1SW1A

Crystal structure of prox from archeoglobus fulgidus in complex with proline betaine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
270
structure length
270
Chain Sequence
ERVVIGSKPFNEQYILANMIAILLEENGYKAEVKEGLGGTLVNYEALKRNDIQLYVEYTGTAYNVILRKQPPELWDQQYIFDEVKKGLLEADGVVVAAKLGFRDDYALAVRADWAEENGVEKISDLAEFADQLVFGSDPEFASRPDGLPQIKKVYGFEFKEVKQMEPTLMYEAIKNKQVDVIPAYTTDSRVDLFNLKILEDDKGALPPYDAIIIVNGNTAKDEKLISVLKLLEDRIDTDTMRALNYQYDVEKKDAREIAMSFLKEQGLVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords osmoprotection protein (proX)
publication title Structural basis for the binding of compatible solutes by ProX from the hyperthermophilic archaeon Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Protein binding
total genus 93
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1sw1A01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 1sw1A02
3IOTA 3VLWA 3HSTA 1MXZA 3T9HB 3PPOA 2PT1A 2F7CA 1SDXA 4QFOA 3MP1A 2Q2AA 5CBRA 3UP9A 1VE4A 3DP8A 2F6GA 3G3IA 1ZKBA 3K1MA 2FA7A 5L9MA 1JEVA 1URDA 1FTOA 4QFLA 4THIA 3C32A 1SI0A 4G68B 3GLBA 1YTVA 1TFDA 3IB0A 4RPOA 4ECFA 1US4A 4OQOA 3TTRA 2QMXA 1MY4A 2Q88A 3IORA 3QYTA 4H6DA 3Q27A 1P1OA 3QUFA 1MS7A 4QSEA 1MY1A 5FHNA 3EHTA 2HZLA 4PQJA 1JEUA 5LOMA 3K6XA 4OFJA 3C31A 4Q8RA 5AA2B 2F36A 5ITOA 3TQLA 2GFEA 2O7UA 4NF6B 4G77A 1GGGA 1EZPA 1M5CA 4BDMA 3CIJA 2OLBA 4EXKA 5KZTA 2HQ0A 3H4ZA 4ONYA 2V3TA 1MPDA 2F35A 4ZECA 3LBSA 5JK4A 1B6HA 4GQOA 2Y7WA 1MH4A 1VFDA 4GF8A 3TZAA 2ONRA 1MQJA 2RC7A 5ISUA 4KYEA 3HO7A 3LSFB 3R26A 4QSCA 1FTJA 4OTEA 4LATA 5KDTA 4LQ5A 2E1SA 3OELA 3PMWA 3KOTA 3GBAA 3SEVA 4R6KA 2XXIA 4BDRA 2Z22A 3T66A 3FD3A 2RCBA 1OVTA 4JWOA 1QVSA 4YZZA 2H5YA 3OD7A 3IL1B 2ZYNA 1FQBA 1IIWA 4YAHX 2I3WA 4DXUA 4JBZA 2QL3A 2ANJA 4LQ2A 4ISUA 4E0WA 1UQWA 3RLFE 3FVOA 4FATA 1L5TA 3EPEA 1MXYA 4KR5A 1B7HA 4OMBA 5CMCA 2DE3A 2AIXA 3QAXA 1T0KA 2Q8JA 5L8DA 4MFIA 2P0SA 3V8XB 4U2RA 5I59A 5A5XA 5H8HA 4XKRA 1BKAA 1FQFA 3KJ7A 2AL5A 3IK6B 2GHBA 1TT1A 3VXCA 1LBCA 2I3VA 3CI8A 5TP9A 3ILTB 1B52A 5CRYA 3K1PA 3A3CA 3BFTA 4NWDA 5I56B 2HCAA 4FJPA 4UACA 3RTFB 5H8NA 3KN3A 3FJ7A 4RPNA 1R9QA 2XD3A 3BKIB 1ZIUA 1B46A 1A55A 1WODA 4X1DA 4DCYA 5DT6A 4DDDA 1N7XA 2I0CA 2VD3A 2ZNSA 2NWJA 5ITPA 3HHGA 1B3EA 2V25A 1CB6A 4XIGQ 1ZTYA 3E9XA 4ZEKA 3S9LC 2ZXTA 5CMMA 4G8MA 1PEBA 2OZZA 3TQWA 2F7BA 2D5WA 2RC8A 3ZKKA 5H8SA 4FEBA 3C35A 1FQEA 3WAFA 3K01A 1MY0A 1MM7A 5DVIA 3VVDA 1PDAA 3FXRA 5I2KA 4YKJA 3I3VA 1D4NA 5B7DA 3OENA 5CMBA 2ALUA 1B58A 1NNKA 3FVKA 4GXAA 1PBPA 4LZ7A 2F7AA 2QJEA 2XX9A 1URSA 4C0RA 1TWYA 3EHSA 3IOUA 2NUVA 1RYXA 3IOWA 3FV1A 2RC9A 1LCFA 2ZMBA 4IO7A 1IEJA 1GV8A 4F2OA 3IJXB 2VOZA 3MVYA 4HCWA 4QFKA 4YMBA 1MM6A 4MLQA 3MWBA 1DMBA 2O68A 4FIMA 3PPRA 3SESA 1LAXA 1SBPA 3VV5A 4L17A 3FXQA 2HEUA 1A99A 2O1MA 2Y7PA 4ZZEA 5IAIA 5KCJA 2REGA 5H8QA 1P99A 2X7PA 1O64A 3VE1B 2UVJA 3SERA 5KDTB 2I4CA 1ZLQA 4NF8A 1Y4TA 1OQHA 2QSXA 1Y3NA 1P1NA 1WDNA 3TDJA 1RYOA 1JW1A 1QKBA 1TXFA 4OVJA 4R6YA 1TFAA 3PPQA 1FW0A 4WEPA 1FQDA 1QUIA 2V84A 2DSFA 3BFUA 2AL4A 4EXLA 2CMOA 1PB7A 1BLFA 1I6AA 4ZDMA 4U4XA 1MXXA 1S9TA 3PUYE 2QRYA 3MW0A 3G7WA 2OJTA 1N0TA 2V3UA 4R9GA 1S7YA 4HTGA 1LAGE 5F7VA 3B6QA 3K6VA 1B1XA 4Q5TA 2H98A 3H03A 3S4UA 1N84A 1UIVA 4DXBA 3H6WA 3ILUB 4ZEIA 5A5XB 3OEKA 1UTBA 3H6UA 4LONB 1Z7NE 2DS9A 1VFEA 2DOJA 4Q0CA 3MVZA 1AMFA 1H76A 1MQHA 1N76A 4XKPA 1B7ZA 1LAHE 4TLLB 2P1SA 3CG1A 3HPIA 1H3DA 5H8NB 1NH7A 4GL0A 3T93B 2B3BA 4OESA 3FZVA 5L9OA 3KJTA 4FAJA 4MF3A 1ELJA 5AA1A 2VHAA 3GZGA 4KYDA 3PUZE 4ELQA 3IB1A 3U94A 1EU8A 4POXA 3HV1A 3QSLA 3QIMA 4JSDA 4RK2A 4WXJA 2HAVA 3A09A 2O6AA 3A3UA 1ATGA 1IXCA 1MH3A 1SW5A 2B65A 2PBWA 2WKYA 1B3FA 4R2BA 4AB6A 3OMBA 4KCCA 4NF4A 1A8EA 3K4UA 1NFTA 2DWIA 3FJMA 4ZE8A 3R6UA 3MJNA 1N3WA 5I2KB 2FNCA 1B05A 2RCAA 4IY5A 4U1ZA 3WAEA 3VXBA 3PUWE 1GR2A 1B2HA 3O2AA 1H43A 5BWJA 1JVXA 5I84A 2AYSA 3RPWA 4GXSB 1DTZA 4PFUA 4P11A 3B7DA 4I8CA 5DTBA 1MQGA 4GOTA 1ZBMA 1EZOA 2G29A 3Q25A 3EN3A 1UTHB 3K6WA 3O97A 1D9YA 2O69A 2ZYMA 4G8NA 4LVQA 1OLCA 4H1XA 4EF2A 2Z8FA 3FASA 4EQ9A 1PBQA 4WEDA 5H8QB 3SEUA 3CR9A 2NXOA 2OCUA 1USYH 2IA4A 1YCJA 3CG3A 2GH9A 4EQBA 1MXUA 1POTA 4GVOA 3IO4A 5JTYA 3MPLA 3O29A 2R6GE 3VLVA 1I69A 1B0LA 4OFOA 1BIYA 2F78A 3CVGA 1QW0A 1H45A 4IGRA 2OWTA 3TAJA 1OQGA 1D3KA 1AL3A 3FIRA 2ABHA 2FYIA 3K02A 3OO9A 4C1UA 1P1UA 1IXHA 5HPQA 3EQ1A 4IO2A 3M3LA 2ONSA 2QMWA 3Q29A 2ZYKA 4IO5A 3IB2A 3H3GA 1LFHA 3UN6A 2HZKA 4DCXA 5ELVA 2ZNTA 5DEXA 1MXWA 3UGWA 5I2NA 1B4ZA 3H6VA 5F1QA 3M3KA 4R72A 2I49A 2A5SA 3IX1A 2XXUA 2GRVA 3W9WA 4N07A 3FVNA 5B70A 4QRZA 2B3FA 1AIVA 3MVWA 1UTBB 3TPAA 3S9EA 3U72A 3V89B 3KSJA 4RK9A 4OEUA 2DVZA 1DPPA 3RNNA 1B1HA 3OEMA 5AA3A 4F3SA 4I62A 4TQUQ 4OETA 4WKMA 2PVUA 1VR5A 4NMYA 4H8JA 3LSWA 4HW8A 3U92A 3RUMA 3PMXA 4H5GA 2THIA 1KWHA 3IO6A 1Y1MA 4EDPA 3QK6A 3T22A 1B4HA 2PMSA 3N5LA 2VD2A 2GHAA 5I57A 3UORA 4GLIA 4NEDA 2UYFA 4BLAA 1P1WA 1LCTA 5CBSA 5EHMA 4RA1A 1BTJA 4F31B 2XXVA 4PFTA 4NF4B 3SEWA 4OENA 2XXWA 3ZS6A 4ND9A 4IO6A 4PFWA 4EF1A 1MDQA 3G3HA 1SYIA 4DZ1A 2Y7KA 4N6PA 4JXIA 3MC2A 4QFPA 3C33A 2QS4A 3CSBA 1N04A 3CFXA 3OXNA 4JWXA 1DOTA 2UVGA 3W9VA 2DE4A 4KYSA 3TUSA 1QKAA 4FEDA 4IO3A 4F18A 2Y7RA 3HCQA 2CZLA 2O1LA 3T96B 4YMAA 2ONKE 4M1VA 4YU0A 3ZKLA 3KN8A 3K1NA 3S9MC 3HN0A 4IB2A 4E0XA 3K00A 4C1TA 4RJZA 4QHQA 3C9HA 1S50A 4AB5A 4X48A 4GFRA 1B5IA 1POY1 3EF7A 3O6HA 2DWAA 5EYFA 3PMVA 2F34A 1MQDA 4F1UA 4F19A 2XXQA 2UVIA 1B5HA 1O7TA 3MP6A 4NWCA 3CFZA 1FTLA 3R7XA 3Q28A 2XX7A 4Z0IA 1Q1KA 1Y9UA 1PB9A 2UYEA 3K6UA 4ZS9A 5JTYB 3DP4A 1XT8A 4POWA 4NTLA 3G3JA 3G3GA 3UA8A 4HCYA 4MH5A 4H5FA 2REJA 5M2VA 3JZJA 4U22A 4QSDA 2OWSA 1DTGA 1Y4CA 2F97A 2R9JA 1MQIA 1B51A 4OYVA 1EH3A 2Q2CA 4RXLA 4DE8A 2DWJA 1IZ1A 4UA8A 2D21A 2XXPA 3S9NC 2Z8DA 1QULA 4U4SA 4R73A 3FJGA 4OHNA 2Q9TA 1F9BA 3O6GA 3N6TA 4YKIA 3PUVE 4YB5A 5DEXB 5I2NB 4ESXA 1IXGA 4IO4A 3EHUA 1LFGA 5CI5A 5CMKA 1M5BA 3SDFA 1MRPA 4H8IA 4XKNA 3KG2A 3IOVA 3RT6B 2I0BA 3FUZA 3RY3A 4P0GA 3MBPA 4P0IA 4DXCA 1JW4A 2YLNA 4PFYA 1RKMA 3HHFA 1SYHA 3OSQA 1FQCA 5K2YA 3RT8A 2LAOA 5DVJA 3SEXA 2V3QA 1B32A 4RYAA 3O9PA 1YPNA 1PB8A 3MZ1A 5I59B 3THIA 5H8HB 3ONMA 1R6ZA 2XX8A 3QXMA 5ICTA 3B6TA 1XOCA 4IGTA 5TP9B 3IJOB 5EHSA 4KFQA 4FE8A 4ZEDA 2XXRA 3DP6A 2UXAA 3PPPA 4I9DA 1SD3A 2H25A 3V5AA 3V83A 3I5OA 3MPKA 5I57B 4G68C 4G4PA 4ZE9A 1NMUA 3SKPA 2XXXA 3JV9A 3RQTA 1GVCA 1FTMA 4Q30B 1II5A 1R9LA 1LB9A 1FQAA 1FCKA 2QS2A 3L6HA 3CFLA 5AE4A 2RKMA 2Y84A 3VDFA 1WVJA 3PV0E 4O3CA 2I58A 4QF9A 2M8CA 5FHMA 5FTIA 2A5TA 5TU0A 3L6GA 5J1DA 3Q26A 3KZGA 2HAUA 5FTHA 3PD9A 4IY6A 4KI0E 4YB7A 3N6UA 2XHDA 2RF1A 1NL5A 4X1BA 1IXIA 3DLNA 3OO8A 1B3HA 4ESWA 1NNFA 1B40A 2QS1A 1NH8A 3FGSA 3KGCA 4H0WA 1J1NA 4MBPA 4F1YA 3N26A 1HSJA 2XD2A 1A40A 2I6EA 4EQ7A 3FVGA 4KQPA 1B0HA 4R6HA 3KBRA 2F5XA 4G8HA 1LAFE 3FXUA 1I6QA 4XTCQ 4ZEBA 4AQ4A 4Z7EA 4OZ9A 3LUYA 4FORA 5TPAA 5CM6A 3ECRA 1LBBA 3RN8A 4X9TA 3LSLA 4BDNA 1XHYA 3C36A 2QS3A 2PYYA 2OK2A 1B3GA 2KLFA 1OMPA 4F3BA 2E0SA 5KCJB 3TTKA 4U21A 1P1QA 2H9BA 1FTKA 2PT2A 3TELA 3FV2A 4BDLA 2I4BA 4YKKA 2OBGA 2BJJX 4NF8B 2PX1A 5CC2A 1M5EA 3TKDA 3CSGA 3USDA 1N3XA 3I6VA 3TODA 3LR1A 3VLUA 4F3GA 2UVHA 1Y20A 3TMGA 1IUDA 4HS7A 1N7WA 1UIUA 4TLMB 1Q35A 4JWYA 1M5DA 4NE4A 1OIBA 3E13X 4OEVA 3JYRA 3U93A 3TCHA 4RNSA 3C34A 3UIFA 3K0VA 3VFJA 4LZ8A 3D4GA 3LC8A 1EZ9A 1M5FA 1IITA 2V93A 4M4GA 4ZZAA 3TCFA 3LSXA 1ZMGA 4KCDA 3E3KA 3RGYA 1Y3PA 1D9VA 1AH5A 1QJMA 3OO7A 1B7UA 2X7QA 3N94A 3G3KA 3O28A 4U23A 1XVYA 4LUBA 1MXVA 3D4CA 2YJPA 4F29A 1B3LA 2NOOA 2HXWA 1A7LA 3M3FA 5K2XA 4R9FA 2ESNA 2XXYA 3RTWB 4R75A 2VGQA 2W7YA 1I6BA 5HM4B 5BUUA 3AXFA 3CRBA 1SI1A 4ELRA 1BP5A 3IAZA 4O3BA 4LA9A 4NF5A 1JETA 2DXRA 2QPQA 4G2ZA 4XXUA 5HBCA 2DXYA 4U1OA 2I48A 3KFMA 1SW4A 1A8FA 3MQ9A 1DPEA 4OWDA 1MG1A 3TCGA 2DQVA 4ELPA 2A5TB 4OXVA 3KEIA 1B9JA 1HSLA 3KOSA 1JNFA 4PP0A 2YPNA 1CE2A 2F8DA 3TTNA 1NNPA 3S2VA 3VVEA 1OLAA 5DYHA 3C4MA 1LLSA 3BBRA 4FECA 3TEPA 4F3PA 1B5JA 4DIGA 4F1VA 1LB8A 3MZBA 2Z23A 5H8FA 1MY3A 5I58A 4F22A 4BDOA 2RINA 5AA4A 1HSEA 2F6PA 4GD5A 5ICQA 5IKBA 4PETA 3O6IA 3TTMA 3E4RA 1QUJA 3K2DA 1URGA 3H6TA 5TPAB 2Q89A 1OVBA 1MDP1 2HFBA 4YKPA 4N13A 2IEEA 5AA2D 2DP8A 4JB7A 1ZU0A 4RY1A 4F2QA 2NVUB 3PD8A 3VVFA 1Y1ZA 5L9SA 4KD5A 4O3AA 2DYXA 1ZJLA 2VP1A 4JSOA 2G93A 1LFIA 4G68A 3QUJA 3MZ9A 3G3FA 4DLDA 1A54A 1MY2A 2O7IA 1UTHA 3O66A 3F11A 2DWHA 3H06B 4K3FA 1O63A 3IR1A 2P2AA 4H67A 4H65A 2D3IA 1R1NA 5AA2A 3B6WA 2H4IA 2ZYOA 4NF6A 4LZ5A 3PUXE 1SQYA 4GIZA 1AOVA 1QUKA 1SW2A 4ZEFA 1PC3A 5DVFA 2H99A 3OOAA 4GRKA 1JVYA 4QFNA 2XXTA 3DELB 4R74A 4MLVA 3PPNA 1GTKA 2O84X 3KSXA 3DM0A 1NKXA 4YB6A 3TTLA 4XKQA 3T9XB 2X26A 2O51A 4I1DA 3U8QA 2Y7IA 3OO6A 3GBBA 1MPCA 1Z7ME 3P7IA 4TOZA 4F39A 4KHZE 3W15C 3UK4A 1JW5A 4OERA 2DVCA 3MAMA 1DSNA 4EUOA 4NF5B 1US5A 3H7MA 3PU5A 2XXHA 1XS5A 1LSTA 5JEIA 3FATA 4YICA 3MUQA 3GXAA 3MP8A 1YAEA 3ODBA 4JDFA 1NNTA 3SEYA 4LP2B 3OSRA 4KPTA 5FHOA 1SW1A 3M8UA 4BDQA 1XC1A 1LGBC 2DE2A 3KN7A 3SETA 3TFLA 3TYHA 3T9UA 1ANFA 4PE5B 4ELOA 4R2FA 1VSOA 3ZSFA 1H44A 3MVXA 5I56A 3PGFA 3U1OA 5H8FB 1USYE 5I58B 4OFLA 1Y3QA 1MPBA 4GWOA 4GL8A 5AA4B 1SVXB 1JQFA 1XVXA 2ZNUA 3T9VA 1IQ7A 2R71A 2Z8EA
