1SWBA

Apo-core-streptavidin at ph 7.5
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
120
structure length
120
Chain Sequence
b'GITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title Structural studies of the streptavidin binding loop.
pubmed rcsb
source organism Streptomyces avidinii
molecule tags Biotin-binding protein
total genus 25
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1swbA00
2IZBA 1VWNB 5IRWA 3VHMA 1SWAA 2MF6A 4CPIA 3T6LA 1RSUB 5F2BA 3RDMA 1SWFA 2IZKA 2UYWA 3WZQA 4BX7B 1SRJA 3WZNA 1KL4A 3X00A 1SWCA 4BX6A 4Y59A 1VWRB 1VYOA 2IZLB 5B5FA 3RDUA 1SWLA 1WBIA 1SWDA 1SWSA 5B5GA 3EW1A 2OFBA 2IZAA 4GGTA 3RE6A 1SLEB 3EW2A 1Y55X 3T2WA 1SRFA 2Y3EA 1STPA 3PK2A 4GGZA 1N4JA 1I9HA 3SZHA 1SWJA 4BBOA 4Y5DA 3RDSA 2FHLA 1SWUA 2ZSCA 1VWOB 1MM9A 1SWRA 1HXZA 1MEPA 4IRWA 1IJ8A 1VWIB 4CPHA 1SLDB 4GDAA 1VWMB 1VWFB 1LCVA 2QCBA 1VWPB 1VWQB 1SRHA 2Y32A 2RTRB 1NQMA 2RTBB 2RTEB 2RTDB 2UZ2A 3FDCA 3MG5A 1Y52X 4I60A 2A5BA 5CHKA 4Z28A 1Y53X 3MM0A 4BX5B 4CPEA 1SWBA 1VWGB 1SLGB 4CPHB 2C4IA 1KL5A 1RSTB 5L3YA 3VHHA 2RTJA 1VWHB 2G5LA 4CPFA 2A5CA 2RTCB 1DF8A 2OFAA 1SWNA 1RXKA 2RTQB 5JD2A 5K68A 3WYQA 1PTSA 4Z2PA 2C1QA 1AVEA 2AVIA 1VWJB 2JGSA 2OF9A 1VWKB 1HXLA 1VWLB 2IZCB 2WPUA 1N9YA 2IZEB 2IZHB 4BX5A 1SREA 2RTAA 4GD9A 1MOYA 1RXJA 1SRGA 1SWOA 5IRAA 1VWCB 2RTHB 2RTNB 3WZOA 4BCSA 1HQQA 2IZIA 3WZPA 2C1SA 1VWAB 2IZDB 2RTFB 4EKVA 4Z6JA 2F01A 2FHNX 2Y3FA 1LDQA 1SWEA 3T2XA 1LELA 1N9MA 3VHIA 1KL3A 1LCWA 2A8GA 4BX6B 4DNEA 4YVBA 1SWGA 3WYPA 2RTPB 3RDQA 4OKAA 3SZIA 1STSB 5CSEA 4Z2OA 2IZJA 1VWEB 2CAMA 3T6FA 1SWTA 1RAVA 2RTOB 2RTIB 5IRUA 1VWBB 4JHQA 3RDOA 3RE5A 2BC3A 1SWHA 1LCZA 1N7YA 3VGWA 4GGRA 2OF8A 1NDJA 4GJVA 3RY1A 2IZFB 2IZGB 2RTMA 1SWKA 3RDXA 4Z2VA 5K67A 1RXHA 1N43A 4BJ8A 1KFFA 4GJSA 1NQNA 1STRB 4JO6A 3RY2A 4Z27A 1LDOA 1NBXA 2GH7A 1NC9A 4BX7A 2RTKA 1SLFB 1MK5A 2RTLA 1HY2A 2RTGB 4JNJA 4U46A 1SRIA 3SZJA 1AVDA 1LUQA 1VWDB 1SWQA 1SWPA
chains in the Genus database with same CATH superfamily
1LICA 1Y9TA 3UEVA 3RBYA 3WJEA 3VHMA 4N7DA 2WEXA 4IMOA 3Q6LA 1SY3A 3KFIA 5F58A 1SWFA 3O19A 1BSOA 4IAWA 4UU2A 3F6ZB 1KL4A 3MVFA 3X00A 5HZQA 2MWHA 2JOZA 5HZ8A 2GTLO 3PECA 3EM0A 2M4LA 4I95A 2W2FA 4KC8A 2WEWA 3VG5A 4YDBA 3C78X 5C0NA 4YKOA 5KHPA 5IXGA 1LIDA 1WBIA 2HZRA 2OY8A 2Q2MA 4O3XB 5B5GA 1YIVA 2F73A 1U0XA 2OFBA 2IZAA 3F8AA 5D4AA 4GGTA 2YMSA 3JQOA 3U9PC 4C5PA 3T1DA 3ZI8A 4ORXA 1Y55X 3T2WA 4CSBA 1SRFA 1EIOA 1W4TA 2NNDA 3SZHA 4O3ZA 4ALBA 3WXQA 5HBSA 3FEKA 4ZHFA 2ZAGA 1BSYA 4HWMA 3NQ3A 2FHLA 2ZSCA 3EBKA 1SWRA 1X8UA 4FQBB 1SY1A 1IJ8A 2QM9A 2Q39A 3WJGA 2BHVA 1H91A 2RA6A 4Y0RA 3FA6A 1VWMB 1LFOA 4AZMA 2QCBA 4PJ2A 4D6AA 3AKMA 5IO7A 1QY2A 5AJBA 5HA0A 1SRHA 3EC5A 2PI3O 2RTEB 4Z28A 1Y52X 4PSQA 1HN2A 2A5BA 4GDZA 4A60A 1QQSA 4R0BA 4FBVA 3JSQA 3RZYA 1A3YA 3S60A 1YUPA 4I3CA 1SLGB 2L67A 5LJGA 2ACOA 4ZHHA 3WVMA 2G5LA 4CPFA 2A5CA 2E4JA 3N91A 2OFAA 2RTQB 4ZH9A 2CZTA 2JU3A 2W2BA 2OVAA 1B56A 1VWJB 4TQ2A 1OBQA 1VWKB 3FA7A 1JV4A 