;  1Y4C A;  2A5T A;  3TMG A;  4F1Y A;  4LON B;  3VLU A;  1IXI A;  1ZBM A;  3FUZ A;  1FBF A;  1S9T A;  3PPQ A;  1A7L A;  2V3T A;  3TTN A;  4NWD A;  3C31 A;  3VVF A;  4DXU A;  1B7U A;  2B4L A;  5CM6 A;  2ALU A;  4KYD A;  4PGN A;  3T96 B;  2I0B A;  1FPF A;  4HS7 A;  3JV9 A;  5I59 B;  4NHB A;  3TTL A;  3MZ9 A;  2Y7K A;  3E3K A;  4OVQ A;  3M3F A;  1N3X A;  4M4G A;  1MQD A;  4H0W A;  3KGC A;  4G61 A;  3W9V A;  3EQ1 A;  2ZMB A;  2THI A;  3DP8 A;  3N6U A;  4PAI A;  3IOR A;  4QRZ A;  3OEL A;  3U72 A;  3O29 A;  1DOT A;  1SW4 A;  3B6T A;  3H06 B;  4EQ7 A;  3K1M A;  3RY3 A;  1M5E A;  3SER A;  4Q5T A;  4G8N A;  1LB9 A;  3S9L C;  5A5X B;  5AA2 D;  4DCY A;  1DMB A;  4C1U A;  3W15 C;  1LFI A;  2XXI A;  4O94 A;  3TTR A;  2V25 A;  3O28 A;  2AL5 A;  4KYE A;  2UVH A;  4OFJ A;  2Q8M A;  4YMA A;  2H9B A;  4FJP A;  1US5 A;  1Y20 A;  4QFP A;  3OXN A;  4QSD A;  4KHZ E;  2QMX A;  4THI A;  5TP9 B;  3PUX E;  2NVU B;  3HV1 A;  3A09 A;  1IME A;  2F78 A;  1QJM A;  2H4I A;  1VFE A;  2XWO A;  1UTH B;  2R9J A;  2HEU A;  1NL5 A;  1F9B A;  4DCX A;  5CMB A;  1MXY A;  3FXU A;  3K00 A;  3OO8 A;  4O7M A;  2QRY A;  3OEN A;  1BK4 A;  1B7Z A;  3VVD A;  4PE5 B;  1AMF A;  3QYT A;  3TPA A;  4YMB A;  2M8C A;  2XHD A;  3UIF A;  2Q89 A;  3C4M A;  1URS A;  3D4C A;  4M1V A;  1S7Y A;  2ABH A;  4PDD A;  4RPN A;  4XKR A;  1LFH A;  2O68 A;  1N84 A;  2ONR A;  1LAF E;  4FEC A;  5IKB A;  3RTW B;  4OAN A;  1JW1 A;  2QS1 A;  3A3C A;  1B2H A;  3E13 X;  2VPO A;  2I58 A;  2WYP A;  2XWV A;  4N07 A;  1LEV A;  4Z7E A;  2PFZ A;  3CSG A;  4I8C A;  2FA7 A;  4YB6 A;  4RK2 A;  2ZYO A;  3HST A;  1N7W A;  1NV6 A;  2Y7W A;  3O6I A;  3IO6 A;  5KZT A;  2VD3 A;  4MNI A;  4UAC A;  4QFL A;  1EH3 A;  1B40 A;  3KSX A;  4EQ9 A;  2I3V A;  3PPR A;  3V5A A;  1N3W A;  2H5Y A;  2JJK A;  1YPN A;  5ESY A;  2ZYM A;  4OYV A;  3GZG A;  1AIV A;  1H45 A;  5CMK A;  1WOD A;  3G3G A;  4IO5 A;  2V93 A;  3KEI A;  2XD2 A;  1P1O A;  2Y7R A;  4JVD A;  3LR1 A;  4BLA A;  1OQH A;  1O63 A;  2QVU A;  2PFY A;  2ZNT A;  1FTA A;  2MKZ A;  5IZZ A;  2F34 A;  1N76 A;  4AB6 A;  2UVI A;  3PUV E;  2GRV A;  2P3V A;  2F6P A;  4C0R A;  5I2K A;  1FPG A;  4MX6 A;  4NF4 A;  1NV0 A;  2FVZ A;  2XXR A;  1RYO A;  1OVT A;  3BBR A;  1NMU A;  4N4U A;  1JEU A;  4ECF A;  1VFD A; 