chains in the Genus database with same CATH superfamily
3IOTA 3VLWA 3HSTA 1MXZA 3T9HB 4GWUA 3PPOA 2PT1A 2F7CA 1SDXA 4X8RA 4QFOA 4O7MA 3MP1A 2Q2AA 5CBRA 3UP9A 2XA5A 1VE4A 1YZ0A 3D1RA 3DP8A 2MKZA 2F6GA 3G3IA 1ZKBA 3K1MA 2FA7A 5L9MA 1JEVA 1URDA 1FTOA 4QFLA 4THIA 3C32A 1SI0A 4G68B 3GLBA 1YTVA 1TFDA 3IB0A 4RPOA 4ECFA 1US4A 4OQOA 1IMBA 3TTRA 2QMXA 1MY4A 2Q88A 3IORA 3QYTA 4H6DA 3Q27A 1P1OA 1FPJA 3QUFA 1MS7A 4QSEA 4OVTA 1MY1A 5FHNA 3EHTA 2HZLA 4PQJA 1JEUA 5LOMA 3K6XA 4OFJA 4MCOA 3C31A 4Q8RA 5AA2B 2F36A 5ITOA 3TQLA 2GFEA 4I40A 2O7UA 4NF6B 4G77A 1GGGA 1EZPA 1M5CA 3SZPA 4BDMA 3CIJA 2OLBA 2WX9A 4EXKA 5KZTA 2HQ0A 3H4ZA 4ONYA 2V3TA 1MPDA 2F35A 4ZECA 3LBSA 5JK4A 1B6HA 4GQOA 2ZZVA 2CZHA 2Y7WA 1MH4A 1VFDA 2WEFA 4GWXA 4GF8A 3TZAA 2ONRA 1MQJA 2RC7A 5ISUA 4KYEA 3HO7A 3LSFB 3R26A 4QSCA 1FTJA 4OTEA 4LATA 5KDTA 4LQ5A 2E1SA 3OELA 3PMWA 4OVQA 3ISPA 3KOTA 3GBAA 4MJOA 3SEVA 1KA0A 3E79A 4R6KA 2XWKA 2XXIA 4BDRA 2Z22A 5ET5A 3T66A 3FD3A 2RCBA 1OVTA 4PGPA 4JWOA 1QVSA 4YZZA 2H5YA 3OD7A 3IL1B 2ZYNA 1FQBA 2QFLA 1IIWA 4YAHX 2I3WA 5EYGA 4DXUA 4JBZA 2QL3A 2ANJA 4LQ2A 4HE1A 4ISUA 4E0WA 1UQWA 3RLFE 3FVOA 4FATA 1L5TA 3EPEA 1MXYA 3RPLB 4KR5A 1B7HA 4OMBA 5CMCA 2DE3A 2AIXA 3QAXA 2CEXA 1T0KA 2Q8JA 5L8DA 4MFIA 2P0SA 3V8XB 4U2RA 5I59A 5A5XA 5H8HA 4XKRA 1BKAA 1FQFA 3KJ7A 2AL5A 3IK6B 2GHBA 1TT1A 1LBCA 2I3VA 3VXCA 3CI8A 5TP9A 3ILTB 1B52A 5T3JA 5CRYA 2PFYA 4NN3A 3K1PA 4XEQA 3A3CA 3BFTA 4NWDA 5I56B 2XWOA 2HCAA 4FJPA 4UACA 3RTFB 5H8NA 3KN3A 3FJ7A 4NG7A 4RPNA 1R9QA 2XD3A 3BKIB 1ZIUA 1B46A 1A55A 4N6DA 1WODA 4PFIA 4X1DA 4DCYA 2L5VA 5DT6A 4DDDA 1N7XA 2I0CA 2VD3A 1LBVA 2ZNSA 2NWJA 5ITPA 3HHGA 1B3EA 2V25A 3KBZA 1CB6A 4XIGQ 1ZTYA 4MNCA 3E9XA 4ZEKA 3S9LC 1DK4A 2ZXTA 5CMMA 4G8MA 1PEBA 1SPIA 1G0IA 2OZZA 3E78A 3TQWA 2F7BA 4QBAA 2D5WA 2RC8A 3ZKKA 5H8SA 3FXBA 2PFZA 4FEBA 1NV5A 3C35A 1FQEA 2B4MA 3WAFA 1NV2A 3K01A 1MY0A 1MM7A 5DVIA 3VVDA 4OA4A 2QVUA 4PBQA 1PDAA 3FXRA 5I2KA 4YKJA 3I3VA 1D4NA 5B7DA 3OENA 5CMBA 2ALUA 1B58A 1NNKA 5IZZA 3FVKA 4GXAA 1PBPA 4LZ7A 4O7IA 2F7AA 2QJEA 2XX9A 1URSA 4C0RA 1TWYA 3EHSA 3IOUA 3QMFA 2NUVA 1RYXA 4DI3D 3IOWA 3FV1A 2RC9A 5DW8A 1LCFA 2ZMBA 4IO7A 1IEJA 1GV8A 4F2OA 3IJXB 2VOZA 3MVYA 4HCWA 4QFKA 4YMBA 4N8YA 1MM6A 4MLQA 3MWBA 1DMBA 4PE3A 4MNPA 3B8BA 2O68A 1FBEA 4FIMA 3PPRA 3SESA 1LAXA 1SBPA 2WBDA 1FRPA 3VV5A 4L17A 5EQ9A 3FXQA 2HEUA 2QVRA 1A99A 2O1MA 2Y7PA 4ZZEA 5IAIA 5KCJA 2REGA 5H8QA 1P99A 2X7PA 1O64A 3VE1B 2UVJA 3SERA 5KDTB 1NV0A 2I4CA 1ZLQA 1IMEA 1Y4TA 1OQHA 4NF8A 4NX1A 2QSXA 1Y3NA 2Y5KA 1FPKA 1P1NA 4N15A 4PTKA 1WDNA 3TDJA 5IZ3B 1RYOA 1JW1A 1QKBA 1TXFA 4OVJA 4R6YA 1TFAA 3PPQA 1FW0A 4WEPA 1FQDA 1QUIA 2V84A 1FBFA 2DSFA 4GWYA 5EQAA 3BFUA 2AL4A 4EXLA 2CMOA 4P8BA 1PB7A 4PDHA 1BLFA 1I6AA 4ZDMA 4U4XA 1MXXA 1S9TA 3PUYE 2QRYA 5ESYA 3MW0A 3G7WA 2OJTA 4GBVA 1FPLA 1N0TA 2V3UA 4R9GA 1S7YA 4HTGA 1LAGE 5F7VA 3B6QA 3K6VA 1B1XA 4N17A 4PDDA 2H98A 4Q5TA 4IR8A 3H03A 3S4UA 1N84A 1UIVA 2FVZA 4DXBA 3H6WA 3ILUB 4ZEIA 5A5XB 3OEKA 1UTBA 4PF6A 3H6UA 4LONB 1Z7NE 2DS9A 1VFEA 3B50A 5ET6A 2DOJA 4Q0CA 5IM2A 3MVZA 1AMFA 1H76A 1MQHA 1N76A 4XKPA 1B7ZA 4I3EA 1LAHE 4TLLB 2P1SA 3CG1A 2B4LA 3HPIA 1H3DA 5H8NB 1NH7A 4GL0A 4GWSA 3T93B 2B3BA 4OESA 3FZVA 5L9OA 4GX6A 3KJTA 4FAJA 4MF3A 1ELJA 5AA1A 2VHAA 3GZGA 4KYDA 3PUZE 1IMDA 2HXRA 4ELQA 3IB1A 3U94A 1EU8A 3ROJA 2FIEA 4POXA 3HV1A 3QSLA 3QIMA 2P3NA 4JSDA 4RK2A 4WXJA 2HAVA 3A09A 2O6AA 3A3UA 1FPBA 1IMCA 1ATGA 4UABA 1IXCA 1MH3A 1SW5A 2B65A 4PAFA 2PBWA 2WKYA 1B3FA 4R2BA 4AB6A 3OMBA 4KCCA 4NF4A 1A8EA 3K4UA 1NFTA 2DWIA 3FJMA 4ZE8A 3R6UA 1FSAA 3MJNA 1N3WA 4PBHA 5I2KB 2HPGA 2FNCA 1B05A 2RCAA 4IY5A 4U1ZA 3WAEA 3VXBA 3PUWE 1GR2A 1B2HA 3O2AA 1H43A 5BWJA 1JVXA 5I84A 2AYSA 3RPWA 2FBPA 4GXSB 1DTZA 2FIXA 4PFUA 4P11A 4G61A 4GBWA 3B7DA 1RDZA 2CEYA 1FTAA 4I8CA 5EYHA 5DTBA 1MQGA 4GOTA 1ZBMA 1EZOA 2G29A 3Q25A 3EN3A 3U65A 1UTHB 3K6WA 2R8TA 3O97A 1D9YA 2OX3A 2O69A 2ZYMA 4G8NA 4LVQA 1OLCA 4H1XA 4EF2A 4I3YA 4X04A 1AWBA 4P47A 2Z8FA 3FASA 1NV6A 4EQ9A 4AS5A 1PBQA 4WEDA 5H8QB 3SEUA 3CR9A 2NXOA 2OCUA 4NHBA 1USYH 2IA4A 1YCJA 3CG3A 5ET8A 2GH9A 4EQBA 3HFUA 1MXUA 1POTA 4GVOA 3IO4A 5JTYA 2GQ1A 3MPLA 3O29A 4N81A 2R6GE 3KC1A 3VLVA 1I69A 1B0LA 4OFOA 1BIYA 2F78A 1KA1A 3CVGA 1QW0A 1H45A 4IGRA 2OWTA 3TAJA 1OQGA 1D3KA 1AL3A 3FIRA 2ABHA 2FYIA 3K02A 3OO9A 4C1UA 1P1UA 2JJKA 1IXHA 5HPQA 3EQ1A 2F3DA 4IO2A 4P1EA 3M3LA 2ONSA 2QMWA 3Q29A 2ZYKA 4IO5A 3IB2A 3H3GA 1LFHA 3UN6A 3MSTA 2HZKA 4DCXA 5ELVA 2ZNTA 4XF5A 1NI9A 5DEXA 1MXWA 3UGWA 5I2NA 1B4ZA 2CZIA 4GX4A 3H6VA 5F1QA 3M3KA 4R72A 2I49A 1EYKA 2A5SA 3IX1A 2XXUA 2GRVA 3W9WA 4N07A 3FVNA 5B70A 4QRZA 2B3FA 1AIVA 4P3LA 3MVWA 1UTBB 3TPAA 3S9EA 3U72A 3V89B 3KSJA 2PCRA 3EKIA 1LBYA 4RK9A 4OEUA 2DVZA 1DPPA 1NV3A 2Q8MA 3RNNA 1B1HA 3OEMA 5AA3A 4GWWA 4F3SA 4I62A 4P9KA 4TQUQ 4OETA 1DBZA 4MX6A 4WKMA 2PVUA 1VR5A 4NMYA 3IFAA 4H8JA 3LSWA 3T0JA 4HW8A 3U92A 3RUMA 2VPOA 3PMXA 4H5GA 2THIA 1KWHA 3IO6A 1Y1MA 3FBPA 4EDPA 5J16A 3QK6A 4NQ8A 3T22A 1B4HA 2PMSA 3N5LA 2VD2A 2GHAA 1FPGA 5I57A 3UORA 4GLIA 4NEDA 2UYFA 4BLAA 1P1WA 1LCTA 5CBSA 5EHMA 4RA1A 3PTYA 1BTJA 4F31B 2XXVA 4PFTA 4NF4B 3SEWA 4OENA 4FBPA 2XXWA 3ZS6A 1DCUA 1RDXA 4ND9A 4IO6A 4PFWA 4EF1A 1MDQA 3G3HA 1SYIA 4DZ1A 2Y7KA 4N6PA 4JXIA 3MC2A 4QFPA 4DI4B 3C33A 2QS4A 3CSBA 1K9ZA 1N04A 3CFXA 3OXNA 4JWXA 1DOTA 2UVGA 3W9VA 2DE4A 1FPDA 1JP4A 4KYSA 3TUSA 1QKAA 4FEDA 4IO3A 4F18A 2Y7RA 3HCQA 2CZLA 2O1LA 3T96B 4YMAA 2ONKE 2V4CA 4M1VA 4YU0A 3ZKLA 3KN8A 3K1NA 4GWZA 4PCDA 3S9MC 3HN0A 4IB2A 4E0XA 3K00A 4C1TA 4RJZA 4QHQA 3C9HA 1S50A 4AB5A 4X48A 4GFRA 2VPNA 1B5IA 1POY1 3EF7A 3O6HA 2Y5LA 2DWAA 5EYFA 1YYZA 3PMVA 2F34A 1MQDA 4F1UA 4F19A 2XXQA 2UVIA 2ZZWA 1B5HA 1O7TA 1LEVA 3MP6A 4NWCA 3CFZA 1FTLA 3R7XA 3Q28A 2XX7A 4Z0IA 1Q1KA 1Y9UA 1PB9A 2UYEA 3K6UA 4ZS9A 5JTYB 3DP4A 1XT8A 4POWA 4NTLA 4KXPA 2WYPA 3G3JA 1INPA 3G3GA 5EQ8A 3UA8A 4HCYA 4MH5A 4H5FA 2REJA 5M2VA 3JZJA 4U22A 4QSDA 2OWSA 4N6KA 1DTGA 1Y4CA 2F97A 2R9JA 1MQIA 4JVDA 1B51A 1LBWA 4OYVA 1EH3A 3BIGA 2Q2CA 4RXLA 4DE8A 2DWJA 1IZ1A 4UA8A 2D21A 2XXPA 3S9NC 2Z8DA 1KZ8A 4PGNA 1QULA 4U4SA 4R73A 3FJGA 4OHNA 2Q9TA 1LBZA 1F9BA 3O6GA 3N6TA 4YKIA 3PUVE 4YB5A 5DEXB 5I2NB 4ESXA 1IXGA 4IO4A 3EHUA 1LFGA 5CI5A 5CMKA 1NV4A 4GX3A 1M5BA 4MEVA 3SDFA 1K9YA 1MRPA 4H8IA 4XKNA 3KG2A 2WBBA 3IOVA 2WYKA 3RT6B 3IFCA 2I0BA 3CHGA 3FUZA 3RY3A 2VT5A 3GYYA 4P0GA 3MBPA 4P0IA 4DXCA 2CZKA 1JW4A 2YLNA 4PFYA 1RKMA 3HHFA 1SYHA 3OSQA 1FQCA 5K2YA 3RT8A 2LAOA 5DVJA 3SEXA 2V3QA 1B32A 4HXVA 4RYAA 3O9PA 4N8GA 1YPNA 1PB8A 1IMAA 3MZ1A 5I59B 3THIA 5H8HB 3ONMA 1R6ZA 2XX8A 3QXMA 5ICTA 3B6TA 1XOCA 4IGTA 4JVIA 5TP9B 3IJOB 4MIJA 5EHSA 4KFQA 4P56A 4FE8A 4ZEDA 2XXRA 4N91A 3DP6A 4P1LA 2UXAA 3PPPA 1QGXA 4I9DA 1SD3A 3RYDA 2H25A 3V5AA 5LDZA 3V83A 3I5OA 3MPKA 5I57B 2Q74A 4G68C 4G4PA 4ZE9A 1NMUA 3SKPA 1FBCA 2XXXA 2HHMA 3JV9A 3RQTA 1GVCA 1FTMA 4Q30B 1II5A 1R9LA 1LB9A 1FQAA 5A5LA 2DDKA 1FCKA 2QS2A 3L6HA 3CFLA 2RKMA 2Y84A 5AE4A 3VDFA 1WVJA 3PV0E 4HE2A 4O3CA 1XI6A 4H46A 2I58A 4QF9A 2M8CA 5FHMA 5FTIA 2A5TA 5TU0A 3L6GA 5J1DA 3Q26A 3KZGA 2HAUA 5FTHA 3PD9A 4IY6A 4KI0E 4LN5A 4YB7A 3N6UA 4NAPA 2XHDA 1NUYA 4PFBA 2RF1A 1NL5A 4X1BA 1IXIA 3DLNA 3OO8A 1B3HA 4ESWA 1NNFA 1B40A 2QS1A 1NH8A 3FGSA 3KGCA 4H0WA 2OWZA 1J1NA 4MBPA 4F1YA 3N26A 1HSJA 2XD2A 1A40A 2I6EA 4EQ7A 1FPEA 3FVGA 4KQPA 1B0HA 4R6HA 3KBRA 2F5XA 5EQ7A 4G8HA 1LAFE 3FXUA 3BIHA 1I6QA 4XTCQ 4ZEBA 4AQ4A 4Z7EA 1YXIA 1CNQA 4OZ9A 3LUYA 1EYIA 4FORA 5TPAA 5CM6A 3ECRA 1LBBA 3RN8A 4X9TA 3LSLA 4BDNA 3KC0A 1XHYA 3C36A 2QS3A 2PYYA 1NUZA 2OK2A 1B3GA 2KLFA 4JVCA 1OMPA 4F3BA 2E0SA 5KCJB 3LUZA 3TTKA 4U21A 1P1QA 2H9BA 1FTKA 2XWVA 2PT2A 1Q9DA 3TELA 3FV2A 4BDLA 4O8MA 2I4BA 4YKKA 2OBGA 2BJJX 4NF8B 2PX1A 5CC2A 1M5EA 3TKDA 3CSGA 3USDA 1N3XA 2KR0A 3I6VA 3TODA 3LR1A 3VLUA 4F3GA 2UVHA 