1YP6A 4U8UN 1T0VA 5AEOA 2CM4A 1QWDA 5EEDA 1HQPA 3ELZA 4GD9A 1BRQA 1FENA 2RTAA 4A1HA 2FKJA 3D97A 1VWCB 2OVEA 2RTNB 3ELXA 3HK1A 1PBYA 4UU3A 2IZIA 2QMIA 5FENA 5IO6A 1CJ5A 1VWAB 2IZDB 2RTFB 4TKBA 2AT8X 4BVMA 4ORSA 1R0UA 1FDQA 1YWDA 1EIIA 5CYBA 4HPDA 3PPTA 3CBSA 4ZHGA 1SWEA 3D9WA 4GNYA 1P6PA 5HWZA 1X8OA 4O49A 1HMRA 4BOEA 1JJJA 3VE1A 3WYPA 4YVBA 4MIRA 3NADA 5CSEA 5HCDC 3PH6A 4GUZA 4U8UO 4YH0A 3ZW0B 3T6FA 2IFBA 1DFVA 4U3QA 4AYHA 1JJXA 2HYSA 2RTIB 4OS8A 2O62A 4CDFA 1MDCA 3RDOA 3SLTA 2G8CO 1FJ1E 3WOVA 3V8UA 2OY1O 1SWHA 1PEEA 2OF8A 3STNA 1Y0GA 2IZFB 2OZQA 4CK4A 1PBOA 2OVSA 1I78A 3BLGA 3AUMO 3PP6A 1MVGA 2GJ5A 4U9CA 2OY7A 5BYPA 3O2YA 4I6SA 5F6BA 2N93A 3CBCA 1NQNA 3KQ0A 4TJZA 3RY2A 1Z24A 2YG2A 1UYOX 1YWCA 1HBQA 2A13A 3B2KA 1NC9A 3MX7A 3P02A 4N7CA 4QYNA 2K23A 3CQRA 3P24A 1MK5A 2RTLA 1HY2A 2RTGB 3FR5A 3LV4A 4ORWA 4BX6B 4YMYA 4FGIB 5JR8A 2IZBA 1BLRA 3VG2A 4IB6A 4L3RA 3ZZVA 1DF3A 3ZUOA 3EMMA 5AQ6A 3L4RA 3T6LA 1RSUB 5F2BA 5HTEA 2UYWA 5EEEA 4A8ZA 3FA9A 2CBSA 3S5XA 4NYRA 2RQ0A 1E02A 3UEWA 3FLLA 5B2AO 2LFOA 3FIDA 4Y59A 4LZUA 1X71A 4XMFA 1AVGI 3RDUA 5B29A 4IB7A 3SLOA 2A2GA 4COTA 5EZ2A 3EW1A 3VE2A 2FLJA 2EU7X 3HWGA 2R73A 3LTWA 5HA1A 2ANSA 2RCTA 1SLEB 3B2LA 5LJEA 4ODDA 2Y3EA 4I3BA 4MVKA 2A2UA 3PK2A 4MISA 4NV8A 2ASNX 3VU1A 1DZMA 1X8PA 1ML7A 4IAXA 4NW4A 3WJCA 2JW1A 2RN4A 1SXYA 3D4RA 3OBLA 3SZJA 1K3BA 1KOIA 4OMWA 1QY0A 1TOWA 3DTQA 5FFHA 4GDAA 3NX2A 4FBOA 1ZNLA 4QGVA 1LCVA 2G7BA 2HLVA 2HKDA 1VWPB 2WR6A 1LIFA 2X55A 4CV7A 3U0DA 1XKIA 2RTBB 4WFUA 2RTDB 3CKFA 3PQUA 4Y0SA 4BQUA 1JYDA 3BU1A 5LJCA 4CDCA 1CBQA 4OELA 4ZFXA 5FQ6E 2NP1A 1SY0A 2OY5O 1JMXA 2ALLX 4BX5B 1SWBA 1U17A 2Q9SA 1KL5A 1SXUA 3STMX 2X46A 5IO5A 1I06A 1OSPO 5L3YA 1HBPA 4RUUA 3K3LA 1AQBA 1VWHB 2FGSA 2RTCB 3GAQA 3NQKA 1ICMA 4O9SA 5H9LA 2KW1A 5JD2A 2BS6A 4QRLA 3FR4A 2GTFX 2C1QA 1RBPA 2JGSA 1NP4A 4IABA 4EXZA 3TGBA 5B10O 1KT3A 2G79A 4ES7A 1SREA 4K19A 4WFVA 1KZWA 1GKAB 4GH7A 2R56A 1SRGA 4YKMA 2RTHB 3VG4A 1OPAA 1I4UA 1HQQA 1LNMA 1X89A 1EXSA 2C1SA 2BSZA 1GXAA 4XMEA 3FELA 4Z6JA 3QKGA 1FTPA 2F01A 1ZNHA 3P6FA 4ORUA 5K06A 2XSTA 1KT5A 2X8TA 4XMHA 2HMBA 2Y3FA 4HPCA 3D95A 5HTDA 3VHIA 2A8GA 3NQ9A 4DNEA 1SWGA 2X8SA 5LKFA 3WJDA 4EEJA 4OKAA 3DSZA 5EPQA 2JU8A 3P6DA 4KH8A 1OBPA 5H9AA 4ZGFA 3UEUA 1IKJA 1E06A 1NGLA 1CBSA 2RTOB 1G74A 1LKEA 3OE3A 4HFOA 5FQ7E 4TLJA 1TOUA 1ZNEA 2BC3A 2I5VO 1U18A 4NYQA 4AZRA 1GM6A 1G5WA 2X4MA 4MVEA 3RY1A 3HTYA 3FYFA 5K67A 2RTMA 1QG5A 2VFBA 1N43A 1FELA 1O8VA 1I05A 3KFGA 4MVIA 5FQ8E 3RWXA 2Z4HA 3WJFA 3ZW0A 2P8GA 1K24A 2KTSA 4JO6A 4YGZA 3O22A 2ACPX 1D2UA 1SA8A 2GH7A 4GZVA 2WSJA 5LJHA 4NLIA 2W2AA 4BX7A 4ZGUA 1JBHA 5L8OA 1EUOA 2RTKA 1EPAA 1OEJA 1A2DA 1QFVA 3HWEA 3KVNA 5B11O 3UAQA 1GT4A 3EBWA 1AVDA 1LUQA 1VWDB 4HPAA 1VWOB 1SWDA 1S2PA 1HMSA 4IBAA 1D3SA 2QO6A 3B2HA 5AJCA 5FAZA 1VWNB 2KT4B 3HWFA 1KT6A 1QY1A 4GETA 5IRWA 1SWAA 1ZNKA 2MF6A 5HZ5A 4KCAA 4CPIA 2X34A 3C77X 4YFRA 3RDMA 3NPOA 2IZKA 2FR3A 5DG4A 4BGFA 3WZQA 4BX7B 1B0OA 2POAA 3OD9A 1KGLA 