#chains in the Genus database with same CATH homology
 3R7X A;  2YPN A;  5H8H B;  5ICT A;  1MG1 A;  4WXJ A;  4FAT A;  2IA4 A;  1ZJL A;  2DQV A;  4O3B A;  1CE2 A;  1D9V A;  4IGT A;  2HXW A;  3LSF B;  2XXH A;  3WAE A;  3KN7 A;  3R26 A;  1MY4 A;  3U1O A;  4LZ5 A;  1TFA A;  3S9E A;  1JET A;  3KJ7 A;  4TLM B;  3TQL A;  3ZKK A;  1B5I A;  4JBZ A;  3CIJ A;  2F7A A;  5H8F B;  2R6G E;  4F19 A;  3H6V A;  3OO9 A;  4EF2 A;  3D4G A;  3K6W A;  1Y3N A;  3O2A A;  3V83 A;  3FJM A;  5FHN A;  5ISU A;  3ZS6 A;  4DLD A;  3IR1 A;  2OZZ A;  4BDO A;  1M5B A;  3MAM A;  5AA4 A;  1O64 A;  3IX1 A;  4DXC A;  1B52 A;  1CB6 A;  4LP2 B;  1M5C A;  1MQJ A;  1LAX A;  1B1X A;  1A8F A;  4PFY A;  1B46 A;  3N5L A;  5JK4 A;  3IOV A;  3VV5 A;  2G93 A;  1ELJ A;  4ZEK A;  4NF5 B;  3VXC A;  3MC2 A;  3C9H A;  4F1U A;  1ANF A;  3MVZ A;  2RC7 A;  2F97 A;  4LQ5 A;  2VHA A;  1P1W A;  2GH9 A;  1QUK A;  4F18 A;  2P2A A;  3KZG A;  4H6D A;  4RXL A;  4G4P A;  1A55 A;  5J1D A;  4RNS A;  3G3K A;  2CZL A;  1HSJ A;  1I6A A;  3PUW E;  3T9V A;  1XT8 A;  5CBS A;  3RLF E;  4H65 A;  2ZXT A;  1VR5 A;  4IO3 A;  1UQW A;  4X48 A;  4GWO A;  2Q8J A;  4KCC A;  5CI5 A;  4XIG Q;  4DE8 A;  4ISU A;  1I6B A;  4G8H A;  1SW2 A;  1A99 A;  1MQI A;  3MVX A;  3S9N C;  1ZKB A;  1IUD A;  3UA8 A;  4R9F A;  3TEL A;  3QUJ A;  1MY1 A;  1B9J A;  3QAX A;  3QSL A;  2HAV A;  3FVN A;  4OTE A;  2P0S A;  1P1Q A;  3KG2 A;  5HBC A;  1FTM A;  5AA3 A;  4IO6 A;  3FVG A;  5LOM A;  2OWT A;  1B58 A;  3UP9 A;  3SKP A;  1IXC A;  1H44 A;  3K1N A;  1BKA A;  1MPC A;  4OES A;  4F22 A;  5AE4 A;  4E0W A;  4N6P A;  3TCG A;  5A5X A;  3N94 A;  1DPE A;  4KPT A;  3B7D A;  4ZZE A;  1ZLQ A;  4HCY A;  1B5J A;  4FE8 A;  2OK2 A;  4YB5 A;  2VOZ A;  1IEJ A;  5BWJ A;  2PMS A;  4O3C A;  1PEB A;  3B6Q A;  3B6W A;  1I69 A;  1IXH A;  1P1N A;  3SET A;  2ZYN