1Y20A 3TMGA 1IUDA 4HS7A 1N7WA 1UIUA 4TLMB 1IMFA 1Q35A 4JWYA 1M5DA 1D9QA 5FBPA 4NE4A 1OIBA 3E13X 4OEVA 3JYRA 3U93A 3TCHA 4RNSA 3C34A 3A29A 3UIFA 1NV1A 3K0VA 3VFJA 4LZ8A 3D4GA 3LC8A 1EZ9A 1M5FA 1IITA 1FBGA 2V93A 4M4GA 4ZZAA 3TCFA 3LSXA 1ZMGA 4PAIA 4KCDA 3E3KA 5IZ3A 3RGYA 1Y3PA 1D9VA 1EYJA 1AH5A 1QJMA 3OO7A 1B7UA 2X7QA 3N94A 4PF8A 3G3KA 3O28A 1NV7A 4U23A 1XVYA 4MHFA 4LUBA 1MXVA 3D4CA 2YJPA 4F29A 1B3LA 2NOOA 2HXWA 1A7LA 4PC9A 3M3FA 5K2XA 4R9FA 2ESNA 2XXYA 3RTWB 4R75A 2VGQA 2W7YA 1I6BA 5HM4B 5BUUA 3AXFA 3CRBA 1SI1A 4ELRA 1BP5A 3IAZA 4O3BA 4LA9A 4NF5A 1JETA 2DXRA 2QPQA 4G2ZA 4XXUA 4HE0A 2DXYA 5HBCA 4U1OA 2I48A 3KFMA 1SW4A 1NUXA 1A8FA 3MQ9A 1DPEA 4OWDA 2FHYA 1MG1A 3TCGA 2DQVA 4ELPA 2A5TB 4OXVA 3KEIA 1B9JA 1HSLA 3KOSA 1JNFA 4PP0A 2YPNA 1CE2A 2F8DA 3TTNA 1NNPA 3S2VA 3VVEA 1OLAA 5DYHA 3C4MA 1BK4A 2XWIA 4PAKA 2KQZA 1LLSA 3BBRA 4FECA 3TEPA 3NOHA 1B5JA 4O94A 4F3PA 4DIGA 4F1VA 4MMPA 1LB8A 1FBDA 3MZBA 2Z23A 5H8FA 1MY3A 5I58A 1VDWA 4F22A 4BDOA 2RINA 5AA4A 1HSEA 2F6PA 5LTCA 5ET7A 4GD5A 5ICQA 5IKBA 1FJ6A 4PETA 3O6IA 1LBXA 5I7IA 3TTMA 3E4RA 1QUJA 3K2DA 1URGA 3H6TA 5TPAB 2Q89A 1OVBA 1MDP1 2HFBA 4NF0A 4YKPA 4MNIA 4N13A 2IEEA 5AA2D 2DP8A 4JB7A 1ZU0A 4RY1A 4OVSA 5IZ1A 2ZZXA 5F24A 4F2QA 2NVUB 2P3VA 3PD8A 3VVFA 1Y1ZA 1G0HA 5L9SA 4KD5A 4O3AA 2DYXA 1ZJLA 2VP1A 1FBPA 4JSOA 2G93A 1LFIA 4G68A 3QUJA 3MZ9A 3G3FA 4DLDA 1A54A 1MY2A 2O7IA 1UTHA 3O66A 3F11A 4H45A 2DWHA 4OVPA 3H06B 4K3FA 1O63A 3IR1A 2P2AA 4AS4A 4N4UA 4H67A 4H65A 2D3IA 1R1NA 5AA2A 3LV0A 3B6WA 2H4IA 2ZYOA 4NF6A 4LZ5A 3PUXE 1SQYA 4GIZA 5IGAA 4OANA 1AOVA 1QUKA 1SW2A 4ZEFA 1PC3A 5DVFA 2H99A 3OOAA 4GRKA 1JVYA 4QFNA 2XXTA 3DELB 4R74A 5I5PA 4MLVA 3PPNA 1GTKA 2O84X 3KSXA 3DM0A 1NKXA 4YB6A 3TTLA 4XKQA 3T9XB 2X26A 2O51A 4I1DA 3U8QA 2Y7IA 3OO6A 3GBBA 1MPCA 1Z7ME 4PFRA 3P7IA 4TOZA 1NUWA 4F39A 2F3BA 4KHZE 3W15C 4NGUA 3UK4A 1JW5A 4OERA 2DVCA 3MAMA 1DSNA 4EUOA 4NF5B 1US5A 3H7MA 3MYUA 3PU5A 2XXHA 1XS5A 1LSTA 5JEIA 3FATA 1FPIA 4YICA 3MUQA 3GXAA 3MP8A 1YAEA 5I3SA 3ODBA 3RPLA 4JDFA 1NNTA 3SEYA 4LP2B 4QXDA 3OSRA 4KPTA 5FHOA 1SW1A 3M8UA 4BDQA 1XC1A 4MAGA 1LGBC 2DE2A 3KN7A 3SETA 3TFLA 3TYHA 2BJIA 3T9UA 1ANFA 1FJ9A 2XXKA 4PE5B 4OVRA 4ELOA 4R2FA 1VSOA 3ZSFA 1H44A 3T1BA 3MVXA 5I56A 1RDYA 3PGFA 3U1OA 5H8FB 1USYE 5I58B 4OFLA 2QVVA 1Y3QA 1FBHA 1MPBA 4XFEA 4GWOA 1FPFA 4GL8A 5AA4B 1SVXB 1JQFA 1XVXA 2ZNUA 3T9VA 1IQ7A 2R71A 2Z8EA
chains in the Genus database with same CATH topology
3IOTA 3VLWA 3HSTA 1MXZA 3T9HB 3PPOA 2PT1A 2F7CA 1SDXA 4QFOA 3MP1A 2Q2AA 5CBRA 3UP9A 1VE4A 3DP8A 2F6GA 3G3IA 1ZKBA 3K1MA 2FA7A 5L9MA 1JEVA 1URDA 1FTOA 4QFLA 4THIA 3C32A 1SI0A 4G68B 3GLBA 1YTVA 1TFDA 3IB0A 4RPOA 4ECFA 1US4A 4OQOA 3TTRA 2QMXA 1MY4A 2Q88A 3IORA 3QYTA 4H6DA 3Q27A 1P1OA 3QUFA 1MS7A 4QSEA 1MY1A 5FHNA 3EHTA 2HZLA 4PQJA 1JEUA 5LOMA 3K6XA 4OFJA 3C31A 4Q8RA 5AA2B 2F36A 5ITOA 3TQLA 2GFEA 2O7UA 4NF6B 4G77A 1GGGA 1EZPA 1M5CA 4BDMA 3CIJA 2OLBA 4EXKA 5KZTA 2HQ0A 3H4ZA 4ONYA 2V3TA 1MPDA 2F35A 4ZECA 3LBSA 5JK4A 1B6HA 4GQOA 2Y7WA 1MH4A 1VFDA 4GF8A 3TZAA 2ONRA 1MQJA 2RC7A 5ISUA 4KYEA 3HO7A 3LSFB 3R26A 4QSCA 1FTJA 4OTEA 4LATA 5KDTA 4LQ5A 2E1SA 3OELA 3PMWA 3KOTA 3GBAA 3SEVA 4R6KA 2XXIA 4BDRA 2Z22A 3T66A 3FD3A 2RCBA 1OVTA 4JWOA 1QVSA 4YZZA 2H5YA 3OD7A 3IL1B 2ZYNA 1FQBA 1IIWA 4YAHX 2I3WA 4DXUA 4JBZA 2QL3A 2ANJA 4LQ2A 4ISUA 4E0WA 1UQWA 3RLFE 3FVOA 4FATA 1L5TA 3EPEA 1MXYA 4KR5A 1B7HA 4OMBA 5CMCA 2DE3A 2AIXA 3QAXA 1T0KA 2Q8JA 5L8DA 4MFIA 2P0SA 3V8XB 4U2RA 5I59A 5A5XA 5H8HA 4XKRA 1BKAA 1FQFA 3KJ7A 2AL5A 3IK6B 2GHBA 1TT1A 3VXCA 1LBCA 2I3VA 3CI8A 5TP9A 3ILTB 1B52A 5CRYA 3K1PA 3A3CA 3BFTA 4NWDA 5I56B 2HCAA 4FJPA 4UACA 3RTFB 5H8NA 3KN3A 3FJ7A 4RPNA 1R9QA 2XD3A 3BKIB 1ZIUA 1B46A 1A55A 1WODA 4X1DA 4DCYA 5DT6A 4DDDA 1N7XA 2I0CA 2VD3A 2ZNSA 2NWJA 5ITPA 3HHGA 1B3EA 2V25A 1CB6A 4XIGQ 1ZTYA 3E9XA 4ZEKA 3S9LC 2ZXTA 5CMMA 4G8MA 1PEBA 2OZZA 3TQWA 2F7BA 2D5WA 2RC8A 3ZKKA 5H8SA 4FEBA 3C35A 1FQEA 3WAFA 3K01A 1MY0A 1MM7A 5DVIA 3VVDA 1PDAA 3FXRA 5I2KA 4YKJA 3I3VA 1D4NA 5B7DA 3OENA 5CMBA 2ALUA 1B58A 1NNKA 3FVKA 4GXAA 1PBPA 4LZ7A 2F7AA 2QJEA 2XX9A 1URSA 4C0RA 1TWYA 3EHSA 3IOUA 2NUVA 1RYXA 3IOWA 3FV1A 2RC9A 1LCFA 2ZMBA 4IO7A 1IEJA 1GV8A 4F2OA 3IJXB 2VOZA 3MVYA 4HCWA 4QFKA 4YMBA 1MM6A 4MLQA 3MWBA 1DMBA 2O68A 4FIMA 3PPRA 3SESA 1LAXA 1SBPA 3VV5A 4L17A 3FXQA 2HEUA 1A99A 2O1MA 2Y7PA 4ZZEA 5IAIA 5KCJA 2REGA 5H8QA 1P99A 2X7PA 1O64A 3VE1B 2UVJA 3SERA 5KDTB 2I4CA 1ZLQA 4NF8A 1Y4TA 1OQHA 2QSXA 1Y3NA 1P1NA 1WDNA 3TDJA 1RYOA 1JW1A 1QKBA 1TXFA 4OVJA 4R6YA 1TFAA 3PPQA 1FW0A 4WEPA 1FQDA 1QUIA 2V84A 2DSFA 3BFUA 2AL4A 4EXLA 2CMOA 1PB7A 1BLFA 1I6AA 4ZDMA 4U4XA 1MXXA 1S9TA 3PUYE 2QRYA 3MW0A 3G7WA 2OJTA 1N0TA 2V3UA 4R9GA 1S7YA 4HTGA 1LAGE 5F7VA 3B6QA 3K6VA 1B1XA 4Q5TA 2H98A 3H03A 3S4UA 1N84A 1UIVA 4DXBA 3H6WA 3ILUB 4ZEIA 5A5XB 3OEKA 1UTBA 3H6UA 4LONB 1Z7NE 2DS9A 1VFEA 2DOJA 4Q0CA 3MVZA 1AMFA 1H76A 1MQHA 1N76A 4XKPA 1B7ZA 1LAHE 4TLLB 2P1SA 3CG1A 3HPIA 1H3DA 5H8NB 1NH7A 4GL0A 3T93B 2B3BA 4OESA 3FZVA 5L9OA 3KJTA 4FAJA 4MF3A 1ELJA 5AA1A 2VHAA 3GZGA 4KYDA 3PUZE 4ELQA 3IB1A 3U94A 1EU8A 4POXA 3HV1A 3QSLA 3QIMA 4JSDA 4RK2A 4WXJA 2HAVA 3A09A 2O6AA 3A3UA 1ATGA 1IXCA 1MH3A 1SW5A 2B65A 2PBWA 2WKYA 1B3FA 4R2BA 4AB6A 3OMBA 4KCCA 4NF4A 1A8EA 3K4UA 1NFTA 2DWIA 3FJMA 4ZE8A 3R6UA 3MJNA 1N3WA 5I2KB 2FNCA 1B05A 2RCAA 4IY5A 4U1ZA 3WAEA 3VXBA 3PUWE 1GR2A 1B2HA 3O2AA 1H43A 5BWJA 1JVXA 5I84A 2AYSA 3RPWA 4GXSB 1DTZA 4PFUA 4P11A 3B7DA 4I8CA 5DTBA 1MQGA 4GOTA 1ZBMA 1EZOA 2G29A 3Q25A 3EN3A 1UTHB 3K6WA 3O97A 1D9YA 2O69A 2ZYMA 4G8NA 4LVQA 1OLCA 4H1XA 4EF2A 2Z8FA 3FASA 4EQ9A 1PBQA 4WEDA 5H8QB 3SEUA 3CR9A 2NXOA 2OCUA 1USYH 2IA4A 1YCJA 3CG3A 2GH9A 4EQBA 1MXUA 1POTA 4GVOA 3IO4A 5JTYA 3MPLA 3O29A 2R6GE 3VLVA 1I69A 1B0LA 4OFOA 1BIYA 2F78A 3CVGA 1QW0A 1H45A 4IGRA 2OWTA 3TAJA 1OQGA 1D3KA 1AL3A 3FIRA 2ABHA 2FYIA 3K02A 3OO9A 4C1UA 1P1UA 1IXHA 5HPQA 3EQ1A 4IO2A 3M3LA 2ONSA 2QMWA 3Q29A 2ZYKA 4IO5A 3IB2A 3H3GA 1LFHA 3UN6A 2HZKA 4DCXA 5ELVA 2ZNTA 5DEXA 1MXWA 3UGWA 5I2NA 1B4ZA 3H6VA 5F1QA 3M3KA 4R72A 2I49A 2A5SA 3IX1A 2XXUA 2GRVA 3W9WA 4N07A 3FVNA 5B70A 4QRZA 2B3FA 1AIVA 3MVWA 1UTBB 3TPAA 3S9EA 3U72A 3V89B 3KSJA 4RK9A 4OEUA 2DVZA 1DPPA 3RNNA 1B1HA 3OEMA 5AA3A 4F3SA 4I62A 4TQUQ 4OETA 4WKMA 2PVUA 1VR5A 4NMYA 4H8JA 3LSWA 4HW8A 3U92A 3RUMA 3PMXA 4H5GA 2THIA 1KWHA 3IO6A 1Y1MA 4EDPA 3QK6A 3T22A 1B4HA 2PMSA 3N5LA 2VD2A 2GHAA 5I57A 3UORA 4GLIA 4NEDA 2UYFA 4BLAA 1P1WA 1LCTA 5CBSA 5EHMA 4RA1A 1BTJA 4F31B 2XXVA 4PFTA 4NF4B 3SEWA 4OENA 2XXWA 3ZS6A 4ND9A 4IO6A 4PFWA 4EF1A 1MDQA 3G3HA 1SYIA 4DZ1A 2Y7KA 4N6PA 4JXIA 3MC2A 4QFPA 3C33A 2QS4A 3CSBA 1N04A 3CFXA 3OXNA 4JWXA 1DOTA 2UVGA 3W9VA 2DE4A 4KYSA 3TUSA 1QKAA 4FEDA 4IO3A 4F18A 2Y7RA 3HCQA 2CZLA 2O1LA 3T96B 4YMAA 2ONKE 4M1VA 4YU0A 3ZKLA 3KN8A 3K1NA 3S9MC 3HN0A 4IB2A 4E0XA 3K00A 4C1TA 4RJZA 4QHQA 3C9HA 1S50A 4AB5A 4X48A 4GFRA 1B5IA 1POY1 3EF7A 3O6HA 2DWAA 5EYFA 3PMVA 2F34A 1MQDA 4F1UA 4F19A 2XXQA 2UVIA 1B5HA 1O7TA 3MP6A 4NWCA 3CFZA 1FTLA 3R7XA 3Q28A 2XX7A 4Z0IA 1Q1KA 1Y9UA 1PB9A 2UYEA 3K6UA 4ZS9A 5JTYB 3DP4A 1XT8A 4POWA 4NTLA 3G3JA 3G3GA 3UA8A 4HCYA 4MH5A 4H5FA 2REJA 5M2VA 3JZJA 4U22A 4QSDA 2OWSA 1DTGA 1Y4CA 2F97A 2R9JA 1MQIA 1B51A 4OYVA 1EH3A 2Q2CA 4RXLA 4DE8A 2DWJA 1IZ1A 4UA8A 2D21A 2XXPA 3S9NC 2Z8DA 1QULA 4U4SA 4R73A 3FJGA 4OHNA 2Q9TA 1F9BA 3O6GA 3N6TA 4YKIA 3PUVE 4YB5A 5DEXB 5I2NB 4ESXA 1IXGA 4IO4A 3EHUA 1LFGA 5CI5A 5CMKA 1M5BA 3SDFA 1MRPA 4H8IA 4XKNA 3KG2A 3IOVA 3RT6B 2I0BA 3FUZA 3RY3A 4P0GA 3MBPA 4P0IA 4DXCA 1JW4A 2YLNA 4PFYA 1RKMA 3HHFA 1SYHA 3OSQA 1FQCA 5K2YA 3RT8A 2LAOA 5DVJA 3SEXA 2V3QA 1B32A 4RYAA 3O9PA 1YPNA 1PB8A 3MZ1A 5I59B 3THIA 5H8HB 3ONMA 1R6ZA 2XX8A 3QXMA 5ICTA 3B6TA 1XOCA 4IGTA 5TP9B 3IJOB 5EHSA 4KFQA 4FE8A 4ZEDA 2XXRA 3DP6A 2UXAA 3PPPA 4I9DA 1SD3A 2H25A 3V5AA 3V83A 3I5OA 3MPKA 5I57B 4G68C 4G4PA 4ZE9A 1NMUA 3SKPA 2XXXA 3JV9A 3RQTA 1GVCA 1FTMA 4Q30B 1II5A 1R9LA 1LB9A 1FQAA 1FCKA 2QS2A 3L6HA 3CFLA 5AE4A 2RKMA 2Y84A 3VDFA 1WVJA 3PV0E 4O3CA 2I58A 4QF9A 2M8CA 5FHMA 5FTIA 2A5TA 5TU0A 3L6GA 5J1DA 3Q26A 3KZGA 2HAUA 5FTHA 3PD9A 4IY6A 4KI0E 4YB7A 3N6UA 2XHDA 2RF1A 1NL5A 4X1BA 1IXIA 3DLNA 3OO8A 1B3HA 4ESWA 1NNFA 1B40A 2QS1A 1NH8A 3FGSA 3KGCA 4H0WA 1J1NA 4MBPA 4F1YA 3N26A 1HSJA 2XD2A 1A40A 2I6EA 4EQ7A 3FVGA 4KQPA 1B0HA 4R6HA 3KBRA 2F5XA 4G8HA 1LAFE 3FXUA 1I6QA 4XTCQ 4ZEBA 4AQ4A 4Z7EA 4OZ9A 3LUYA 4FORA 5TPAA 5CM6A 3ECRA 1LBBA 3RN8A 4X9TA 3LSLA 4BDNA 1XHYA 