3OJYC 1EW3A 5D48A 4LZVA 4BX6A 4O4SA 1Y9LA 3BX8A 3ZW2A 4OS0A 2FWVA 1IIUA 5CE4A 2FRSA 4KIIA 4DCBA 1SWLA 1SWSA 2CZUA 2Q4NA 1JMZA 1PMPA 1O1UA 1OEEA 1OPBA 2LBVA 3EW2A 3FEPA 1GGLA 1TXLA 4ZCBA 3S26A 4GGZA 1ICNA 1N4JA 1I9HA 3CKGA 5F7GA 1BWYA 1MUPA 5HAEA 4LQZA 1NP1A 2NNEA 2OL8O 3VG7A 2RD7C 3RDSA 1MM9A 2KD2A 1MEPA 4IRWA 1VWIB 4O4UA 2MM3A 1SXWA 2Z4IA 4GRJA 1VWFB 1ZRYA 4ARHA 1RLBE 3IFBA 3TGCA 1IFBA 1VWQB 4L1NA 2Y32A 1NQMA 4OEMA 1ACDA 3FDCA 4I60A 4IMNA 4KT5A 3TZSA 2MHDA 3TF6A 4XMCA 3FMZA 3MBTA 2WQ9A 4CPEA 1VWGB 3D96A 2C4IA 2L9CA 3FA8A 3H3IA 1SXXA 1O1VA 1RSTB 4GKCA 4TNNA 2OYBO 5KIDA 1EI5A 4ZJ0A 1KXOA 2LKKA 1DV9A 3BS2A 3RSWA 1DF8A 4WBKA 1SWNA 1RXKA 1W6FA 5K68A 4ML7B 3ZW1A 4FBRA 1PTSA 3FENA 3BY0A 3BX7A 3LHNA 2AVIA 1S7DA 1HXLA 2IZCB 4YDAA 4ZH6A 1FE3A 5D8JA 1ERBA 1N9YA 2IZEB 5HCEC 4ZHDA 4BX5A 1BSQA 3IA8A 4QZTA 1MOYA 3APWA 2KTDA 4RUNA 1BBPA 2QO5A 4XMGA 4ZR2A 3WZOA 4BCSA 1UYNX 4EKVA 2AH7X 3ZW1B 5LJKA 2GTLN 1EPBA 1QABE 4YGGA 4I9SA 2FHNX 1ZNDA 3B2JA 5LJBA 4QAEA 1LELA 4QNIA 1JIWI 1KL3A 3SLJA 1LPJA 3NX1A 1GKAA 1EQDA 2BLGA 1GT3A 1JQPA 4QGWA 2FKGA 1ERXA 1S44A 4GU8A 5D45A 2AT5X 2QO4A 5B27A 5B3MO 3SOTA 4ORRA 3STKA 4YBPA 2A3FX 2IZJA 4Z2OA 1VWEB 2CAMA 4YBUA 1SWTA 1RAVA 1N0SA 4JHQA 2VFCA 1T68X 4MVLA 5IRUA 3SAOA 3KFHA 3AEHA 2AT0X 3BRNA 1BJ7A 1DZJA 3PQSA 2X8FA 1LCZA 1N7YA 1GX9A 4LKTA 3BSZE 3C76X 2IZGB 3RDXA 4Z2VA 1UZ2X 1EALA 1L6MA 2X56A 3ZWEA 1JJUA 4BJ8A 3HPEA 4DQ3A 1YP7A 1KFFA 4AZNA 4LKPA 2GC9A 2XKLA 4TKJA 1QFTA 1KZXA 3PH5A 2LBAA 2QOMA 2BS5A 4GNWA 3NP1A 4QQ1A 4JNJA 4AW8A 1W5RA 4INNA 4GJSA 4NNTA 1XCAA 1SWQA 2AF5A 2WQAE 2AT3X 3E3CA 5LJDA 4QZUA 1DZPA 4MEEA 3FR2A 2HZQA 1SMPI 2FS7A 4NP1A 1LF7A 3KZAA 4GE1A 1GX3A 2OFMX 1X8QA 1SRJA 4O3WA 4IB9A 3VG3A 3WZNA 1JZUA 1KQXA 3QQ2A 3CWKA 3P6CA 4GK9A 4QGXA 2FTBA 1GT5A 1SWCA 3KFFA 1DC9A 1VWRB 1VYOA 3ZQ3A 2GTLM 2IZLB 2L68A 5B5FA 3CQNA 4Y0QA 4IB8A 3BDRA 1B4MA 1UREA 4ON1A 4YCEA 2FR2A 1CRBA 1X8NA 1KT7A 3RE6A 3JS1A 3S5VA 4ALOA 2AMMX 1STPA 2OVDA 2I5ZO 5EDCA 2JU7A 3B2IA 1SWJA 2X45A 4I3DA 3WJBA 1BEBA 1PM1X 1E00A 1HMTA 2JN3A 1CBRA 3HWDA 4Y5DA 4BBOA 1SWUA 5D47A 4DQ4A 1WUBA 1DZKA 2DJGA 1HXZA 3FW4A 3VG6A 4CPHA 1T8VA 1SLDB 1LIBA 3EYCA 3G7XA 4O3YA 4EQAC 2NNQA 1YWBA 2OFRX 4NV7A 3UEXA 4GGRA 2RTRB 3VHHA 1E5PA 2UZ2A 5CHKA 3MG5A 2AKQA 4ID2A 2JMBA 1Y53X 3MM0A 1B8EA 4CPHB 3I17A 3U03A 3APUA 3APVA 1BM5A 1MX8A 2RTJA 4B55A 2HNXA 2WUTA 5KICA 3P6GA 1GX8A 5H9KA 3WYQA 1G7NA 4AZQA 2G78A 1GT1A 4QYPA 4Z2PA 5HCCC 1AVEA 2OF9A 2WPUA 3P6EA 1VWLB 3APXA 2CBRA 4EDEA 4AZPA 2IZHB 5BVQA 4A1YA 4M7MA 5BVTA 1RXJA 2FS6A 2OL6O 1SWOA 5IRAA 3WBGA 4OS3A 2DJFA 2AT6X 2FT9A 3PDFA 2QOSC 3WZPA 1FEMA 4EFGA 4O4XA 5LKEA 2R74A 1CBIA 2ZAIA 3NBXX 5HZ6A 2Q2PA 1IFCA 2LB6A 5DPQA 1IKEA 5F6ZA 1LDQA 1I04A 4HPBA 1KT4A 3T2XA 4AZOA 1N9MA 3Q34A 1AELA 1G85A 1LCWA 1VYFA 3NR3A 1SY2A 3ZUIA 2WWPA 3HOLA 4YFPA 1IW2A 5L8IA 4WHIA 3CMPA 2RTPB 1ALBA 2X32A 3GE2A 4O4OA 3RDQA 1JYJA 1A18A 3SZIA 1STSB 3VPJE 4YGHA 4M6SA 1BRPA 1AB0A 3HOEA 3CR6A 4YFQA 2DM5A 