A;  4YB7 A;  4GL8 A;  1SDX A;  4MFI A;  4MLQ A;  2AYS A;  2RCB A;  4ZED A;  3EF7 A;  2HZL A;  4R9G A;  4F2Q A;  5TP9 A;  1TWY A;  2B3F A;  1MY2 A;  5HPQ A;  4GXA A;  1I6Q A;  3QUF A;  1BP5 A;  4YU0 A;  1URD A;  3TUS A;  1R1N A;  3BFT A;  5DT6 A;  3DM0 A;  2H98 A;  1MDQ A;  3KOS A;  2DSF A;  3Q25 A;  3G3I A;  1NH8 A;  3MZB A;  4F3B A;  4MF3 A;  3TKD A;  1IZ1 A;  1LAG E;  3OSQ A;  4DDD A;  2UYE A;  4IO2 A;  1LFG A;  3OOA A;  3P7I A;  4ZZA A;  3HHF A;  1SW1 A;  4BDL A;  4JXI A;  5FHM A;  2NXO A;  3TTM A;  2B3B A;  4G68 B;  1PBQ A;  5L9O A;  2PYY A;  5I58 A;  1B5H A;  5F7V A;  1MH4 A;  4QF9 A;  1PC3 A;  3I6V A;  4I1D A;  1IIW A;  4F2O A;  4F31 B;  4NF6 B;  3EHS A;  3LBS A;  1LBB A;  3TZA A;  1AH5 A;  1L5T A;  3C33 A;  4JDF A;  3M3L A;  3LSL A;  1UIU A;  5TPA A;  3MPK A;  1HSL A;  5I2N A;  1B3E A;  3K6V A;  3KN3 A;  2H99 A;  4JWO A;  4OEV A;  1TXF A;  2OCU A;  2XD3 A;  2X7P A;  3MBP A;  3EHU A;  1AOV A;  2DVC A;  4KYS A;  1QUJ A;  4YZZ A;  1OLA A;  4ZDM A;  4NF8 B;  3U93 A;  2DWI A;  3KSJ A;  2Z8E A;  1FCK A;  5ITP A;  3SDF A;  1IXG A;  4OEU A;  1JVX A;  3V89 B;  1J1N A;  1Q1K A;  3TCH A;  4QSC A;  1P99 A;  3KFM A;  4HCW A;  3WAF A;  2XXX A;  3C36 A;  1ATG A;  3G3J A;  1GGG A;  2I6E A;  5H8H A;  4OVJ A;  3IB2 A;  4ZS9 A;  3IB0 A;  3Q27 A;  3PMX A;  5IAI A;  3QXM A;  1D3K A;  3RTF B;  2QJE A;  1MS7 A;  5I58 B;  2VP1 A;  1A8E A;  4IY6 A;  3K01 A;  4X1B A;  5I57 B;  1Y3Q A;  4MBP A;  3AXF A;  1B32 A;  3RPW A;  4R6H A;  3SES A;  3MQ9 A;  4GFR A;  4E0X A;  1PB9 A;  3H6T A;  5FTH A;  1EZ9 A;  5H8F A;  2REJ A;  4H67 A;  3K1P A;  3T93 B;  1GVC A;  3K6X A;  5TPA B;  4GQO A;  2YLN A;  3PPO A;  5I2N B;  1QUI A;  4OHN A;  2XXW A;  3VXB A;  3U8Q A;  4RK9 A;  3RN8 A;  2Z8D A;  2R71 A;  3G7W A;  5H8N B;  2RF1 A;  4R6K A;  4FAJ A;  2UVG A;  2AL4 A;  5JEI A;  2O51 A;  5B70 A;  3O6G A;  1B7H A;  5CBR A;  3L6G A;  4NF5 A;  4OWD A;  1Y9U A;  2XXT A;  1MM6 A;  3IAZ A;  5AA2 B;  3RQT A;  2HZK A;  1Q35 A;  1FQD A;  3ZKL A;  3OEK A;  2Q2C A;  1USY H;  3MWB A;  5KDT B;  