3C36A 2QS3A 2PYYA 2OK2A 1B3GA 2KLFA 1OMPA 4F3BA 2E0SA 5KCJB 3TTKA 4U21A 1P1QA 2H9BA 1FTKA 2PT2A 3TELA 3FV2A 4BDLA 2I4BA 4YKKA 2OBGA 2BJJX 4NF8B 2PX1A 5CC2A 1M5EA 3TKDA 3CSGA 3USDA 1N3XA 3I6VA 3TODA 3LR1A 3VLUA 4F3GA 2UVHA 1Y20A 3TMGA 1IUDA 4HS7A 1N7WA 1UIUA 4TLMB 1Q35A 4JWYA 1M5DA 4NE4A 1OIBA 3E13X 4OEVA 3JYRA 3U93A 3TCHA 4RNSA 3C34A 3UIFA 3K0VA 3VFJA 4LZ8A 3D4GA 3LC8A 1EZ9A 1M5FA 1IITA 2V93A 4M4GA 4ZZAA 3TCFA 3LSXA 1ZMGA 4KCDA 3E3KA 3RGYA 1Y3PA 1D9VA 1AH5A 1QJMA 3OO7A 1B7UA 2X7QA 3N94A 3G3KA 3O28A 4U23A 1XVYA 4LUBA 1MXVA 3D4CA 2YJPA 4F29A 1B3LA 2NOOA 2HXWA 1A7LA 3M3FA 5K2XA 4R9FA 2ESNA 2XXYA 3RTWB 4R75A 2VGQA 2W7YA 1I6BA 5HM4B 5BUUA 3AXFA 3CRBA 1SI1A 4ELRA 1BP5A 3IAZA 4O3BA 4LA9A 4NF5A 1JETA 2DXRA 2QPQA 4G2ZA 4XXUA 5HBCA 2DXYA 4U1OA 2I48A 3KFMA 1SW4A 1A8FA 3MQ9A 1DPEA 4OWDA 1MG1A 3TCGA 2DQVA 4ELPA 2A5TB 4OXVA 3KEIA 1B9JA 1HSLA 3KOSA 1JNFA 4PP0A 2YPNA 1CE2A 2F8DA 3TTNA 1NNPA 3S2VA 3VVEA 1OLAA 5DYHA 3C4MA 1LLSA 3BBRA 4FECA 3TEPA 4F3PA 1B5JA 4DIGA 4F1VA 1LB8A 3MZBA 2Z23A 5H8FA 1MY3A 5I58A 4F22A 4BDOA 2RINA 5AA4A 1HSEA 2F6PA 4GD5A 5ICQA 5IKBA 4PETA 3O6IA 3TTMA 3E4RA 1QUJA 3K2DA 1URGA 3H6TA 5TPAB 2Q89A 1OVBA 1MDP1 2HFBA 4YKPA 4N13A 2IEEA 5AA2D 2DP8A 4JB7A 1ZU0A 4RY1A 4F2QA 2NVUB 3PD8A 3VVFA 1Y1ZA 5L9SA 4KD5A 4O3AA 2DYXA 1ZJLA 2VP1A 4JSOA 2G93A 1LFIA 4G68A 3QUJA 3MZ9A 3G3FA 4DLDA 1A54A 1MY2A 2O7IA 1UTHA 3O66A 3F11A 2DWHA 3H06B 4K3FA 1O63A 3IR1A 2P2AA 4H67A 4H65A 2D3IA 1R1NA 5AA2A 3B6WA 2H4IA 2ZYOA 4NF6A 4LZ5A 3PUXE 1SQYA 4GIZA 1AOVA 1QUKA 1SW2A 4ZEFA 1PC3A 5DVFA 2H99A 3OOAA 4GRKA 1JVYA 4QFNA 2XXTA 3DELB 4R74A 4MLVA 3PPNA 1GTKA 2O84X 3KSXA 3DM0A 1NKXA 4YB6A 3TTLA 4XKQA 3T9XB 2X26A 2O51A 4I1DA 3U8QA 2Y7IA 3OO6A 3GBBA 1MPCA 1Z7ME 3P7IA 4TOZA 4F39A 4KHZE 3W15C 3UK4A 1JW5A 4OERA 2DVCA 3MAMA 1DSNA 4EUOA 4NF5B 1US5A 3H7MA 3PU5A 2XXHA 1XS5A 1LSTA 5JEIA 3FATA 4YICA 3MUQA 3GXAA 3MP8A 1YAEA 3ODBA 4JDFA 1NNTA 3SEYA 4LP2B 3OSRA 4KPTA 5FHOA 1SW1A 3M8UA 4BDQA 1XC1A 1LGBC 2DE2A 3KN7A 3SETA 3TFLA 3TYHA 3T9UA 1ANFA 4PE5B 4ELOA 4R2FA 1VSOA 3ZSFA 1H44A 3MVXA 5I56A 3PGFA 3U1OA 5H8FB 1USYE 5I58B 4OFLA 1Y3QA 1MPBA 4GWOA 4GL8A 5AA4B 1SVXB 1JQFA 1XVXA 2ZNUA 3T9VA 1IQ7A 2R71A 2Z8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IOT A;  3VLW A;  3HST A;  1MXZ A;  3T9H B;  3PPO A;  2PT1 A;  2F7C A;  1SDX A;  4QFO A;  3MP1 A;  2Q2A A;  5CBR A;  3UP9 A;  1VE4 A;  3DP8 A;  2F6G A;  3G3I A;  1ZKB A;  3K1M A;  2FA7 A;  5L9M A;  1JEV A;  1URD A;  1FTO A;  4QFL A;  4THI A;  3C32 A;  1SI0 A;  4G68 B;  3GLB A;  1YTV A;  1TFD A;  3IB0 A;  4RPO A;  4ECF A;  1US4 A;  4OQO A;  3TTR A;  2QMX A;  1MY4 A;  2Q88 A;  3IOR A;  3QYT A;  4H6D A;  3Q27 A;  1P1O A;  3QUF A;  1MS7 A;  4QSE A;  1MY1 A;  5FHN A;  3EHT A;  2HZL A;  4PQJ A;  1JEU A;  5LOM A;  3K6X A;  4OFJ A;  3C31 A;  4Q8R A;  5AA2 B;  2F36 A;  5ITO A;  3TQL A;  2GFE A;  2O7U A;  4NF6 B;  4G77 A;  1GGG A;  1EZP A;  1M5C A;  4BDM A;  3CIJ A;  2OLB A;  4EXK A;  5KZT A;  2HQ0 A;  3H4Z A;  4ONY A;  2V3T A;  1MPD A;  2F35 A;  4ZEC A;  3LBS A;  5JK4 A;  1B6H A;  4GQO A;  2Y7W A;  1MH4 A;  1VFD A;  4GF8 A;  3TZA A;  2ONR A;  1MQJ A;  2RC7 A;  5ISU A;  4KYE A;  3HO7 A;  3LSF B;  3R26 A;  4QSC A;  1FTJ A;  4OTE A;  4LAT A;  5KDT A;  4LQ5 A;  2E1S A;  3OEL A;  3PMW A;  3KOT A;  3GBA A;  3SEV A;  4R6K A;  2XXI A;  4BDR A;  2Z22 A;  3T66 A;  3FD3 A;  2RCB A;  1OVT A;  4JWO A;  1QVS A;  4YZZ A;  2H5Y A;  3OD7 A;  3IL1 B;  2ZYN A;  1FQB A;  1IIW A;  4YAH X;  2I3W A;  4DXU A;  4JBZ A;  2QL3 A;  2ANJ A;  4LQ2 A;  4ISU A;  4E0W A;  1UQW A;  3RLF E;  3FVO A;  4FAT A;  1L5T A;  3EPE A;  1MXY A;  4KR5 A;  1B7H A;  4OMB A;  5CMC A;  2DE3 A;  2AIX A;  3QAX A;  1T0K A;  2Q8J A;  5L8D A;  4MFI A;  2P0S A;  3V8X B;  4U2R A;  5I59 A;  5A5X A;  5H8H A;  4XKR A;  1BKA A;  1FQF A;  3KJ7 A;  2AL5 A;  3IK6 B;  2GHB A;  1TT1 A;  3VXC A;  1LBC A;  2I3V A;  3CI8 A;  5TP9 A;  3ILT B;  1B52 A;  5CRY A;  3K1P A;  3A3C A;  3BFT A;  4NWD A;  5I56 B;  2HCA A;  4FJP A;  4UAC A;  3RTF B;  5H8N A;  3KN3 A;  3FJ7 A;  4RPN A;  1R9Q A;  2XD3 A;  3BKI B;  1ZIU A;  1B46 A;  1A55 A;  1WOD A;  4X1D A;  4DCY A;  5DT6 A;  4DDD A;  1N7X A;  2I0C A;  2VD3 A;  2ZNS A;  2NWJ A;  5ITP A;  3HHG A;  1B3E A;  2V25 A;  1CB6 A;  4XIG Q;  1ZTY A;  3E9X A;  4ZEK A;  3S9L C;  2ZXT A;  5CMM A;  4G8M A;  1PEB A;  2OZZ A;  3TQW A;  2F7B A;  2D5W A;  2RC8 A;  3ZKK A;  5H8S A;  4FEB A;  3C35 A;  1FQE A;  3WAF A;  3K01 A;  1MY0 A;  1MM7 A;  5DVI A;  3VVD A;  1PDA A;  3FXR A;  5I2K A;  4YKJ A;  3I3V A;  1D4N A;  5B7D A;  3OEN A;  5CMB A;  2ALU A;  1B58 A;  1NNK A;  3FVK A;  4GXA A;  1PBP A;  4LZ7 A;  2F7A A;  2QJE A;  2XX9 A;  1URS A;  4C0R A;  1TWY A;  3EHS A;  3IOU A;  2NUV A;  1RYX A;  3IOW A;  3FV1 A;  2RC9 A;  1LCF A;  2ZMB A;  4IO7 A;  1IEJ A;  1GV8 A;  4F2O A;  3IJX B;  2VOZ A;  3MVY A;  4HCW A;  4QFK A;  4YMB A;  1MM6 A;  4MLQ A;  3MWB A;  1DMB A;  2O68 A;  4FIM A;  3PPR A;  3SES A;  1LAX A;  1SBP A;  3VV5 A;  4L17 A;  3FXQ A;  2HEU A;  1A99 A;  2O1M A;  2Y7P A;  4ZZE A;  5IAI A;  5KCJ A;  2REG A;  5H8Q A;  1P99 A;  2X7P A;  1O64 A;  3VE1 B;  2UVJ A;  3SER A;  5KDT B;  2I4C A;  1ZLQ A;  4NF8 A;  1Y4T A;  1OQH A;  2QSX A;  1Y3N A;  1P1N A;  1WDN A;  3TDJ A;  1RYO A;  1JW1 A;  1QKB A;  1TXF A;  4OVJ A;  4R6Y A;  1TFA A;  3PPQ A;  1FW0 A;  4WEP A;  1FQD A;  1QUI A;  2V84 A;  2DSF A;  3BFU A;  2AL4 A;  4EXL A;  2CMO A;  1PB7 A;  1BLF A;  1I6A A;  4ZDM A;  4U4X A;  1MXX A;  1S9T A;  3PUY E;  2QRY A;  3MW0 A;  3G7W A;  2OJT A;  1N0T A;  2V3U A;  4R9G A;  1S7Y A;  4HTG A;  1LAG E;  5F7V A;  3B6Q A;  3K6V A;  1B1X A;  4Q5T A;  2H98 A;  3H03 A;  3S4U A;  1N84 A;  1UIV A;  4DXB A;  3H6W A;  3ILU B;  4ZEI A;  5A5X B;  3OEK A;  1UTB A;  3H6U A;  4LON B;  1Z7N E;  2DS9 A;  1VFE A;  2DOJ A;  4Q0C A;  3MVZ A;  1AMF A;  1H76 A;  1MQH A;  1N76 A;  4XKP A;  1B7Z A;  1LAH E;  4TLL B;  2P1S A;  3CG1 A;  3HPI A;  1H3D A;  5H8N B;  1NH7 A;  4GL0 A;  3T93 B;  2B3B A;  4OES A;  3FZV A;  5L9O A;  3KJT A;  4FAJ A;  4MF3 A;  1ELJ A;  5AA1 A;  2VHA A;  3GZG A;  4KYD A;  3PUZ E;  4ELQ A;  3IB1 A;  3U94 A;  1EU8 A;  4POX A;  3HV1 A;  3QSL A;  3QIM A;  4JSD A;  4RK2 A;  4WXJ A;  2HAV A;  3A09 A;  2O6A A;  3A3U A;  1ATG A;  1IXC A;  1MH3 A;  1SW5 A;  2B65 A;  2PBW A;  2WKY A;  1B3F A;  4R2B A;  4AB6 A;  3OMB A;  4KCC A;  4NF4 A;  1A8E A;  3K4U A;  1NFT A;  2DWI A;  3FJM A;  4ZE8 A;  3R6U A;  3MJN A;  1N3W A;  5I2K B;  2FNC A;  1B05 A;  2RCA A;  4IY5 A;  4U1Z A;  3WAE A;  3VXB A;  3PUW E;  1GR2 A;  1B2H A;  3O2A A;  1H43 A;  5BWJ A;  1JVX A;  5I84 A;  2AYS A;  3RPW A;  4GXS B;  1DTZ A;  4PFU A;  4P11 A;  3B7D A;  4I8C A;  5DTB A;  1MQG A;  4GOT A;  1ZBM A;  1EZO A;  2G29 A;  3Q25 A;  3EN3 A;  1UTH B;  3K6W A;  3O97 A;  1D9Y A;  2O69 A;  2ZYM A;  4G8N A;  4LVQ A;  1OLC A;  4H1X A;  4EF2 A;  2Z8F A;  3FAS A;  4EQ9 A;  1PBQ A;  4WED A;  5H8Q B;  3SEU A;  3CR9 A;  2NXO A;  2OCU A;  1USY H;  2IA4 A;  1YCJ A;  3CG3 A;  2GH9 A;  4EQB A;  1MXU A;  1POT A;  4GVO A;  3IO4 A;  5JTY A;  3MPL A;  3O29 A;  2R6G E;  3VLV A;  1I69 A;  1B0L A;  4OFO A;  1BIY A;  2F78 A;  3CVG A;  1QW0 A;  1H45 A;  4IGR A;  2OWT A;  3TAJ A;  1OQG A;  1D3K A;  1AL3 A;  3FIR A;  2ABH A;  2FYI A;  3K02 A;  3OO9 A;  4C1U A;  1P1U A;  1IXH A;  5HPQ A;  3EQ1 A;  4IO2 A;  3M3L A;  2ONS A;  2QMW A;  3Q29 A;  2ZYK A;  4IO5 A;  3IB2 A;  3H3G A;  1LFH A;  3UN6 A;  2HZK A;  4DCX A;  5ELV A;  2ZNT A;  5DEX A;  1MXW A;  3UGW A;  5I2N A;  1B4Z A;  3H6V A;  5F1Q A;  3M3K A;  4R72 A;  2I49 A;  2A5S A;  3IX1 A;  2XXU A;  2GRV A;  3W9W A;  4N07 A;  3FVN A;  5B70 A;  4QRZ A;  2B3F A;  1AIV A;  3MVW A;  1UTB B;  3TPA A;  3S9E A;  3U72 A;  3V89 B;  3KSJ A;  4RK9 A;  4OEU A;  2DVZ A;  1DPP A;  3RNN A;  1B1H A;  3OEM A;  5AA3 A;  4F3S A;  4I62 A;  4TQU Q;  4OET A;  4WKM A;  2PVU A;  1VR5 A;  4NMY A;  4H8J A;  3LSW A;  4HW8 A;  3U92 A;  3RUM A;  3PMX A;  4H5G A;  2THI A;  1KWH A;  3IO6 A;  1Y1M A;  4EDP A;  3QK6 A;  3T22 A;  1B4H A;  2PMS A;  3N5L A;  2VD2 A;  2GHA A;  5I57 A;  3UOR A;  4GLI A;  4NED A;  2UYF A;  4BLA A;  1P1W A;  1LCT A;  5CBS A;  5EHM A;  4RA1 A;  1BTJ A;  4F31 B;  2XXV A;  4PFT A;  4NF4 B;  3SEW A;  4OEN A;  2XXW A;  3ZS6 A;  4ND9 A;  4IO6 A;  4PFW A;  4EF1 A;  1MDQ A;  3G3H A;  1SYI A;  4DZ1 A;  2Y7K