1ADLA 3AKNA 1TVQA 2AL0X 2F09A 4NNSA 4U8UM 5F1EA 3TGAA 2VDFA 1VWBB 5BVSA 1KQWA 3RE5A 3RKGA 1E2TA 4ORYA 1VPRA 4Y0PA 1OBUA 2LA7A 3F9DA 4JGLA 3BU9A 3FIQA 2MJIA 3VGWA 1NDJA 4GJVA 1A57A 4YCHA 5L8NA 4ZHCA 2MO5A 1SWKA 4CDDA 1MX7A 1RXHA 2BT9A 2RCQA 3I0AA 2L5PA 2CM9A 1TW4A 1LIEA 1STRB 4OMXA 4Z27A 1LDOA 4I9RA 1NBXA 4TKHA 5H8TA 1YWAA 2A0AA 4D6BA 5H9NA 1ZNGA 4KC7A 3P6HA 3PEDA 1SLFB 4NLJA 5EDBA 4CDEA 1OEKA 2OL7A 3FW5A 1VYGA 4U46A 1SRIA 4XMDA 2K62A 5HZ9A 2PY1A 1SWPA
chains in the Genus database with same CATH topology
2IZBA 1VWNB 5IRWA 3VHMA 1SWAA 2MF6A 4CPIA 3T6LA 1RSUB 5F2BA 3RDMA 1SWFA 2IZKA 2UYWA 3WZQA 4BX7B 1SRJA 3WZNA 1KL4A 3X00A 1SWCA 4BX6A 4Y59A 1VWRB 1VYOA 2IZLB 5B5FA 3RDUA 1SWLA 1WBIA 1SWDA 1SWSA 5B5GA 3EW1A 2OFBA 2IZAA 4GGTA 3RE6A 1SLEB 3EW2A 1Y55X 3T2WA 1SRFA 2Y3EA 1STPA 3PK2A 4GGZA 1N4JA 1I9HA 3SZHA 1SWJA 4BBOA 4Y5DA 3RDSA 2FHLA 1SWUA 2ZSCA 1VWOB 1MM9A 1SWRA 1HXZA 1MEPA 4IRWA 1IJ8A 1VWIB 4CPHA 1SLDB 4GDAA 1VWMB 1VWFB 1LCVA 2QCBA 1VWPB 1VWQB 1SRHA 2Y32A 2RTRB 1NQMA 2RTBB 2RTEB 2RTDB 2UZ2A 3FDCA 3MG5A 1Y52X 4I60A 2A5BA 5CHKA 4Z28A 1Y53X 3MM0A 4BX5B 4CPEA 1SWBA 1VWGB 1SLGB 4CPHB 2C4IA 1KL5A 1RSTB 5L3YA 3VHHA 2RTJA 1VWHB 2G5LA 4CPFA 2A5CA 2RTCB 1DF8A 2OFAA 1SWNA 1RXKA 2RTQB 5JD2A 5K68A 3WYQA 1PTSA 4Z2PA 2C1QA 1AVEA 2AVIA 1VWJB 2JGSA 2OF9A 1VWKB 1HXLA 1VWLB 2IZCB 2WPUA 1N9YA 2IZEB 2IZHB 4BX5A 1SREA 2RTAA 4GD9A 1MOYA 1RXJA 1SRGA 1SWOA 5IRAA 1VWCB 2RTHB 2RTNB 3WZOA 4BCSA 1HQQA 2IZIA 3WZPA 2C1SA 1VWAB 2IZDB 2RTFB 4EKVA 4Z6JA 2F01A 2FHNX 2Y3FA 1LDQA 1SWEA 3T2XA 1LELA 1N9MA 3VHIA 1KL3A 1LCWA 2A8GA 4BX6B 4DNEA 4YVBA 1SWGA 3WYPA 2RTPB 3RDQA 4OKAA 3SZIA 1STSB 5CSEA 4Z2OA 2IZJA 1VWEB 2CAMA 3T6FA 1SWTA 1RAVA 2RTOB 2RTIB 5IRUA 1VWBB 4JHQA 3RDOA 3RE5A 2BC3A 1SWHA 1LCZA 1N7YA 3VGWA 4GGRA 2OF8A 1NDJA 4GJVA 3RY1A 2IZFB 2IZGB 2RTMA 1SWKA 3RDXA 4Z2VA 5K67A 1RXHA 1N43A 4BJ8A 1KFFA 4GJSA 1NQNA 1STRB 4JO6A 3RY2A 4Z27A 1LDOA 1NBXA 2GH7A 1NC9A 4BX7A 2RTKA 1SLFB 1MK5A 2RTLA 1HY2A 2RTGB 4JNJA 4U46A 1SRIA 3SZJA 1AVDA 1LUQA 1VWDB 1SWQA 1SWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IZB A;  1VWN B;  5IRW A;  3VHM A;  1SWA A;  2MF6 A;  4CPI A;  3T6L A;  1RSU B;  5F2B A;  3RDM A;  1SWF A;  2IZK A;  2UYW A;  3WZQ A;  4BX7 B;  1SRJ A;  3WZN A;  1KL4 A;  3X00 A;  1SWC A;  4BX6 A;  4Y59 A;  1VWR B;  1VYO A;  2IZL B;  5B5F A;  3RDU A;  1SWL A;  1WBI A;  1SWD A;  1SWS A;  5B5G A;  3EW1 A;  2OFB A;  2IZA A;  4GGT A;  3RE6 A;  1SLE B;  3EW2 A;  1Y55 X;  3T2W A;  1SRF A;  2Y3E A;  1STP A;  3PK2 A;  4GGZ A;  1N4J A;  1I9H A;  3SZH A;  1SWJ A;  4BBO A;  4Y5D A;  3RDS A;  2FHL A;  1SWU A;  2ZSC A;  1VWO B;  1MM9 A;  1SWR A;  1HXZ A;  1MEP A;  4IRW A;  1IJ8 A;  1VWI B;  4CPH A;  1SLD B;  4GDA A;  1VWM B;  1VWF B;  1LCV A;  2QCB A;  1VWP B;  1VWQ B;  1SRH A;  2Y32 A;  2RTR B;  1NQM A;  2RTB B;  2RTE B;  2RTD B;  2UZ2 A;  3FDC A;  3MG5 A;  1Y52 X;  4I60 A;  2A5B A;  5CHK A;  4Z28 A;  1Y53 X;  3MM0 A;  4BX5 B;  4CPE