4KFQ A;  5I84 A;  3CG1 A;  4KCD A;  3RT6 B;  3IL1 B;  1FQF A;  5HM4 B;  3A3U A;  1NNP A;  1MQH A;  2F7C A;  1SI1 A;  4I9D A;  1T0K A;  1QKB A;  2ANJ A;  4MLV A;  4G8M A;  4JSO A;  4TLL B;  4BDR A;  4ELO A;  2F8D A;  4WKM A;  3N6T A;  4ESW A;  3TCF A;  4EUO A;  3EN3 A;  4ELQ A;  4IO4 A;  2NOO A;  5EHM A;  4ZE9 A;  4IGR A;  4U21 A;  3IOT A;  3TOD A;  4G77 A;  1Z7M E;  3PD8 A;  2GHB A;  1PB7 A;  2Q9T A;  3TFL A;  4TQU Q;  1OMP A;  3CVG A;  3G3F A;  3S9M C;  1PBP A;  3TQW A;  1FTO A;  2NWJ A;  1B3F A;  4DIG A;  1ZMG A;  3IB1 A;  2UYF A;  4LUB A;  1XVX A;  2BJJ X;  4AQ4 A;  1SYI A;  3RT8 A;  4RYA A;  2QPQ A;  3U92 A;  2O84 X;  3PUY E;  3VE1 B;  1SBP A;  4U1O A;  2I4C A;  4GD5 A;  3SEU A;  4NE4 A;  4YKP A;  3PV0 E;  1FQE A;  3I3V A;  1Z7N E;  3CFX A;  1IIT A;  1DSN A;  4POW A;  3MVY A;  1A54 A;  2PX1 A;  1ZIU A;  2ZYK A;  1Y3P A;  5CC2 A;  2O7U A;  1MXW A;  4YKJ A;  5DYH A;  2UXA A;  3TTK A;  1BLF A;  3ONM A;  3K2D A;  1TT1 A;  3E9X A;  4X9T A;  1EZP A;  4UA8 A;  2I49 A;  3VDF A;  3ILU B;  3MVW A;  3M3K A;  1US4 A;  4JB7 A;  4X1D A;  4FEB A;  3V8X B;  2G29 A;  1B0L A;  4GVO A;  1LST A;  5L9S A;  1OIB A;  1H76 A;  5AA1 A;  2NUV A;  3DEL B;  1N04 A;  1KWH A;  5L8D A;  3EPE A;  4G68 A;  2OLB A;  3FXQ A;  1MXV A;  1DTZ A;  2HCA A;  5TU0 A;  3JYR A;  2XXQ A;  3HN0 A;  3FVK A;  2XXP A;  2XXY A;  2DOJ A;  2AIX A;  1NNK A;  2O1L A;  4F3P A;  3FD3 A;  1B3H A;  4XXU A;  1Y4T A;  2QS3 A;  3HPI A;  3MP1 A;  3THI A;  4NF6 A;  4OEN A;  3CFL A;  3PMV A;  1LB8 A;  5I56 B;  4GL0 A;  2OBG A;  3Q26 A;  3Q28 A;  4XKQ A;  4PFU A;  3ODB A;  3GXA A;  4DXB A;  3CG3 A;  2DE3 A;  3IK6 B;  3UK4 A;  2CMO A;  1JW4 A;  2Y7I A;  2ONS A;  3SEX A;  4EF1 A;  1AL3 A;  5M2V A;  1FW0 A;  1RKM A;  2O7I A;  4EXL A;  5ICQ A;  3H6W A;  1SW5 A;  1WDN A;  2IEE A;  3MJN A;  4H8J A;  3KJT A;  1FTK A;  4XTC Q;  1B51 A;  4OER A;  1GTK A;  3ECR A;  4F3S A;  4R75 A;  3FV1 A;  1XC1 A;  3O6H A;  4R74 A;  1B3G A;  3MUQ A;  4WED A;  4H5G A;  4KQP A;  4QFO A;  5KCJ B;  4U4S A;  4NF8 A;  4IB2 A;  1YAE A;  