A;  4N6P A;  4JXI A;  3MC2 A;  4QFP A;  3C33 A;  2QS4 A;  3CSB A;  1N04 A;  3CFX A;  3OXN A;  4JWX A;  1DOT A;  2UVG A;  3W9V A;  2DE4 A;  4KYS A;  3TUS A;  1QKA A;  4FED A;  4IO3 A;  4F18 A;  2Y7R A;  3HCQ A;  2CZL A;  2O1L A;  3T96 B;  4YMA A;  2ONK E;  4M1V A;  4YU0 A;  3ZKL A;  3KN8 A;  3K1N A;  3S9M C;  3HN0 A;  4IB2 A;  4E0X A;  3K00 A;  4C1T A;  4RJZ A;  4QHQ A;  3C9H A;  1S50 A;  4AB5 A;  4X48 A;  4GFR A;  1B5I A;  1POY 1;  3EF7 A;  3O6H A;  2DWA A;  5EYF A;  3PMV A;  2F34 A;  1MQD A;  4F1U A;  4F19 A;  2XXQ A;  2UVI A;  1B5H A;  1O7T A;  3MP6 A;  4NWC A;  3CFZ A;  1FTL A;  3R7X A;  3Q28 A;  2XX7 A;  4Z0I A;  1Q1K A;  1Y9U A;  1PB9 A;  2UYE A;  3K6U A;  4ZS9 A;  5JTY B;  3DP4 A;  1XT8 A;  4POW A;  4NTL A;  3G3J A;  3G3G A;  3UA8 A;  4HCY A;  4MH5 A;  4H5F A;  2REJ A;  5M2V A;  3JZJ A;  4U22 A;  4QSD A;  2OWS A;  1DTG A;  1Y4C A;  2F97 A;  2R9J A;  1MQI A;  1B51 A;  4OYV A;  1EH3 A;  2Q2C A;  4RXL A;  4DE8 A;  2DWJ A;  1IZ1 A;  4UA8 A;  2D21 A;  2XXP A;  3S9N C;  2Z8D A;  1QUL A;  4U4S A;  4R73 A;  3FJG A;  4OHN A;  2Q9T A;  1F9B A;  3O6G A;  3N6T A;  4YKI A;  3PUV E;  4YB5 A;  5DEX B;  5I2N B;  4ESX A;  1IXG A;  4IO4 A;  3EHU A;  1LFG A;  5CI5 A;  5CMK A;  1M5B A;  3SDF A;  1MRP A;  4H8I A;  4XKN A;  3KG2 A;  3IOV A;  3RT6 B;  2I0B A;  3FUZ A;  3RY3 A;  4P0G A;  3MBP A;  4P0I A;  4DXC A;  1JW4 A;  2YLN A;  4PFY A;  1RKM A;  3HHF A;  1SYH A;  3OSQ A;  1FQC A;  5K2Y A;  3RT8 A;  2LAO A;  5DVJ A;  3SEX A;  2V3Q A;  1B32 A;  4RYA A;  3O9P A;  1YPN A;  1PB8 A;  3MZ1 A;  5I59 B;  3THI A;  5H8H B;  3ONM A;  1R6Z A;  2XX8 A;  3QXM A;  5ICT A;  3B6T A;  1XOC A;  4IGT A;  5TP9 B;  3IJO B;  5EHS A;  4KFQ A;  4FE8 A;  4ZED A;  2XXR A;  3DP6 A;  2UXA A;  3PPP A;  4I9D A;  1SD3 A;  2H25 A;  3V5A A;  3V83 A;  3I5O A;  3MPK A;  5I57 B;  4G68 C;  4G4P A;  4ZE9 A;  1NMU A;  3SKP A;  2XXX A;  3JV9 A;  3RQT A;  1GVC A;  1FTM A;  4Q30 B;  1II5 A;  1R9L A;  1LB9 A;  1FQA A;  1FCK A;  2QS2 A;  3L6H A;  3CFL A;  5AE4 A;  2RKM A;  2Y84 A;  3VDF A;  1WVJ A;  3PV0 E;  4O3C A;  2I58 A;  4QF9 A;  2M8C A;  5FHM A;  5FTI A;  2A5T A;  5TU0 A;  3L6G A;  5J1D A;  3Q26 A;  3KZG A;  2HAU A;  5FTH A;  3PD9 A;  4IY6 A;  4KI0 E;  4YB7 A;  3N6U A;  2XHD A;  2RF1 A;  1NL5 A;  4X1B A;  1IXI A;  3DLN A;  3OO8 A;  1B3H A;  4ESW A;  1NNF A;  1B40 A;  2QS1 A;  1NH8 A;  3FGS A;  3KGC A;  4H0W A;  1J1N A;  4MBP A;  4F1Y A;  3N26 A;  1HSJ A;  2XD2 A;  1A40 A;  2I6E A;  4EQ7 A;  3FVG A;  4KQP A;  1B0H A;  4R6H A;  3KBR A;  2F5X A;  4G8H A;  1LAF E;  3FXU A;  1I6Q A;  4XTC Q;  4ZEB A;  4AQ4 A;  4Z7E A;  4OZ9 A;  3LUY A;  4FOR A;  5TPA A;  5CM6 A;  3ECR A;  1LBB A;  3RN8 A;  4X9T A;  3LSL A;  4BDN A;  1XHY A;  3C36 A;  2QS3 A;  2PYY A;  2OK2 A;  1B3G A;  2KLF A;  1OMP A;  4F3B A;  2E0S A;  5KCJ B;  3TTK A;  4U21 A;  1P1Q A;  2H9B A;  1FTK A;  2PT2 A;  3TEL A;  3FV2 A;  4BDL A;  2I4B A;  4YKK A;  2OBG A;  2BJJ X;  4NF8 B;  2PX1 A;  5CC2 A;  1M5E A;  3TKD A;  3CSG A;  3USD A;  1N3X A;  3I6V A;  3TOD A;  3LR1 A;  3VLU A;  4F3G A;  2UVH A;  1Y20 A;  3TMG A;  1IUD A;  4HS7 A;  1N7W A;  1UIU A;  4TLM B;  1Q35 A;  4JWY A;  1M5D A;  4NE4 A;  1OIB A;  3E13 X;  4OEV A;  3JYR A;  3U93 A;  3TCH A;  4RNS A;  3C34 A;  3UIF A;  3K0V A;  3VFJ A;  4LZ8 A;  3D4G A;  3LC8 A;  1EZ9 A;  1M5F A;  1IIT A;  2V93 A;  4M4G A;  4ZZA A;  3TCF A;  3LSX A;  1ZMG A;  4KCD A;  3E3K A;  3RGY A;  1Y3P A;  1D9V A;  1AH5 A;  1QJM A;  3OO7 A;  1B7U A;  2X7Q A;  3N94 A;  3G3K A;  3O28 A;  4U23 A;  1XVY A;  4LUB A;  1MXV A;  3D4C A;  2YJP A;  4F29 A;  1B3L A;  2NOO A;  2HXW A;  1A7L A;  3M3F A;  5K2X A;  4R9F A;  2ESN A;  2XXY A;  3RTW B;  4R75 A;  2VGQ A;  2W7Y A;  1I6B A;  5HM4 B;  5BUU A;  3AXF A;  3CRB A;  1SI1 A;  4ELR A;  1BP5 A;  3IAZ A;  4O3B A;  4LA9 A;  4NF5 A;  1JET A;  2DXR A;  2QPQ A;  4G2Z A;  4XXU A;  5HBC A;  2DXY A;  4U1O A;  2I48 A;  3KFM A;  1SW4 A;  1A8F A;  3MQ9 A;  1DPE A;  4OWD A;  1MG1 A;  3TCG A;  2DQV A;  4ELP A;  2A5T B;  4OXV A;  3KEI A;  1B9J A;  1HSL A;  3KOS A;  1JNF A;  4PP0 A;  2YPN A;  1CE2 A;  2F8D A;  3TTN A;  1NNP A;  3S2V A;  3VVE A;  1OLA A;  5DYH A;  3C4M A;  1LLS A;  3BBR A;  4FEC A;  3TEP A;  4F3P A;  1B5J A;  4DIG A;  4F1V A;  1LB8 A;  3MZB A;  2Z23 A;  5H8F A;  1MY3 A;  5I58 A;  4F22 A;  4BDO A;  2RIN A;  5AA4 A;  1HSE A;  2F6P A;  4GD5 A;  5ICQ A;  5IKB A;  4PET A;  3O6I A;  3TTM A;  3E4R A;  1QUJ A;  3K2D A;  1URG A;  3H6T A;  5TPA B;  2Q89 A;  1OVB A;  1MDP 1;  2HFB A;  4YKP A;  4N13 A;  2IEE A;  5AA2 D;  2DP8 A;  4JB7 A;  1ZU0 A;  4RY1 A;  4F2Q A;  2NVU B;  3PD8 A;  3VVF A;  1Y1Z A;  5L9S A;  4KD5 A;  4O3A A;  2DYX A;  1ZJL A;  2VP1 A;  4JSO A;  2G93 A;  1LFI A;  4G68 A;  3QUJ A;  3MZ9 A;  3G3F A;  4DLD A;  1A54 A;  1MY2 A;  2O7I A;  1UTH A;  3O66 A;  3F11 A;  2DWH A;  3H06 B;  4K3F A;  1O63 A;  3IR1 A;  2P2A A;  4H67 A;  4H65 A;  2D3I A;  1R1N A;  5AA2 A;  3B6W A;  2H4I A;  2ZYO A;  4NF6 A;  4LZ5 A;  3PUX E;  1SQY A;  4GIZ A;  1AOV A;  1QUK A;  1SW2 A;  4ZEF A;  1PC3 A;  5DVF A;  2H99 A;  3OOA A;  4GRK A;  1JVY A;  4QFN A;  2XXT A;  3DEL B;  4R74 A;  4MLV A;  3PPN A;  1GTK A;  2O84 X;  3KSX A;  3DM0 A;  1NKX A;  4YB6 A;  3TTL A;  4XKQ A;  3T9X B;  2X26 A;  2O51 A;  4I1D A;  3U8Q A;  2Y7I A;  3OO6 A;  3GBB A;  1MPC A;  1Z7M E;  3P7I A;  4TOZ A;  4F39 A;  4KHZ E;  3W15 C;  3UK4 A;  1JW5 A;  4OER A;  2DVC A;  3MAM A;  1DSN A;  4EUO A;  4NF5 B;  1US5 A;  3H7M A;  3PU5 A;  2XXH A;  1XS5 A;  1LST A;  5JEI A;  3FAT A;  4YIC A;  3MUQ A;  3GXA A;  3MP8 A;  1YAE A;  3ODB A;  4JDF A;  1NNT A;  3SEY A;  4LP2 B;  3OSR A;  4KPT A;  5FHO A;  1SW1 A;  3M8U A;  4BDQ A;  1XC1 A;  1LGB C;  2DE2 A;  3KN7 A;  3SET A;  3TFL A;  3TYH A;  3T9U A;  1ANF A;  4PE5 B;  4ELO A;  4R2F A;  1VSO A;  3ZSF A;  1H44 A;  3MVX A;  5I56 A;  3PGF A;  3U1O A;  5H8F B;  1USY E;  5I58 B;  4OFL A;  1Y3Q A;  1MPB A;  4GWO A;  4GL8 A;  5AA4 B;  1SVX B;  1JQF A;  1XVX A;  2ZNU A;  3T9V A;  1IQ7 A;  2R71 A;  2Z8E A; 
#chains in the Genus database with same CATH topology
 3IOT A;  3VLW A;  3HST A;  1MXZ A;  3T9H B;  4GWU A;  3PPO A;  2PT1 A;  2F7C A;  1SDX A;  4X8R A;  4QFO A;  4O7M A;  3MP1 A;  2Q2A A;  5CBR A;  3UP9 A;  2XA5 A;  1VE4 A;  1YZ0 A;  3D1R A;  3DP8 A;  2MKZ A;  2F6G A;  3G3I A;  1ZKB A;  3K1M A;  2FA7 A;  5L9M A;  1JEV A;  1URD A;  1FTO A;  4QFL A;  4THI A;  3C32 A;  1SI0 A;  4G68 B;  3GLB A;  1YTV A;  1TFD A;  3IB0 A;  4RPO A;  4ECF A;  1US4 A;  4OQO A;  1IMB A;  3TTR A;  2QMX A;  1MY4 A;  2Q88 A;  3IOR A;  3QYT A;  4H6D A;  3Q27 A;  1P1O A;  1FPJ A;  3QUF A;  1MS7 A;  4QSE A;  4OVT A;  1MY1 A;  5FHN A;  3EHT A;  2HZL A;  4PQJ A;  1JEU A;  5LOM A;  3K6X A;  4OFJ A;  4MCO A;  3C31 A;  4Q8R A;  5AA2 B;  2F36 A;  5ITO A;  3TQL A;  2GFE A;  4I40 A;  2O7U A;  4NF6 B;  4G77 A;  1GGG A;  1EZP A;  1M5C A;  3SZP A;  4BDM A;  3CIJ A;  2OLB A;  2WX9 A;  4EXK A;  5KZT A;  2HQ0 A;  3H4Z A;  4ONY A;  2V3T A;  1MPD A;  2F35 A;  4ZEC A;  3LBS A;  5JK4 A;  1B6H A;  4GQO A;  2ZZV A;  2CZH A;  2Y7W A;  1MH4 A;  1VFD A;  2WEF A;  4GWX A;  4GF8 A;  3TZA A;  2ONR A;  1MQJ A;  2RC7 A;  5ISU A;  4KYE A;  3HO7 A;  3LSF B;  3R26 A;  4QSC A;  1FTJ A;  4OTE A;  4LAT A;  5KDT A;  4LQ5 A;  2E1S A;  3OEL A;  3PMW A;  4OVQ A;  3ISP A;  3KOT A;  3GBA A;  4MJO A;  3SEV A;  1KA0 A;  3E79 A;  4R6K A;  2XWK A;  2XXI A;  4BDR A;  2Z22 A;  5ET5 A;  3T66 A;  3FD3 A;  2RCB A;  1OVT A;  4PGP A;  4JWO A;  1QVS A;  4YZZ A;  2H5Y A;  3OD7 A;  3IL1 B;  2ZYN A;  1FQB A;  2QFL A;  1IIW A;  4YAH X;  2I3W A;  5EYG A;  4DXU A;  4JBZ A;  2QL3 A;  2ANJ A;  4LQ2 A;  4HE1 A;  4ISU A;  4E0W A;  1UQW A;  3RLF E;  3FVO A;  4FAT A;  1L5T A;  3EPE A;  1MXY A;  3RPL B;  4KR5 A;  1B7H A;  4OMB A;  5CMC A;  2DE3 A;  2AIX A;  3QAX A;  2CEX A;  1T0K A;  2Q8J A;  5L8D A;  4MFI A;  2P0S A;  3V8X B;  4U2R A;  5I59 A;  5A5X A;  5H8H A;  4XKR A;  1BKA A;  1FQF A;  3KJ7 A;  2AL5 A;  3IK6 B;  2GHB A;  1TT1 A;  1LBC A;  2I3V A;  3VXC A;  3CI8 A;  5TP9 A;  3ILT B;  1B52 A;  5T3J A;  5CRY A;  2PFY A;  4NN3 A;  3K1P A;  4XEQ A;  3A3C A;  3BFT A;  4NWD A;  5I56 B;  2XWO A;  2HCA A;  4FJP A;  4UAC A;  3RTF B;  5H8N A;  3KN3 A;  3FJ7 A;  4NG7 A;  4RPN A;  1R9Q A;  2XD3 A;  3BKI B;  1ZIU A;  1B46 A;  1A55 A;  4N6D A;  1WOD