A;  1SWB A;  1VWG B;  1SLG B;  4CPH B;  2C4I A;  1KL5 A;  1RST B;  5L3Y A;  3VHH A;  2RTJ A;  1VWH B;  2G5L A;  4CPF A;  2A5C A;  2RTC B;  1DF8 A;  2OFA A;  1SWN A;  1RXK A;  2RTQ B;  5JD2 A;  5K68 A;  3WYQ A;  1PTS A;  4Z2P A;  2C1Q A;  1AVE A;  2AVI A;  1VWJ B;  2JGS A;  2OF9 A;  1VWK B;  1HXL A;  1VWL B;  2IZC B;  2WPU A;  1N9Y A;  2IZE B;  2IZH B;  4BX5 A;  1SRE A;  2RTA A;  4GD9 A;  1MOY A;  1RXJ A;  1SRG A;  1SWO A;  5IRA A;  1VWC B;  2RTH B;  2RTN B;  3WZO A;  4BCS A;  1HQQ A;  2IZI A;  3WZP A;  2C1S A;  1VWA B;  2IZD B;  2RTF B;  4EKV A;  4Z6J A;  2F01 A;  2FHN X;  2Y3F A;  1LDQ A;  1SWE A;  3T2X A;  1LEL A;  1N9M A;  3VHI A;  1KL3 A;  1LCW A;  2A8G A;  4BX6 B;  4DNE A;  4YVB A;  1SWG A;  3WYP A;  2RTP B;  3RDQ A;  4OKA A;  3SZI A;  1STS B;  5CSE A;  4Z2O A;  2IZJ A;  1VWE B;  2CAM A;  3T6F A;  1SWT A;  1RAV A;  2RTO B;  2RTI B;  5IRU A;  1VWB B;  4JHQ A;  3RDO A;  3RE5 A;  2BC3 A;  1SWH A;  1LCZ A;  1N7Y A;  3VGW A;  4GGR A;  2OF8 A;  1NDJ A;  4GJV A;  3RY1 A;  2IZF B;  2IZG B;  2RTM A;  1SWK A;  3RDX A;  4Z2V A;  5K67 A;  1RXH A;  1N43 A;  4BJ8 A;  1KFF A;  4GJS A;  1NQN A;  1STR B;  4JO6 A;  3RY2 A;  4Z27 A;  1LDO A;  1NBX A;  2GH7 A;  1NC9 A;  4BX7 A;  2RTK A;  1SLF B;  1MK5 A;  2RTL A;  1HY2 A;  2RTG B;  4JNJ A;  4U46 A;  1SRI A;  3SZJ A;  1AVD A;  1LUQ A;  1VWD B;  1SWQ A;  1SWP A; 
#chains in the Genus database with same CATH topology
 1LIC A;  1Y9T A;  3UEV A;  3RBY A;  3WJE A;  3VHM A;  4N7D A;  2WEX A;  4IMO A;  3Q6L A;  1SY3 A;  3KFI A;  5F58 A;  1SWF A;  3O19 A;  1BSO A;  4IAW A;  4UU2 A;  3F6Z B;  1KL4 A;  3MVF A;  3X00 A;  5HZQ A;  2MWH A;  2JOZ A;  5HZ8 A;  2GTL O;  3PEC A;  3EM0 A;  2M4L A;  4I95 A;  2W2F A;  4KC8 A;  2WEW A;  3VG5 A;  4YDB A;  3C78 X;  5C0N A;  4YKO A;  5KHP A;  5IXG A;  1LID A;  1WBI A;  2HZR A;  2OY8 A;  2Q2M A;  4O3X B;  5B5G A;  1YIV A;  2F73 A;  1U0X A;  2OFB A;  2IZA A;  3F8A A;  5D4A A;  4GGT A;  2YMS A;  3JQO A;  3U9P C;  4C5P A;  3T1D A;  3ZI8 A;  4ORX A;  1Y55 X;  3T2W A;  4CSB A;  1SRF A;  1EIO A;  1W4T A;  2NND A;  3SZH A;  4O3Z A;  4ALB A;  3WXQ A;  5HBS A;  3FEK A;  4ZHF A;  2ZAG A;  1BSY A;  4HWM A;  3NQ3 A;  2FHL A;  2ZSC A;  3EBK A;  1SWR A;  1X8U A;  4FQB B;  1SY1 A;  1IJ8 A;  2QM9 A;  2Q39 A;  3WJG A;  2BHV A;  1H91 A;  2RA6 A;  4Y0R A;  3FA6 A;  1VWM B;  1LFO A;  4AZM A;  2QCB A;  4PJ2 A;  4D6A A;  3AKM A;  5IO7 A;  1QY2 A;  5AJB A;  5HA0 A;  1SRH A;  3EC5 A;  2PI3 O;  2RTE B;  4Z28 A;  1Y52 X;  4PSQ A;  1HN2 A;  2A5B A;  4GDZ A;  4A60 A;  1QQS A;  4R0B A;  4FBV A;  3JSQ A;  3RZY A;  1A3Y A;  3S60 A;  1YUP A;  4I3C A;  1SLG B;  2L67 A;  5LJG A;  2ACO A;  4ZHH A;  3WVM A;  2G5L A;  4CPF A;  2A5C A;  2E4J A;  3N91 A;  2OFA A;  2RTQ B;  4ZH9 A;  2CZT A;  2JU3 A;  2W2B A;  2OVA A;  1B56 A;  1VWJ B;  4TQ2 A;  1OBQ A;  1VWK B;  3FA7 A;  1JV4 A;  1YP6 A;  4U8U N;  1T0V A;  5AEO A;  2CM4 A;  1QWD A;  5EED A;  1HQP A;  