3GBB A;  3ILT B;  1BIY A;  2X26 A;  1LGB C;  4MH5 A;  3VFJ A;  2QS2 A;  4EDP A;  4R6Y A;  2PT2 A;  1WVJ A;  1R9Q A;  1TFD A;  2H25 A;  4BDM A;  4LA9 A;  5H8Q B;  5JTY A;  2Z8F A;  5DEX B;  2I4B A;  4Q0C A;  1MXZ A;  3H3G A;  2D21 A;  3F11 A;  3IO4 A;  1LCF A;  3CSB A;  2FNC A;  3IOU A;  3PUZ E;  4EQB A;  2ZNS A;  4BDN A;  3T9U A;  1JNF A;  3O97 A;  1HSE A;  2DYX A;  3BKI B;  2XXV A;  2GHA A;  2V3U A;  1R9L A;  4POX A;  4U4X A;  1BTJ A;  2LAO A;  1ZU0 A;  5L9M A;  1FTJ A;  4FIM A;  4RA1 A;  4OFO A;  5CMM A;  2XX9 A;  5I57 A;  1D9Y A;  3DLN A;  1H43 A;  3TEP A;  3I5O A;  3MP8 A;  3SEY A;  2F6G A;  1S50 A;  4GOT A;  4QFK A;  1USY E;  1NKX A;  4HW8 A;  3TYH A;  4LQ2 A;  4OXV A;  2W7Y A;  2ONK E;  3EHT A;  2O1M A;  3LSW A;  1URG A;  4KR5 A;  1N0T A;  3T9H B;  1B4Z A;  4U23 A;  2REG A;  1QUL A;  3SEV A;  2DVZ A;  2RIN A;  2RCA A;  1B05 A;  2E0S A;  3H6U A;  5H8N A;  5FTI A;  1MPD A;  4ZEI A;  3C34 A;  3FAS A;  4H5F A;  1LCT A;  3OEM A;  2P1S A;  1R6Z A;  4RJZ A;  4XKP A;  3CRB A;  4AB5 A;  4ESX A;  3GBA A;  4TOZ A;  1GV8 A;  4NMY A;  3GLB A;  4RPO A;  1GR2 A;  4H1X A;  5AA2 A;  5JTY B;  4PFW A;  3OMB A;  1P1U A;  4PET A;  2PVU A;  5KDT A;  4PQJ A;  1Y1Z A;  2QSX A;  3LUY A;  4R2B A;  3MPL A;  3CI8 A;  4Q8R A;  3FIR A;  3C35 A;  3KBR A;  4LVQ A;  1YCJ A;  2V3Q A;  4KI0 E;  2DS9 A;  3QK6 A;  4PFT A;  1SI0 A;  3MP6 A;  3PD9 A;  1MPB A;  2A5T B;  4OQO A;  4QSE A;  2OJT A;  4R2F A;  1MH3 A;  2B65 A;  1MQG A;  3G3H A;  4GLI A;  1JW5 A;  5DVI A;  3OO7 A;  4P0I A;  2V84 A;  5CMC A;  5ITO A;  3UOR A;  4YKI A;  5DTB A;  4ZEB A;  1A40 A;  2RC9 A;  2XX7 A;  1N7X A;  1SQY A;  3M8U A;  4U22 A;  5K2Y A;  4O3A A;  1XOC A;  4F3G A;  4I62 A;  3TDJ A;  2Q2A A;  2DWJ A;  3T66 A;  5K2X A;  4QHQ A;  1SVX B;  3N26 A;  1LAH E;  1SD3 A;  3IOW A;  2HQ0 A;  3DP6 A;  3S2V A;  1RYX A;  4GXS B;  3LC8 A;  4YIC A;  3ZSF A;  2F36 A;  2ESN A;  1H3D A;  4OMB A;  1OQG A;  4K3F A;  2UVJ A;  2D3I A;  2YJP A;  3H4Z A;  4GF8 A;  1SYH A;  4BDQ A;  2F5X A;  3FJG A;  3Q29 A;  1YTV A;  2DWH