A;  4PFI A;  4X1D A;  4DCY A;  2L5V A;  5DT6 A;  4DDD A;  1N7X A;  2I0C A;  2VD3 A;  1LBV A;  2ZNS A;  2NWJ A;  5ITP A;  3HHG A;  1B3E A;  2V25 A;  3KBZ A;  1CB6 A;  4XIG Q;  1ZTY A;  4MNC A;  3E9X A;  4ZEK A;  3S9L C;  1DK4 A;  2ZXT A;  5CMM A;  4G8M A;  1PEB A;  1SPI A;  1G0I A;  2OZZ A;  3E78 A;  3TQW A;  2F7B A;  4QBA A;  2D5W A;  2RC8 A;  3ZKK A;  5H8S A;  3FXB A;  2PFZ A;  4FEB A;  1NV5 A;  3C35 A;  1FQE A;  2B4M A;  3WAF A;  1NV2 A;  3K01 A;  1MY0 A;  1MM7 A;  5DVI A;  3VVD A;  4OA4 A;  2QVU A;  4PBQ A;  1PDA A;  3FXR A;  5I2K A;  4YKJ A;  3I3V A;  1D4N A;  5B7D A;  3OEN A;  5CMB A;  2ALU A;  1B58 A;  1NNK A;  5IZZ A;  3FVK A;  4GXA A;  1PBP A;  4LZ7 A;  4O7I A;  2F7A A;  2QJE A;  2XX9 A;  1URS A;  4C0R A;  1TWY A;  3EHS A;  3IOU A;  3QMF A;  2NUV A;  1RYX A;  4DI3 D;  3IOW A;  3FV1 A;  2RC9 A;  5DW8 A;  1LCF A;  2ZMB A;  4IO7 A;  1IEJ A;  1GV8 A;  4F2O A;  3IJX B;  2VOZ A;  3MVY A;  4HCW A;  4QFK A;  4YMB A;  4N8Y A;  1MM6 A;  4MLQ A;  3MWB A;  1DMB A;  4PE3 A;  4MNP A;  3B8B A;  2O68 A;  1FBE A;  4FIM A;  3PPR A;  3SES A;  1LAX A;  1SBP A;  2WBD A;  1FRP A;  3VV5 A;  4L17 A;  5EQ9 A;  3FXQ A;  2HEU A;  2QVR A;  1A99 A;  2O1M A;  2Y7P A;  4ZZE A;  5IAI A;  5KCJ A;  2REG A;  5H8Q A;  1P99 A;  2X7P A;  1O64 A;  3VE1 B;  2UVJ A;  3SER A;  5KDT B;  1NV0 A;  2I4C A;  1ZLQ A;  1IME A;  1Y4T A;  1OQH A;  4NF8 A;  4NX1 A;  2QSX A;  1Y3N A;  2Y5K A;  1FPK A;  1P1N A;  4N15 A;  4PTK A;  1WDN A;  3TDJ A;  5IZ3 B;  1RYO A;  1JW1 A;  1QKB A;  1TXF A;  4OVJ A;  4R6Y A;  1TFA A;  3PPQ A;  1FW0 A;  4WEP A;  1FQD A;  1QUI A;  2V84 A;  1FBF A;  2DSF A;  4GWY A;  5EQA A;  3BFU A;  2AL4 A;  4EXL A;  2CMO A;  4P8B A;  1PB7 A;  4PDH A;  1BLF A;  1I6A A;  4ZDM A;  4U4X A;  1MXX A;  1S9T A;  3PUY E;  2QRY A;  5ESY A;  3MW0 A;  3G7W A;  2OJT A;  4GBV A;  1FPL A;  1N0T A;  2V3U A;  4R9G A;  1S7Y A;  4HTG A;  1LAG E;  5F7V A;  3B6Q A;  3K6V A;  1B1X A;  4N17 A;  4PDD A;  2H98 A;  4Q5T A;  4IR8 A;  3H03 A;  3S4U A;  1N84 A;  1UIV A;  2FVZ A;  4DXB A;  3H6W A;  3ILU B;  4ZEI A;  5A5X B;  3OEK A;  1UTB A;  4PF6 A;  3H6U A;  4LON B;  1Z7N E;  2DS9 A;  1VFE A;  3B50 A;  5ET6 A;  2DOJ A;  4Q0C A;  5IM2 A;  3MVZ A;  1AMF A;  1H76 A;  1MQH A;  1N76 A;  4XKP A;  1B7Z A;  4I3E A;  1LAH E;  4TLL B;  2P1S A;  3CG1 A;  2B4L A;  3HPI A;  1H3D A;  5H8N B;  1NH7 A;  4GL0 A;  4GWS A;  3T93 B;  2B3B A;  4OES A;  3FZV A;  5L9O A;  4GX6 A;  3KJT A;  4FAJ A;  4MF3 A;  1ELJ A;  5AA1 A;  2VHA A;  3GZG A;  4KYD A;  3PUZ E;  1IMD A;  2HXR A;  4ELQ A;  3IB1 A;  3U94 A;  1EU8 A;  3ROJ A;  2FIE A;  4POX A;  3HV1 A;  3QSL A;  3QIM A;  2P3N A;  4JSD A;  4RK2 A;  4WXJ A;  2HAV A;  3A09 A;  2O6A A;  3A3U A;  1FPB A;  1IMC A;  1ATG A;  4UAB A;  1IXC A;  1MH3 A;  1SW5 A;  2B65 A;  4PAF A;  2PBW A;  2WKY A;  1B3F A;  4R2B A;  4AB6 A;  3OMB A;  4KCC A;  4NF4 A;  1A8E A;  3K4U A;  1NFT A;  2DWI A;  3FJM A;  4ZE8 A;  3R6U A;  1FSA A;  3MJN A;  1N3W A;  4PBH A;  5I2K B;  2HPG A;  2FNC A;  1B05 A;  2RCA A;  4IY5 A;  4U1Z A;  3WAE A;  3VXB A;  3PUW E;  1GR2 A;  1B2H A;  3O2A A;  1H43 A;  5BWJ A;  1JVX A;  5I84 A;  2AYS A;  3RPW A;  2FBP A;  4GXS B;  1DTZ A;  2FIX A;  4PFU A;  4P11 A;  4G61 A;  4GBW A;  3B7D A;  1RDZ A;  2CEY A;  1FTA A;  4I8C A;  5EYH A;  5DTB A;  1MQG A;  4GOT A;  1ZBM A;  1EZO A;  2G29 A;  3Q25 A;  3EN3 A;  3U65 A;  1UTH B;  3K6W A;  2R8T A;  3O97 A;  1D9Y A;  2OX3 A;  2O69 A;  2ZYM A;  4G8N A;  4LVQ A;  1OLC A;  4H1X A;  4EF2 A;  4I3Y A;  4X04 A;  1AWB A;  4P47 A;  2Z8F A;  3FAS A;  1NV6 A;  4EQ9 A;  4AS5 A;  1PBQ A;  4WED A;  5H8Q B;  3SEU A;  3CR9 A;  2NXO A;  2OCU A;  4NHB A;  1USY H;  2IA4 A;  1YCJ A;  3CG3 A;  5ET8 A;  2GH9 A;  4EQB A;  3HFU A;  1MXU A;  1POT A;  4GVO A;  3IO4 A;  5JTY A;  2GQ1 A;  3MPL A;  3O29 A;  4N81 A;  2R6G E;  3KC1 A;  3VLV A;  1I69 A;  1B0L A;  4OFO A;  1BIY A;  2F78 A;  1KA1 A;  3CVG A;  1QW0 A;  1H45 A;  4IGR A;  2OWT A;  3TAJ A;  1OQG A;  1D3K A;  1AL3 A;  3FIR A;  2ABH A;  2FYI A;  3K02 A;  3OO9 A;  4C1U A;  1P1U A;  2JJK A;  1IXH A;  5HPQ A;  3EQ1 A;  2F3D A;  4IO2 A;  4P1E A;  3M3L A;  2ONS A;  2QMW A;  3Q29 A;  2ZYK A;  4IO5 A;  3IB2 A;  3H3G A;  1LFH A;  3UN6 A;  3MST A;  2HZK A;  4DCX A;  5ELV A;  2ZNT A;  4XF5 A;  1NI9 A;  5DEX A;  1MXW A;  3UGW A;  5I2N A;  1B4Z A;  2CZI A;  4GX4 A;  3H6V A;  5F1Q A;  3M3K A;  4R72 A;  2I49 A;  1EYK A;  2A5S A;  3IX1 A;  2XXU A;  2GRV A;  3W9W A;  4N07 A;  3FVN A;  5B70 A;  4QRZ A;  2B3F A;  1AIV A;  4P3L A;  3MVW A;  1UTB B;  3TPA A;  3S9E A;  3U72 A;  3V89 B;  3KSJ A;  2PCR A;  3EKI A;  1LBY A;  4RK9 A;  4OEU A;  2DVZ A;  1DPP A;  1NV3 A;  2Q8M A;  3RNN A;  1B1H A;  3OEM A;  5AA3 A;  4GWW A;  4F3S A;  4I62 A;  4P9K A;  4TQU Q;  4OET A;  1DBZ A;  4MX6 A;  4WKM A;  2PVU A;  1VR5 A;  4NMY A;  3IFA A;  4H8J A;  3LSW A;  3T0J A;  4HW8 A;  3U92 A;  3RUM A;  2VPO A;  3PMX A;  4H5G A;  2THI A;  1KWH A;  3IO6 A;  1Y1M A;  3FBP A;  4EDP A;  5J16 A;  3QK6 A;  4NQ8 A;  3T22 A;  1B4H A;  2PMS A;  3N5L A;  2VD2 A;  2GHA A;  1FPG A;  5I57 A;  3UOR A;  4GLI A;  4NED A;  2UYF A;  4BLA A;  1P1W A;  1LCT A;  5CBS A;  5EHM A;  4RA1 A;  3PTY A;  1BTJ A;  4F31 B;  2XXV A;  4PFT A;  4NF4 B;  3SEW A;  4OEN A;  4FBP A;  2XXW A;  3ZS6 A;  1DCU A;  1RDX A;  4ND9 A;  4IO6 A;  4PFW A;  4EF1 A;  1MDQ A;  3G3H A;  1SYI A;  4DZ1 A;  2Y7K A;  4N6P A;  4JXI A;  3MC2 A;  4QFP A;  4DI4 B;  3C33 A;  2QS4 A;  3CSB A;  1K9Z A;  1N04 A;  3CFX A;  3OXN A;  4JWX A;  1DOT A;  2UVG A;  3W9V A;  2DE4 A;  1FPD A;  1JP4 A;  4KYS A;  3TUS A;  1QKA A;  4FED A;  4IO3 A;  4F18 A;  2Y7R A;  3HCQ A;  2CZL A;  2O1L A;  3T96 B;  4YMA A;  2ONK E;  2V4C A;  4M1V A;  4YU0 A;  3ZKL A;  3KN8 A;  3K1N A;  4GWZ A;  4PCD A;  3S9M C;  3HN0 A;  4IB2 A;  4E0X A;  3K00 A;  4C1T A;  4RJZ A;  4QHQ A;  3C9H A;  1S50 A;  4AB5 A;  4X48 A;  4GFR A;  2VPN A;  1B5I A;  1POY 1;  3EF7 A;  3O6H A;  2Y5L A;  2DWA A;  5EYF A;  1YYZ A;  3PMV A;  2F34 A;  1MQD A;  4F1U A;  4F19 A;  2XXQ A;  2UVI A;  2ZZW A;  1B5H A;  1O7T A;  1LEV A;  3MP6 A;  4NWC A;  3CFZ A;  1FTL A;  3R7X A;  3Q28 A;  2XX7 A;  4Z0I A;  1Q1K A;  1Y9U A;  1PB9 A;  2UYE A;  3K6U A;  4ZS9 A;  5JTY B;  3DP4 A;  1XT8 A;  4POW A;  4NTL A;  4KXP A;  2WYP A;  3G3J A;  1INP A;  3G3G A;  5EQ8 A;  3UA8 A;  4HCY A;  4MH5 A;  4H5F A;  2REJ A;  5M2V A;  3JZJ A;  4U22 A;  4QSD A;  2OWS A;  4N6K A;  1DTG A;  1Y4C A;  2F97 A;  2R9J A;  1MQI A;  4JVD A;  1B51 A;  1LBW A;  4OYV A;  1EH3 A;  3BIG A;  2Q2C A;  4RXL A;  4DE8 A;  2DWJ A;  1IZ1 A;  4UA8 A;  2D21 A;  2XXP A;  3S9N C;  2Z8D A;  1KZ8 A;  4PGN A;  1QUL A;  4U4S A;  4R73 A;  3FJG A;  4OHN A;  2Q9T A;  1LBZ A;  1F9B A;  3O6G A;  3N6T A;  4YKI A;  3PUV E;  4YB5 A;  5DEX B;  5I2N B;  4ESX A;  1IXG A;  4IO4 A;  3EHU A;  1LFG A;  5CI5 A;  5CMK A;  1NV4 A;  4GX3 A;  1M5B A;  4MEV A;  3SDF A;  1K9Y A;  1MRP A;  4H8I A;  4XKN A;  3KG2 A;  2WBB A;  3IOV A;  2WYK A;  3RT6 B;  3IFC A;  2I0B A;  3CHG A;  3FUZ A;  3RY3 A;  2VT5 A;  3GYY A;  4P0G A;  3MBP A;  4P0I A;  4DXC A;  2CZK A;  1JW4 A;  2YLN A;  4PFY A;  1RKM A;  3HHF A;  1SYH A;  3OSQ A;  1FQC A;  5K2Y A;  3RT8 A;  2LAO A;  5DVJ A;  3SEX A;  2V3Q A;  1B32 A;  4HXV A;  4RYA A;  3O9P A;  4N8G A;  1YPN A;  1PB8 A;  1IMA A;  3MZ1 A;  5I59 B;  3THI A;  5H8H B;  3ONM A;  1R6Z A;  2XX8 A;  3QXM A;  5ICT A;  3B6T A;  1XOC A;  4IGT A;  4JVI A;  5TP9 B;  3IJO B;  4MIJ A;  5EHS A;  4KFQ A;  4P56 A;  4FE8 A;  4ZED A;  2XXR A;  4N91 A;  3DP6 A;  4P1L A;  2UXA A;  3PPP A;  1QGX A;  4I9D A;  1SD3 A;  3RYD A;  2H25 A;  3V5A A;  5LDZ A;  3V83 A;  3I5O A;  3MPK A;  5I57 B;  2Q74 A;  4G68 C;  4G4P A;  4ZE9 A;  1NMU A;  3SKP A;  1FBC A;  2XXX A;  2HHM A;  3JV9 A;  3RQT A;  1GVC A;  1FTM A;  4Q30 B;  1II5 A;  1R9L A;  1LB9 A;  1FQA A;  5A5L A;  2DDK A;  1FCK A;  2QS2 A;  3L6H A;  3CFL A;  2RKM A;  2Y84 A;  5AE4 A;  3VDF A;  1WVJ A;  3PV0 E;  4HE2 A;  4O3C A;  1XI6 A;  4H46 A;  2I58 A;  4QF9 A;  2M8C A;  5FHM A;  5FTI A;  2A5T A;  5TU0 A;  3L6G A;  5J1D A;  3Q26 A;  3KZG A;  2HAU A;  5FTH A;  3PD9 A;  4IY6 A;  4KI0 E;  4LN5 A;  4YB7 A;  3N6U A;  4NAP A;  2XHD A;  1NUY A;  4PFB A;  2RF1 A;  1NL5 A;  4X1B A;  1IXI A;  3DLN A;  3OO8 A;  1B3H A;  4ESW A;  1NNF A;  1B40 A;  2QS1 A;  1NH8 A;  3FGS A;  3KGC A;  4H0W A;  2OWZ A;  1J1N A;  4MBP A;  4F1Y A;  3N26 A;  1HSJ A;  2XD2 A;  1A40 A;  2I6E A;  4EQ7 A;  1FPE A;  3FVG A;  4KQP A;  1B0H A;  4R6H A;  3KBR A;  2F5X A;  5EQ7 A;  4G8H A;  1LAF E;  3FXU A;  3BIH A;  1I6Q A;  4XTC Q;  4ZEB A;  4AQ4 A;  4Z7E A;  1YXI A;  1CNQ A;  4OZ9 A;  3LUY A;  1EYI A;  4FOR A;  5TPA A;  5CM6 A;  3ECR A;  1LBB A;  3RN8 A;  4X9T A;  3LSL A;  4BDN A;  3KC0 A;  1XHY A;  3C36 A;  2QS3 A;  2PYY A;  1NUZ A;  2OK2 A;  1B3G A;  2KLF A;  4JVC A;  1OMP A;  4F3B A;  2E0S A;  5KCJ B;  3LUZ A;  3TTK A;  4U21 A;  1P1Q A;  2H9B A;  1FTK A;  2XWV A;  2PT2 A;  1Q9D A;  3TEL A;  3FV2 A;  4BDL A;  4O8M A;  2I4B A;  4YKK A;  2OBG A;  2BJJ X;  4NF8 B;  2PX1 A;  5CC2 A;  1M5E A;  3TKD A;  3CSG A;  3USD A;  1N3X A;  2KR0 A;  3I6V A;  3TOD A;  3LR1 A;  3VLU A;  4F3G A;  2UVH A;  1Y20 A;  3TMG A;  1IUD A;  4HS7 A;  1N7W A;  1UIU A;  4TLM B;  1IMF A;  1Q35 A;  4JWY A;  1M5D A;  1D9Q A;  5FBP A;  4NE4 A;  1OIB A;  3E13 X;  4OEV A;  3JYR A;  3U93 A;  3TCH A;  4RNS A;  3C34 A;  3A29 A;  3UIF A;  1NV1 A;  3K0V A;  3VFJ A;  4LZ8 A;  3D4G A;  3LC8 A;  1EZ9 A;  1M5F A;  1IIT A;  1FBG A;  2V93 A;  4M4G A;  4ZZA A;  3TCF A;  3LSX A;  1ZMG A;  4PAI A;  4KCD A;  3E3K A;  5IZ3 A;  3RGY A;  1Y3P A;  1D9V A;  1EYJ A;  1AH5 A;  1QJM A;  3OO7 A;  1B7U A;  2X7Q A;  3N94 A;  4PF8 A;  3G3K A;  3O28 A;  1NV7 A;  4U23 A;  1XVY A;  4MHF A;  4LUB A;  1MXV A;  3D4C A;  2YJP A;  4F29 A;  1B3L A;  2NOO A;  2HXW A;  1A7L A;  4PC9 A;  3M3F A;  5K2X A;  4R9F A;  2ESN A;  2XXY A;  3RTW B;  4R75 A;  2VGQ A;  2W7Y A;  1I6B A;  5HM4 B;  5BUU A;  3AXF A;  3CRB A;  1SI1 A;  4ELR A;  1BP5 A;  3IAZ A;  4O3B A;  4LA9 A;  4NF5 A;  1JET A;  2DXR A;  2QPQ A;  4G2Z A;  4XXU A;  4HE0 A;  2DXY A;  5HBC A;  4U1O A;  2I48 A;  3KFM A;  1SW4 A;  1NUX A;  1A8F A;  3MQ9 A;  1DPE A;  4OWD A;  2FHY A;  1MG1 A;  3TCG A;  2DQV A;  4ELP A;  2A5T B;  4OXV A;  3KEI A;  1B9J A;  1HSL A;  3KOS A;  1JNF A;  4PP0 A;  2YPN A;  1CE2 A;  2F8D A;  3TTN A;  1NNP A;  3S2V A;  3VVE A;  1OLA A;  5DYH A;  3C4M A;  1BK4 A;  2XWI A;  4PAK A;  2KQZ A;  1LLS A;  3BBR A;  4FEC A;  3TEP A;  3NOH A;  1B5J A;  4O94 A;  4F3P A;  4DIG A;  4F1V A;  4MMP A;  1LB8 A;  1FBD A;  3MZB A;  2Z23 A;  5H8F A;  1MY3 A;  5I58 A;  1VDW A;  4F22 A;  4BDO A;  2RIN A;  5AA4 A;  1HSE A;  2F6P A;  5LTC A;  5ET7 A;  4GD5 A;  5ICQ A;  5IKB A;  1FJ6 A;  4PET A;  3O6I A;  1LBX A;  5I7I A;  3TTM A;  3E4R A;  1QUJ A;  3K2D A;  1URG A;  3H6T A;  5TPA B;  2Q89 A;  1OVB A;  1MDP 1;  2HFB A;  4NF0 A;  4YKP A;  4MNI A;  4N13 A;  2IEE A;  5AA2 D;  2DP8 A;  4JB7 A;  1ZU0 A;  4RY1 A;  4OVS A;  5IZ1 A;  2ZZX A;  5F24 A;  4F2Q A;  2NVU B;  2P3V A;  3PD8 A;  3VVF A;  1Y1Z A;  1G0H A;  5L9S A;  4KD5 A;  4O3A A;  2DYX A;  1ZJL A;  2VP1 A;  1FBP A;  4JSO A;  2G93 A;  1LFI A;  4G68 A;  3QUJ A;  3MZ9 A;  3G3F A;  4DLD A;  1A54 A;  1MY2 A;  2O7I A;  1UTH A;  3O66 A;  3F11 A;  4H45 A;  2DWH A;  4OVP A;  3H06 B;  4K3F A;  1O63 A;  3IR1 A;  2P2A A;  4AS4 A;  4N4U A;  4H67 A;  4H65 A;  2D3I A;  1R1N A;  5AA2 A;  3LV0 A;  3B6W A;  2H4I A;  2ZYO A;  4NF6 A;  4LZ5 A;  3PUX E;  1SQY A;  4GIZ A;  5IGA A;  4OAN A;  1AOV A;  1QUK A;  1SW2 A;  4ZEF A;  1PC3 A;  5DVF A;  2H99 A;  3OOA A;  4GRK A;  1JVY A;  4QFN A;  2XXT A;  3DEL B;  4R74 A;  5I5P A;  4MLV A;  3PPN A;  1GTK A;  2O84 X;  3KSX A;  3DM0 A;  1NKX A;  4YB6 A;  3TTL A;  4XKQ A;  3T9X B;  2X26 A;  2O51 A;  4I1D A;  3U8Q A;  2Y7I A;  3OO6 A;  3GBB A;  1MPC A;  1Z7M E;  4PFR A;  3P7I A;  4TOZ A;  1NUW A;  4F39 A;  2F3B A;  4KHZ E;  3W15 C;  4NGU A;  3UK4 A;  1JW5 A;  4OER A;  2DVC A;  3MAM A;  1DSN A;  4EUO A;  4NF5 B;  1US5 A;  3H7M A;  3MYU A;  3PU5 A;  2XXH A;  1XS5 A;  1LST A;  5JEI A;  3FAT A;  1FPI A;  4YIC A;  3MUQ A;  3GXA A;  3MP8 A;  1YAE A;  5I3S A;  3ODB A;  3RPL A;  4JDF A;  1NNT A;  3SEY A;  4LP2 B;  4QXD A;  3OSR A;  4KPT A;  5FHO A;  1SW1 A;  3M8U A;  4BDQ A;  1XC1 A;  4MAG A;  1LGB C;  2DE2 A;  3KN7 A;  3SET A;  3TFL A;  3TYH A;  2BJI A;  3T9U A;  1ANF A;  1FJ9 A;  2XXK A;  4PE5 B;  4OVR A;  4ELO A;  4R2F A;  1VSO A;  3ZSF A;  1H44 A;  3T1B A;  3MVX A;  5I56 A;  1RDY A;  3PGF A;  3U1O A;  5H8F B;  1USY E;  5I58 B;  4OFL A;  2QVV A;  1Y3Q A;  1FBH A;  1MPB A;  4XFE A;  4GWO A;  1FPF A;  4GL8 A;  5AA4 B;  1SVX B;  1JQF A;  1XVX A;  2ZNU A;  3T9V A;  1IQ7 A;  2R71 A;  2Z8E A; 
#chains in the Genus database with same CATH homology
 3IOT A;  3VLW A;  3HST A;  1MXZ A;  3T9H B;  3PPO A;  2PT1 A;  2F7C A;  1SDX A;  4QFO A;  3MP1 A;  2Q2A A;  5CBR A;  3UP9 A;  1VE4 A;  3DP8 A;  2F6G A;  3G3I A;  1ZKB A;  3K1M A;  2FA7 A;  5L9M A;  1JEV A;  1URD A;  1FTO A;  4QFL A;  4THI A;  3C32 A;  1SI0 A;  4G68 B;  3GLB A;  1YTV A;  1TFD A;  3IB0 A;  4RPO A;  4ECF A;  1US4 A;  4OQO A;  3TTR A;  2QMX A;  1MY4 A;  2Q88 A;  3IOR A;  3QYT A;  4H6D A;  3Q27 A;  1P1O A;  3QUF A;  1MS7 A;  4QSE A;  1MY1 A;  5FHN A;  3EHT A;  2HZL A;  4PQJ A;  1JEU A;  5LOM A;  3K6X A;  4OFJ A;  3C31 A;  4Q8R A;  5AA2 B;  2F36 A;  5ITO A;  3TQL A;  2GFE A;  2O7U A;  4NF6 B;  4G77 A;  1GGG A;  1EZP A;  1M5C A;  4BDM A;  3CIJ A;  2OLB A;  4EXK A;  5KZT A;  2HQ0 A;  3H4Z A;  4ONY A;  2V3T A;  1MPD A;  2F35 A;  4ZEC A;  3LBS A;  5JK4 A;  1B6H A;  4GQO A;  2Y7W A;  1MH4 A;  1VFD A;  4GF8 A;  3TZA A;  2ONR A;  1MQJ A;  2RC7 A;  5ISU A;  4KYE A;  3HO7 A;  3LSF B;  3R26 A;  4QSC A;  1FTJ A;  4OTE A;  4LAT A;  5KDT A;  4LQ5 A;  2E1S A;  3OEL A;  3PMW A;  3KOT A;  3GBA A;  3SEV A;  4R6K A;  2XXI A;  4BDR A;  2Z22 A;  3T66 A;  3FD3 A;  2RCB A;  1OVT A;  4JWO A;  1QVS A;  4YZZ A;  2H5Y A;  3OD7 A;  3IL1 B;  2ZYN A;  1FQB A;  1IIW A;  4YAH X;  2I3W A;  4DXU A;  4JBZ A;  2QL3 A;  2ANJ A;  4LQ2 A;  4ISU A;  4E0W A;  1UQW A;  3RLF E;  3FVO A;  4FAT A;  1L5T A;  3EPE A;  1MXY A;  4KR5 A;  1B7H A;  4OMB A;  5CMC A;  2DE3 A;  2AIX A;  3QAX A;  1T0K A;  2Q8J A;  5L8D A;  4MFI A;  2P0S A;  3V8X B;  4U2R A;  5I59 A;  5A5X A;  5H8H A;  4XKR A;  1BKA A;  1FQF A;  3KJ7 A;  2AL5 A;  3IK6 B;  2GHB A;  1TT1 A;  3VXC A;  1LBC A;  2I3V A;  3CI8 A;  5TP9 A;  3ILT B;  1B52 A;  5CRY A;  3K1P A;  3A3C A;  3BFT A;  4NWD A;  5I56 B;  2HCA A;  4FJP A;  4UAC A;  3RTF B;  5H8N A;  3KN3 A;  3FJ7 A;  4RPN A;  1R9Q A;  2XD3 A;  3BKI B;  1ZIU A;  1B46 A;  1A55 A;  1WOD A;  4X1D A;  4DCY A;  5DT6 A;  4DDD A;  1N7X A;  2I0C A;  2VD3 A;  2ZNS A;  2NWJ A;  5ITP A;  3HHG A;  1B3E A;  2V25 A;  1CB6 A;  4XIG Q;  1ZTY A;  3E9X A;  4ZEK A;  3S9L C;  2ZXT A;  5CMM A;  4G8M A;  1PEB A;  2OZZ A;  3TQW A;  2F7B A;  2D5W A;  2RC8 A;  3ZKK A;  5H8S A;  4FEB A;  3C35 A;  1FQE A;  3WAF A;  3K01 A;  1MY0 A;  1MM7 A;  5DVI A;  3VVD A;  1PDA A;  3FXR A;  5I2K A;  4YKJ A;  3I3V A;  1D4N A;  5B7D A;  3OEN A;  5CMB A;  2ALU A;  1B58 A;  1NNK A;  3FVK A;  4GXA A;  1PBP A;  4LZ7 A;  2F7A A;  2QJE A;  2XX9 A;  1URS A;  4C0R A;  1TWY A;  3EHS A;  3IOU A;  2NUV A;  1RYX A;  3IOW A;  3FV1 A;  2RC9 A;  1LCF A;  2ZMB A;  4IO7 A;  1IEJ A;  1GV8 A;  4F2O A;  3IJX B;  2VOZ A;  3MVY A;  4HCW A;  4QFK A;  4YMB A;  1MM6 A;  4MLQ A;  3MWB A;  1DMB A;  2O68 A;  4FIM A;  3PPR A;  3SES A;  1LAX A;  1SBP A;  3VV5 A;  4L17 A;  3FXQ A;  2HEU A;  1A99 A;  2O1M A;  2Y7P A;  4ZZE A;  5IAI A;  5KCJ A;  2REG A;  5H8Q A;  1P99 A;  2X7P A;  1O64 A;  3VE1 B;  2UVJ A;  3SER A;  5KDT B;  2I4C A;  1ZLQ A;  4NF8 A;  1Y4T A;  1OQH A;  2QSX A;  1Y3N A;  1P1N A;  1WDN A;  3TDJ A;  1RYO A;  1JW1 A;  1QKB A;  1TXF A;  4OVJ A;  4R6Y A;  1TFA A;  3PPQ A;  1FW0 A;  4WEP A;  1FQD A;  1QUI A;  2V84 A;  2DSF A;  3BFU A;  2AL4 A;  4EXL A;  2CMO A;  1PB7 A;  1BLF A;  1I6A A;  4ZDM A;  4U4X A;  1MXX A;  1S9T A;  3PUY E;  2QRY A;  3MW0 A;  3G7W A;  2OJT A;  1N0T A;  2V3U A;  4R9G A;  1S7Y A;  4HTG A;  1LAG E;  5F7V A;  3B6Q A;  3K6V A;  1B1X A;  4Q5T A;  2H98 A;  3H03 A;  3S4U A;  1N84 A;  1UIV A;  4DXB A;  3H6W A;  3ILU B;  4ZEI A;  5A5X B;  3OEK A;  1UTB A;  3H6U A;  4LON B;  1Z7N E;  2DS9 A;  1VFE A;  2DOJ A;  4Q0C A;  3MVZ A;  1AMF A;  1H76 A;  1MQH A;  1N76 A;  4XKP A;  1B7Z A;  1LAH E;  4TLL B;  2P1S A;  3CG1 A;  3HPI A;  1H3D A;  5H8N B;  1NH7 A;  4GL0 A;  3T93 B;  2B3B A;  4OES A;  3FZV A;  5L9O A;  3KJT A;  4FAJ A;  4MF3 A;  1ELJ A;  5AA1 A;  2VHA A;  3GZG A;  4KYD