3ELZ A;  4GD9 A;  1BRQ A;  1FEN A;  2RTA A;  4A1H A;  2FKJ A;  3D97 A;  1VWC B;  2OVE A;  2RTN B;  3ELX A;  3HK1 A;  1PBY A;  4UU3 A;  2IZI A;  2QMI A;  5FEN A;  5IO6 A;  1CJ5 A;  1VWA B;  2IZD B;  2RTF B;  4TKB A;  2AT8 X;  4BVM A;  4ORS A;  1R0U A;  1FDQ A;  1YWD A;  1EII A;  5CYB A;  4HPD A;  3PPT A;  3CBS A;  4ZHG A;  1SWE A;  3D9W A;  4GNY A;  1P6P A;  5HWZ A;  1X8O A;  4O49 A;  1HMR A;  4BOE A;  1JJJ A;  3VE1 A;  3WYP A;  4YVB A;  4MIR A;  3NAD A;  5CSE A;  5HCD C;  3PH6 A;  4GUZ A;  4U8U O;  4YH0 A;  3ZW0 B;  3T6F A;  2IFB A;  1DFV A;  4U3Q A;  4AYH A;  1JJX A;  2HYS A;  2RTI B;  4OS8 A;  2O62 A;  4CDF A;  1MDC A;  3RDO A;  3SLT A;  2G8C O;  1FJ1 E;  3WOV A;  3V8U A;  2OY1 O;  1SWH A;  1PEE A;  2OF8 A;  3STN A;  1Y0G A;  2IZF B;  2OZQ A;  4CK4 A;  1PBO A;  2OVS A;  1I78 A;  3BLG A;  3AUM O;  3PP6 A;  1MVG A;  2GJ5 A;  4U9C A;  2OY7 A;  5BYP A;  3O2Y A;  4I6S A;  5F6B A;  2N93 A;  3CBC A;  1NQN A;  3KQ0 A;  4TJZ A;  3RY2 A;  1Z24 A;  2YG2 A;  1UYO X;  1YWC A;  1HBQ A;  2A13 A;  3B2K A;  1NC9 A;  3MX7 A;  3P02 A;  4N7C A;  4QYN A;  2K23 A;  3CQR A;  3P24 A;  1MK5 A;  2RTL A;  1HY2 A;  2RTG B;  3FR5 A;  3LV4 A;  4ORW A;  4BX6 B;  4YMY A;  4FGI B;  5JR8 A;  2IZB A;  1BLR A;  3VG2 A;  4IB6 A;  4L3R A;  3ZZV A;  1DF3 A;  3ZUO A;  3EMM A;  5AQ6 A;  3L4R A;  3T6L A;  1RSU B;  5F2B A;  5HTE A;  2UYW A;  5EEE A;  4A8Z A;  3FA9 A;  2CBS A;  3S5X A;  4NYR A;  2RQ0 A;  1E02 A;  3UEW A;  3FLL A;  5B2A O;  2LFO A;  3FID A;  4Y59 A;  4LZU A;  1X71 A;  4XMF A;  1AVG I;  3RDU A;  5B29 A;  4IB7 A;  3SLO A;  2A2G A;  4COT A;  5EZ2 A;  3EW1 A;  3VE2 A;  2FLJ A;  2EU7 X;  3HWG A;  2R73 A;  3LTW A;  5HA1 A;  2ANS A;  2RCT A;  1SLE B;  3B2L A;  5LJE A;  4ODD A;  2Y3E A;  4I3B A;  4MVK A;  2A2U A;  3PK2 A;  4MIS A;  4NV8 A;  2ASN X;  3VU1 A;  1DZM A;  1X8P A;  1ML7 A;  4IAX A;  4NW4 A;  3WJC A;  2JW1 A;  2RN4 A;  1SXY A;  3D4R A;  3OBL A;  3SZJ A;  1K3B A;  1KOI A;  4OMW A;  1QY0 A;  1TOW A;  3DTQ A;  5FFH A;  4GDA A;  3NX2 A;  4FBO A;  1ZNL A;  4QGV A;  1LCV A;  2G7B A;  2HLV A;  2HKD A;  1VWP B;  2WR6 A;  1LIF A;  2X55 A;  4CV7 A;  3U0D A;  1XKI A;  2RTB B;  4WFU A;  2RTD B;  3CKF A;  3PQU A;  4Y0S A;  4BQU A;  1JYD A;  3BU1 A;  5LJC A;  4CDC A;  1CBQ A;  4OEL A;  4ZFX A;  5FQ6 E;  2NP1 A;  1SY0 A;  2OY5 O;  1JMX A;  2ALL X;  4BX5 B;  1SWB A;  1U17 A;  2Q9S A;  1KL5 A;  1SXU A;  3STM X;  2X46 A;  5IO5 A;  1I06 A;  1OSP O;  5L3Y A;  1HBP A;  4RUU A;  3K3L A;  1AQB A;  1VWH B;  2FGS A;  2RTC B;  3GAQ A;  3NQK A;  1ICM A;  4O9S A;  5H9L A;  2KW1 A;  5JD2 A;  2BS6 A;  4QRL A;  3FR4 A;  2GTF X;  2C1Q A;  1RBP A;  2JGS A;  1NP4 A;  4IAB A;  4EXZ A;  3TGB A;  5B10 O;  1KT3 A;  2G79 A;  4ES7 A;  1SRE A;  4K19 A;  4WFV A;  1KZW A;  1GKA B;  4GH7 A;  2R56 A;  1SRG A;  4YKM A;  2RTH B;  3VG4 A;  1OPA A;  1I4U A;  1HQQ A;  1LNM A;  1X89 A;  1EXS A;  2C1S A;  2BSZ A;  1GXA A;  4XME A;  3FEL A;  