A;  1ZTY A;  2F35 A;  2PT1 A;  4RY1 A;  4F29 A;  3RNN A;  1POT A;  3IJO B;  1MXU A;  3VLW A;  1PB8 A;  3C32 A;  1Y1M A;  1QW0 A;  3BFU A;  5F1Q A;  3KN8 A;  1XVY A;  4NTL A;  4XKN A;  5B7D A;  4OZ9 A;  2PBW A;  1VE4 A;  1DPP A;  3K02 A;  3RGY A;  4IY5 A;  2ZNU A;  2DE4 A;  1DTG A;  1B6H A;  1MY0 A;  3O9P A;  4ND9 A;  2A5S A;  1NH7 A;  5EYF A;  4G2Z A;  2O69 A;  1M5F A;  2E1S A;  1OVB A;  2Y84 A;  3MZ1 A;  4Z0I A;  2F7B A;  4JWX A;  4LAT A;  4QFN A;  5I56 A;  4U1Z A;  2DWA A;  1FQB A;  4FOR A;  4N13 A;  1B4H A;  3HHG A;  3QIM A;  4C1T A;  1EZO A;  4U2R A;  3CFZ A;  4GIZ A;  4G68 C;  3PGF A;  3U94 A;  2DXR A;  4PP0 A;  1NNF A;  4ZE8 A;  1XHY A;  2Z22 A;  3HCQ A;  2QS4 A;  4F1V A;  1II5 A;  3W9W A;  4Q30 B;  3KOT A;  3E4R A;  5DVJ A;  4LZ8 A;  3PMW A;  4P11 A;  3FAT A;  3FJ7 A;  4YAH X;  3PU5 A;  4R73 A;  2Z23 A;  2I3W A;  3FXR A;  5KCJ A;  4ZEF A;  4NWC A;  1FQA A;  3JZJ A;  1POY 1;  2I0C A;  4IO7 A;  2OWS A;  4ZEC A;  2VGQ A;  1UIV A;  5H8Q A;  4WEP A;  1JEV A;  2Q88 A;  4P0G A;  5DEX A;  3OO6 A;  1UTB A;  4LZ7 A;  1VSO A;  4FED A;  3PPP A;  4HTG A;  1PDA A;  4ONY A;  3S4U A;  5I2K B;  3VVE A;  4OFL A;  4NF4 B;  3T9X B;  4JWY A;  3MW0 A;  3SEW A;  1MY3 A;  1QVS A;  1NFT A;  1FQC A;  2FYI A;  3LSX A;  3PPN A;  2VD2 A;  3OD7 A;  1D4N A;  3FVO A;  3R6U A;  2D5W A;  3FZV A;  3K6U A;  3H7M A;  1O7T A;  2DP8 A;  3HO7 A;  3K0V A;  1EU8 A;  5I59 A;  4JSD A;  4GRK A;  3UN6 A;  4NED A;  2QL3 A;  2I48 A;  2HFB A;  3T22 A;  1FTL A;  1B1H A;  4H8I A;  4ELP A;  3CR9 A;  4KD5 A;  1OLC A;  1M5D A;  3O66 A;  5BUU A;  5AA4 B;  4EXK A;  3FV2 A;  2KLF A;  2DE2 A;  3DP4 A;  4YKK A;  4ELR A;  3IJX B;  2WKY A;  2XX8 A;  3TAJ A;  1JQF A;  1B3L A;  2RC8 A;  2Y7P A;  3RUM A;  1MRP A;  2RKM A;  5FHO A;  4OET A;  1LBC A;  1MDP 1;  5DVF A;  1QKA A;  3OSR A;  3USD A;  1B0H A;  1IQ7 A;  4R72 A;  3UGW A;  3H03 A;  5ELV A;  2DXY A;  1UTB B;  1JVY A;  1LLS A;  1MM7 A;  1NNT A;  3FGS A;  2QMW A;  3K4U A;  2GFE A;  5CRY A;  5EHS A;  3VLV A;  5H8S A;  1UTH A;  2O6A A;  3L6H A;  