A;  3PUZ E;  4ELQ A;  3IB1 A;  3U94 A;  1EU8 A;  4POX A;  3HV1 A;  3QSL A;  3QIM A;  4JSD A;  4RK2 A;  4WXJ A;  2HAV A;  3A09 A;  2O6A A;  3A3U A;  1ATG A;  1IXC A;  1MH3 A;  1SW5 A;  2B65 A;  2PBW A;  2WKY A;  1B3F A;  4R2B A;  4AB6 A;  3OMB A;  4KCC A;  4NF4 A;  1A8E A;  3K4U A;  1NFT A;  2DWI A;  3FJM A;  4ZE8 A;  3R6U A;  3MJN A;  1N3W A;  5I2K B;  2FNC A;  1B05 A;  2RCA A;  4IY5 A;  4U1Z A;  3WAE A;  3VXB A;  3PUW E;  1GR2 A;  1B2H A;  3O2A A;  1H43 A;  5BWJ A;  1JVX A;  5I84 A;  2AYS A;  3RPW A;  4GXS B;  1DTZ A;  4PFU A;  4P11 A;  3B7D A;  4I8C A;  5DTB A;  1MQG A;  4GOT A;  1ZBM A;  1EZO A;  2G29 A;  3Q25 A;  3EN3 A;  1UTH B;  3K6W A;  3O97 A;  1D9Y A;  2O69 A;  2ZYM A;  4G8N A;  4LVQ A;  1OLC A;  4H1X A;  4EF2 A;  2Z8F A;  3FAS A;  4EQ9 A;  1PBQ A;  4WED A;  5H8Q B;  3SEU A;  3CR9 A;  2NXO A;  2OCU A;  1USY H;  2IA4 A;  1YCJ A;  3CG3 A;  2GH9 A;  4EQB A;  1MXU A;  1POT A;  4GVO A;  3IO4 A;  5JTY A;  3MPL A;  3O29 A;  2R6G E;  3VLV A;  1I69 A;  1B0L A;  4OFO A;  1BIY A;  2F78 A;  3CVG A;  1QW0 A;  1H45 A;  4IGR A;  2OWT A;  3TAJ A;  1OQG A;  1D3K A;  1AL3 A;  3FIR A;  2ABH A;  2FYI A;  3K02 A;  3OO9 A;  4C1U A;  1P1U A;  1IXH A;  5HPQ A;  3EQ1 A;  4IO2 A;  3M3L A;  2ONS A;  2QMW A;  3Q29 A;  2ZYK A;  4IO5 A;  3IB2 A;  3H3G A;  1LFH A;  3UN6 A;  2HZK A;  4DCX A;  5ELV A;  2ZNT A;  5DEX A;  1MXW A;  3UGW A;  5I2N A;  1B4Z A;  3H6V A;  5F1Q A;  3M3K A;  4R72 A;  2I49 A;  2A5S A;  3IX1 A;  2XXU A;  2GRV A;  3W9W A;  4N07 A;  3FVN A;  5B70 A;  4QRZ A;  2B3F A;  1AIV A;  3MVW A;  1UTB B;  3TPA A;  3S9E A;  3U72 A;  3V89 B;  3KSJ A;  4RK9 A;  4OEU A;  2DVZ A;  1DPP A;  3RNN A;  1B1H A;  3OEM A;  5AA3 A;  4F3S A;  4I62 A;  4TQU Q;  4OET A;  4WKM A;  2PVU A;  1VR5 A;  4NMY A;  4H8J A;  3LSW A;  4HW8 A;  3U92 A;  3RUM A;  3PMX A;  4H5G A;  2THI A;  1KWH A;  3IO6 A;  1Y1M A;  4EDP A;  3QK6 A;  3T22 A;  1B4H A;  2PMS A;  3N5L A;  2VD2 A;  2GHA A;  5I57 A;  3UOR A;  4GLI A;  4NED A;  2UYF A;  4BLA A;  1P1W A;  1LCT A;  5CBS A;  5EHM A;  4RA1 A;  1BTJ A;  4F31 B;  2XXV A;  4PFT A;  4NF4 B;  3SEW A;  4OEN A;  2XXW A;  3ZS6 A;  4ND9 A;  4IO6 A;  4PFW A;  4EF1 A;  1MDQ A;  3G3H A;  1SYI A;  4DZ1 A;  2Y7K A;  4N6P A;  4JXI A;  3MC2 A;  4QFP A;  3C33 A;  2QS4 A;  3CSB A;  1N04 A;  3CFX A;  3OXN A;  4JWX A;  1DOT A;  2UVG A;  3W9V A;  2DE4 A;  4KYS A;  3TUS A;  1QKA A;  4FED A;  4IO3 A;  4F18 A;  2Y7R A;  3HCQ A;  2CZL A;  2O1L A;  3T96 B;  4YMA A;  2ONK E;  4M1V A;  4YU0 A;  3ZKL A;  3KN8 A;  3K1N A;  3S9M C;  3HN0 A;  4IB2 A;  4E0X A;  3K00 A;  4C1T A;  4RJZ A;  4QHQ A;  3C9H A;  1S50 A;  4AB5 A;  4X48 A;  4GFR A;  1B5I A;  1POY 1;  3EF7 A;  3O6H A;  2DWA A;  5EYF A;  3PMV A;  2F34 A;  1MQD A;  4F1U A;  4F19 A;  2XXQ A;  2UVI A;  1B5H A;  1O7T A;  3MP6 A;  4NWC A;  3CFZ A;  1FTL A;  3R7X A;  3Q28 A;  2XX7 A;  4Z0I A;  1Q1K A;  1Y9U A;  1PB9 A;  2UYE A;  3K6U A;  4ZS9 A;  5JTY B;  3DP4 A;  1XT8 A;  4POW A;  4NTL A;  3G3J A;  3G3G A;  3UA8 A;  4HCY A;  4MH5 A;  4H5F A;  2REJ A;  5M2V A;  3JZJ A;  4U22 A;  4QSD A;  2OWS A;  1DTG A;  1Y4C A;  2F97 A;  2R9J A;  1MQI A;  1B51 A;  4OYV A;  1EH3 A;  2Q2C A;  4RXL A;  4DE8 A;  2DWJ A;  1IZ1 A;  4UA8 A;  2D21 A;  2XXP A;  3S9N C;  2Z8D A;  1QUL A;  4U4S A;  4R73 A;  3FJG A;  4OHN A;  2Q9T A;  1F9B A;  3O6G A;  3N6T A;  4YKI A;  3PUV E;  4YB5 A;  5DEX B;  5I2N B;  4ESX A;  1IXG A;  4IO4 A;  3EHU A;  1LFG A;  5CI5 A;  5CMK A;  1M5B A;  3SDF A;  1MRP A;  4H8I A;  4XKN A;  3KG2 A;  3IOV A;  3RT6 B;  2I0B A;  3FUZ A;  3RY3 A;  4P0G A;  3MBP A;  4P0I A;  4DXC A;  1JW4 A;  2YLN A;  4PFY A;  1RKM A;  3HHF A;  1SYH A;  3OSQ A;  1FQC A;  5K2Y A;  3RT8 A;  2LAO A;  5DVJ A;  3SEX A;  2V3Q A;  1B32 A;  4RYA A;  3O9P A;  1YPN A;  1PB8 A;  3MZ1 A;  5I59 B;  3THI A;  5H8H B;  3ONM A;  1R6Z A;  2XX8 A;  3QXM A;  5ICT A;  3B6T A;  1XOC A;  4IGT A;  5TP9 B;  3IJO B;  5EHS A;  4KFQ A;  4FE8 A;  4ZED A;  2XXR A;  3DP6 A;  2UXA A;  3PPP A;  4I9D A;  1SD3 A;  2H25 A;  3V5A A;  3V83 A;  3I5O A;  3MPK A;  5I57 B;  4G68 C;  4G4P A;  4ZE9 A;  1NMU A;  3SKP A;  2XXX A;  3JV9 A;  3RQT A;  1GVC A;  1FTM A;  4Q30 B;  1II5 A;  1R9L A;  1LB9 A;  1FQA A;  1FCK A;  2QS2 A;  3L6H A;  3CFL A;  5AE4 A;  2RKM A;  2Y84 A;  3VDF A;  1WVJ A;  3PV0 E;  4O3C A;  2I58 A;  4QF9 A;  2M8C A;  5FHM A;  5FTI A;  2A5T A;  5TU0 A;  3L6G A;  5J1D A;  3Q26 A;  3KZG A;  2HAU A;  5FTH A;  3PD9 A;  4IY6 A;  4KI0 E;  4YB7 A;  3N6U A;  2XHD A;  2RF1 A;  1NL5 A;  4X1B A;  1IXI A;  3DLN A;  3OO8 A;  1B3H A;  4ESW A;  1NNF A;  1B40 A;  2QS1 A;  1NH8 A;  3FGS A;  3KGC A;  4H0W A;  1J1N A;  4MBP A;  4F1Y A;  3N26 A;  1HSJ A;  2XD2 A;  1A40 A;  2I6E A;  4EQ7 A;  3FVG A;  4KQP A;  1B0H A;  4R6H A;  3KBR A;  2F5X A;  4G8H A;  1LAF E;  3FXU A;  1I6Q A;  4XTC Q;  4ZEB A;  4AQ4 A;  4Z7E A;  4OZ9 A;  3LUY A;  4FOR A;  5TPA A;  5CM6 A;  3ECR A;  1LBB A;  3RN8 A;  4X9T A;  3LSL A;  4BDN A;  1XHY A;  3C36 A;  2QS3 A;  2PYY A;  2OK2 A;  1B3G A;  2KLF A;  1OMP A;  4F3B A;  2E0S A;  5KCJ B;  3TTK A;  4U21 A;  1P1Q A;  2H9B A;  1FTK A;  2PT2 A;  3TEL A;  3FV2 A;  4BDL A;  2I4B A;  4YKK A;  2OBG A;  2BJJ X;  4NF8 B;  2PX1 A;  5CC2 A;  1M5E A;  3TKD A;  3CSG A;  3USD A;  1N3X A;  3I6V A;  3TOD A;  3LR1 A;  3VLU A;  4F3G A;  2UVH A;  1Y20 A;  3TMG A;  1IUD A;  4HS7 A;  1N7W A;  1UIU A;  4TLM B;  1Q35 A;  4JWY A;  1M5D A;  4NE4 A;  1OIB A;  3E13 X;  4OEV A;  3JYR A;  3U93 A;  3TCH A;  4RNS A;  3C34 A;  3UIF A;  3K0V A;  3VFJ A;  4LZ8 A;  3D4G A;  3LC8 A;  1EZ9 A;  1M5F A;  1IIT A;  2V93 A;  4M4G A;  4ZZA A;  3TCF A;  3LSX A;  1ZMG A;  4KCD A;  3E3K A;  3RGY A;  1Y3P A;  1D9V A;  1AH5 A;  1QJM A;  3OO7 A;  1B7U A;  2X7Q A;  3N94 A;  3G3K A;  3O28 A;  4U23 A;  1XVY A;  4LUB A;  1MXV A;  3D4C A;  2YJP A;  4F29 A;  1B3L A;  2NOO A;  2HXW A;  1A7L A;  3M3F A;  5K2X A;  4R9F A;  2ESN A;  2XXY A;  3RTW B;  4R75 A;  2VGQ A;  2W7Y A;  1I6B A;  5HM4 B;  5BUU A;  3AXF A;  3CRB A;  1SI1 A;  4ELR A;  1BP5 A;  3IAZ A;  4O3B A;  4LA9 A;  4NF5 A;  1JET A;  2DXR A;  2QPQ A;  4G2Z A;  4XXU A;  5HBC A;  2DXY A;  4U1O A;  2I48 A;  3KFM A;  1SW4 A;  1A8F A;  3MQ9 A;  1DPE A;  4OWD A;  1MG1 A;  3TCG A;  2DQV A;  4ELP A;  2A5T B;  4OXV A;  3KEI A;  1B9J A;  1HSL A;  3KOS A;  1JNF A;  4PP0 A;  2YPN A;  1CE2 A;  2F8D A;  3TTN A;  1NNP A;  3S2V A;  3VVE A;  1OLA A;  5DYH A;  3C4M A;  1LLS A;  3BBR A;  4FEC A;  3TEP A;  4F3P A;  1B5J A;  4DIG A;  4F1V A;  1LB8 A;  3MZB A;  2Z23 A;  5H8F A;  1MY3 A;  5I58 A;  4F22 A;  4BDO A;  2RIN A;  5AA4 A;  1HSE A;  2F6P A;  4GD5 A;  5ICQ A;  5IKB A;  4PET A;  3O6I A;  3TTM A;  3E4R A;  1QUJ A;  3K2D A;  1URG A;  3H6T A;  5TPA B;  2Q89 A;  1OVB A;  1MDP 1;  2HFB A;  4YKP A;  4N13 A;  2IEE A;  5AA2 D;  2DP8 A;  4JB7 A;  1ZU0 A;  4RY1 A;  4F2Q A;  2NVU B;  3PD8 A;  3VVF A;  1Y1Z A;  5L9S A;  4KD5 A;  4O3A A;  2DYX A;  1ZJL A;  2VP1 A;  4JSO A;  2G93 A;  1LFI A;  4G68 A;  3QUJ A;  3MZ9 A;  3G3F A;  4DLD A;  1A54 A;  1MY2 A;  2O7I A;  1UTH A;  3O66 A;  3F11 A;  2DWH A;  3H06 B;  4K3F A;  1O63 A;  3IR1 A;  2P2A A;  4H67 A;  4H65 A;  2D3I A;  1R1N A;  5AA2 A;  3B6W A;  2H4I A;  2ZYO A;  4NF6 A;  4LZ5 A;  3PUX E;  1SQY A;  4GIZ A;  1AOV A;  1QUK A;  1SW2 A;  4ZEF A;  1PC3 A;  5DVF A;  2H99 A;  3OOA A;  4GRK A;  1JVY A;  4QFN A;  2XXT A;  3DEL B;  4R74 A;  4MLV A;  3PPN A;  1GTK A;  2O84 X;  3KSX A;  3DM0 A;  1NKX A;  4YB6 A;  3TTL A;  4XKQ A;  3T9X B;  2X26 A;  2O51 A;  4I1D A;  3U8Q A;  2Y7I A;  3OO6 A;  3GBB A;  1MPC A;  1Z7M E;  3P7I A;  4TOZ A;  4F39 A;  4KHZ E;  3W15 C;  3UK4 A;  1JW5 A;  4OER A;  2DVC A;  3MAM A;  1DSN A;  4EUO A;  4NF5 B;  1US5 A;  3H7M A;  3PU5 A;  2XXH A;  1XS5 A;  1LST A;  5JEI A;  3FAT A;  4YIC A;  3MUQ A;  3GXA A;  3MP8 A;  1YAE A;  3ODB A;  4JDF A;  1NNT A;  3SEY A;  4LP2 B;  3OSR A;  4KPT A;  5FHO A;  1SW1 A;  3M8U A;  4BDQ A;  1XC1 A;  1LGB C;  2DE2 A;  3KN7 A;  3SET A;  3TFL A;  3TYH A;  3T9U A;  1ANF A;  4PE5 B;  4ELO A;  4R2F A;  1VSO A;  3ZSF A;  1H44 A;  3MVX A;  5I56 A;  3PGF A;  3U1O A;  5H8F B;  1USY E;  5I58 B;  4OFL A;  1Y3Q A;  1MPB A;  4GWO A;  4GL8 A;  5AA4 B;  1SVX B;  1JQF A;  1XVX A;  2ZNU A;  3T9V A;  1IQ7 A;  2R71 A;  2Z8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...