2XXU A;  2HAU A;  4DZ1 A;  1MXX A;  1XS5 A;  4L17 A;  4F39 A;  2X7Q A;  1Y4C A;  2A5T A;  3TMG A;  4F1Y A;  4LON B;  3VLU A;  1IXI A;  1ZBM A;  3FUZ A;  1S9T A;  3PPQ A;  1A7L A;  2V3T A;  3TTN A;  4NWD A;  3C31 A;  3VVF A;  4DXU A;  1B7U A;  5CM6 A;  2ALU A;  4KYD A;  3T96 B;  2I0B A;  4HS7 A;  3JV9 A;  5I59 B;  3TTL A;  3MZ9 A;  2Y7K A;  3E3K A;  3M3F A;  1N3X A;  4M4G A;  1MQD A;  4H0W A;  3KGC A;  3W9V A;  3EQ1 A;  2ZMB A;  2THI A;  3DP8 A;  3N6U A;  3IOR A;  4QRZ A;  3OEL A;  3U72 A;  3O29 A;  1DOT A;  1SW4 A;  3B6T A;  3H06 B;  4EQ7 A;  3K1M A;  3RY3 A;  1M5E A;  3SER A;  4Q5T A;  4G8N A;  1LB9 A;  3S9L C;  5A5X B;  5AA2 D;  4DCY A;  1DMB A;  4C1U A;  3W15 C;  1LFI A;  2XXI A;  3TTR A;  2V25 A;  3O28 A;  2AL5 A;  4KYE A;  2UVH A;  4OFJ A;  4YMA A;  2H9B A;  4FJP A;  1US5 A;  1Y20 A;  4QFP A;  3OXN A;  4QSD A;  4KHZ E;  2QMX A;  4THI A;  5TP9 B;  3PUX E;  2NVU B;  3HV1 A;  3A09 A;  2F78 A;  1QJM A;  2H4I A;  1VFE A;  1UTH B;  2R9J A;  2HEU A;  1NL5 A;  1F9B A;  4DCX A;  5CMB A;  1MXY A;  3FXU A;  3K00 A;  3OO8 A;  2QRY A;  3OEN A;  1B7Z A;  3VVD A;  4PE5 B;  1AMF A;  3QYT A;  3TPA A;  4YMB A;  2M8C A;  2XHD A;  3UIF A;  2Q89 A;  3C4M A;  1URS A;  3D4C A;  4M1V A;  1S7Y A;  2ABH A;  4RPN A;  4XKR A;  1LFH A;  2O68 A;  1N84 A;  2ONR A;  1LAF E;  4FEC A;  5IKB A;  3RTW B;  1JW1 A;  2QS1 A;  3A3C A;  1B2H A;  3E13 X;  2I58 A;  4N07 A;  4Z7E A;  3CSG A;  4I8C A;  2FA7 A;  4YB6 A;  4RK2 A;  2ZYO A;  3HST A;  1N7W A;  2Y7W A;  3O6I A;  3IO6 A;  5KZT A;  2VD3 A;  4UAC A;  4QFL A;  1EH3 A;  1B40 A;  3KSX A;  4EQ9 A;  2I3V A;  3PPR A;  3V5A A;  1N3W A;  2H5Y A;  1YPN A;  2ZYM A;  4OYV A;  3GZG A;  1AIV A;  1H45 A;  5CMK A;  1WOD A;  3G3G A;  4IO5 A;  2V93 A;  3KEI A;  2XD2 A;  1P1O A;  2Y7R A;  3LR1 A;  4BLA A;  1OQH A;  1O63 A;  2ZNT A;  2F34 A;  1N76 A;  4AB6 A;  2UVI A;  3PUV E;  2GRV A;  2F6P A;  4C0R A;  5I2K A;  4NF4 A;  2XXR A;  1RYO A;  1OVT A;  3BBR A;  1NMU A;  1JEU A;  4ECF A;  1VFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...