4Z6J A;  3QKG A;  1FTP A;  2F01 A;  1ZNH A;  3P6F A;  4ORU A;  5K06 A;  2XST A;  1KT5 A;  2X8T A;  4XMH A;  2HMB A;  2Y3F A;  4HPC A;  3D95 A;  5HTD A;  3VHI A;  2A8G A;  3NQ9 A;  4DNE A;  1SWG A;  2X8S A;  5LKF A;  3WJD A;  4EEJ A;  4OKA A;  3DSZ A;  5EPQ A;  2JU8 A;  3P6D A;  4KH8 A;  1OBP A;  5H9A A;  4ZGF A;  3UEU A;  1IKJ A;  1E06 A;  1NGL A;  1CBS A;  2RTO B;  1G74 A;  1LKE A;  3OE3 A;  4HFO A;  5FQ7 E;  4TLJ A;  1TOU A;  1ZNE A;  2BC3 A;  2I5V O;  1U18 A;  4NYQ A;  4AZR A;  1GM6 A;  1G5W A;  2X4M A;  4MVE A;  3RY1 A;  3HTY A;  3FYF A;  5K67 A;  2RTM A;  1QG5 A;  2VFB A;  1N43 A;  1FEL A;  1O8V A;  1I05 A;  3KFG A;  4MVI A;  5FQ8 E;  3RWX A;  2Z4H A;  3WJF A;  3ZW0 A;  2P8G A;  1K24 A;  2KTS A;  4JO6 A;  4YGZ A;  3O22 A;  2ACP X;  1D2U A;  1SA8 A;  2GH7 A;  4GZV A;  2WSJ A;  5LJH A;  4NLI A;  2W2A A;  4BX7 A;  4ZGU A;  1JBH A;  5L8O A;  1EUO A;  2RTK A;  1EPA A;  1OEJ A;  1A2D A;  1QFV A;  3HWE A;  3KVN A;  5B11 O;  3UAQ A;  1GT4 A;  3EBW A;  1AVD A;  1LUQ A;  1VWD B;  4HPA A;  1VWO B;  1SWD A;  1S2P A;  1HMS A;  4IBA A;  1D3S A;  2QO6 A;  3B2H A;  5AJC A;  5FAZ A;  1VWN B;  2KT4 B;  3HWF A;  1KT6 A;  1QY1 A;  4GET A;  5IRW A;  1SWA A;  1ZNK A;  2MF6 A;  5HZ5 A;  4KCA A;  4CPI A;  2X34 A;  3C77 X;  4YFR A;  3RDM A;  3NPO A;  2IZK A;  2FR3 A;  5DG4 A;  4BGF A;  3WZQ A;  4BX7 B;  1B0O A;  2POA A;  3OD9 A;  1KGL A;  3OJY C;  1EW3 A;  5D48 A;  4LZV A;  4BX6 A;  4O4S A;  1Y9L A;  3BX8 A;  3ZW2 A;  4OS0 A;  2FWV A;  1IIU A;  5CE4 A;  2FRS A;  4KII A;  4DCB A;  1SWL A;  1SWS A;  2CZU A;  2Q4N A;  1JMZ A;  1PMP A;  1O1U A;  1OEE A;  1OPB A;  2LBV A;  3EW2 A;  3FEP A;  1GGL A;  1TXL A;  4ZCB A;  3S26 A;  4GGZ A;  1ICN A;  1N4J A;  1I9H A;  3CKG A;  5F7G A;  1BWY A;  1MUP A;  5HAE A;  4LQZ A;  1NP1 A;  2NNE A;  2OL8 O;  3VG7 A;  2RD7 C;  3RDS A;  1MM9 A;  2KD2 A;  1MEP A;  4IRW A;  1VWI B;  4O4U A;  2MM3 A;  1SXW A;  2Z4I A;  4GRJ A;  1VWF B;  1ZRY A;  4ARH A;  1RLB E;  3IFB A;  3TGC A;  1IFB A;  1VWQ B;  4L1N A;  2Y32 A;  1NQM A;  4OEM A;  1ACD A;  3FDC A;  4I60 A;  4IMN A;  4KT5 A;  3TZS A;  2MHD A;  3TF6 A;  4XMC A;  3FMZ A;  3MBT A;  2WQ9 A;  4CPE A;  1VWG B;  3D96 A;  2C4I A;  2L9C A;  3FA8 A;  3H3I A;  1SXX A;  1O1V A;  1RST B;  4GKC A;  4TNN A;  2OYB O;  5KID A;  1EI5 A;  4ZJ0 A;  1KXO A;  2LKK A;  1DV9 A;  3BS2 A;  3RSW A;  1DF8 A;  4WBK A;  1SWN A;  1RXK A;  1W6F A;  5K68 A;  4ML7 B;  3ZW1 A;  4FBR A;  1PTS A;  3FEN A;  3BY0 A;  3BX7 A;  3LHN A;  2AVI A;  1S7D A;  1HXL A;  2IZC B;  4YDA A;  4ZH6 A;  1FE3 A;  5D8J A;  1ERB A;  1N9Y A;  2IZE B;  5HCE C;  4ZHD A;  4BX5 A;  1BSQ A;  3IA8 A;  4QZT A;  1MOY A;  3APW A;  2KTD A;  4RUN A;  1BBP A;  2QO5 A;  4XMG A;  4ZR2 A;  3WZO A;  4BCS A;  1UYN X;  4EKV A;  2AH7 X;  3ZW1 B;  5LJK A;  2GTL N;  1EPB A;  1QAB E;  4YGG A;  4I9S A;  2FHN X;  1ZND A;  3B2J A;  5LJB A;  4QAE A;  1LEL A;  4QNI A;  1JIW I;  1KL3 A;  3SLJ A;  1LPJ A;  3NX1 A;  1GKA A;  1EQD A;  2BLG A;  1GT3 A;  1JQP A;  4QGW A;  2FKG A;  1ERX A;  1S44 A;  4GU8 A;  5D45 A;  2AT5 X;  2QO4 A;  5B27 A;  5B3M O;  3SOT A;  4ORR A;  3STK A;  4YBP A;  2A3F X;  2IZJ A;  4Z2O A;  1VWE B;  2CAM A;  4YBU A;  1SWT A;  1RAV A;  1N0S A;  4JHQ A;  2VFC A;  1T68 X;  4MVL A;  5IRU A;  3SAO A;  3KFH A;  3AEH A;  2AT0 X;  3BRN A;  1BJ7 A;  1DZJ A;  3PQS A;  2X8F A;  1LCZ A;  1N7Y A;  1GX9 A;  4LKT A;  3BSZ E;  3C76 X;  2IZG B;  3RDX A;  4Z2V A;  1UZ2 X;  1EAL A;  1L6M A;  2X56 A;  3ZWE A;  1JJU A;  4BJ8 A;  3HPE A;  4DQ3 A;  1YP7 A;  1KFF A;  4AZN A;  4LKP A;  2GC9 A;  2XKL A;  4TKJ A;  1QFT A;  1KZX A;  3PH5 A;  2LBA A;  2QOM A;  2BS5 A;  4GNW A;  3NP1 A;  4QQ1 A;  4JNJ A;  4AW8 A;  1W5R A;  4INN A;  4GJS A;  4NNT A;  1XCA A;  1SWQ A;  2AF5 A;  2WQA E;  2AT3 X;  3E3C A;  5LJD A;  4QZU A;  1DZP A;  4MEE A;  3FR2 A;  2HZQ A;  1SMP I;  2FS7 A;  4NP1 A;  1LF7 A;  3KZA A;  4GE1 A;  1GX3 A;  2OFM X;  1X8Q A;  1SRJ A;  4O3W A;  4IB9 A;  3VG3 A;  3WZN A;  1JZU A;  1KQX A;  3QQ2 A;  3CWK A;  3P6C A;  4GK9 A;  4QGX A;  2FTB A;  1GT5 A;  1SWC A;  3KFF A;  1DC9 A;  1VWR B;  1VYO A;  3ZQ3 A;  2GTL M;  2IZL B;  2L68 A;  5B5F A;  3CQN A;  4Y0Q A;  4IB8 A;  3BDR A;  1B4M A;  1URE A;  4ON1 A;  4YCE A;  2FR2 A;  1CRB A;  1X8N A;  1KT7 A;  3RE6 A;  3JS1 A;  3S5V A;  4ALO A;  2AMM X;  1STP A;  2OVD A;  2I5Z O;  5EDC A;  2JU7 A;  3B2I A;  1SWJ A;  2X45 A;  4I3D A;  3WJB A;  1BEB A;  1PM1 X;  1E00 A;  1HMT A;  2JN3 A;  1CBR A;  3HWD A;  4Y5D A;  4BBO A;  1SWU A;  5D47 A;  4DQ4 A;  1WUB A;  1DZK A;  2DJG A;  1HXZ A;  3FW4 A;  3VG6 A;  4CPH A;  1T8V A;  1SLD B;  1LIB A;  3EYC A;  3G7X A;  4O3Y A;  4EQA C;  2NNQ A;  1YWB A;  2OFR X;  4NV7 A;  3UEX A;  4GGR A;  2RTR B;  3VHH A;  1E5P A;  2UZ2 A;  5CHK A;  3MG5 A;  2AKQ A;  4ID2 A;  2JMB A;  1Y53 X;  3MM0 A;  1B8E A;  4CPH B;  3I17 A;  3U03 A;  3APU A;  3APV A;  1BM5 A;  1MX8 A;  2RTJ A;  4B55 A;  2HNX A;  2WUT A;  5KIC A;  3P6G A;  1GX8 A;  5H9K A;  3WYQ A;  1G7N A;  4AZQ A;  2G78 A;  1GT1 A;  4QYP A;  4Z2P A;  5HCC C;  1AVE A;  2OF9 A;  2WPU A;  3P6E A;  1VWL B;  3APX A;  2CBR A;  4EDE A;  4AZP A;  2IZH B;  5BVQ A;  4A1Y A;  4M7M A;  5BVT A;  1RXJ A;  2FS6 A;  2OL6 O;  1SWO A;  5IRA A;  3WBG A;  4OS3 A;  2DJF A;  2AT6 X;  2FT9 A;  3PDF A;  2QOS C;  3WZP A;  1FEM A;  4EFG A;  4O4X A;  5LKE A;  2R74 A;  1CBI A;  2ZAI A;  3NBX X;  5HZ6 A;  2Q2P A;  1IFC A;  2LB6 A;  5DPQ A;  1IKE A;  5F6Z A;  1LDQ A;  1I04 A;  4HPB A;  1KT4 A;  3T2X A;  4AZO A;  1N9M A;  3Q34 A;  1AEL A;  1G85 A;  1LCW A;  1VYF A;  3NR3 A;  1SY2 A;  3ZUI A;  2WWP A;  3HOL A;  4YFP A;  1IW2 A;  5L8I A;  4WHI A;  3CMP A;  2RTP B;  1ALB A;  2X32 A;  3GE2 A;  4O4O A;  3RDQ A;  1JYJ A;  1A18 A;  3SZI A;  1STS B;  3VPJ E;  4YGH A;  4M6S A;  1BRP A;  1AB0 A;  3HOE A;  3CR6 A;  4YFQ A;  2DM5 A;  1ADL A;  3AKN A;  1TVQ A;  2AL0 X;  2F09 A;  4NNS A;  4U8U M;  5F1E A;  3TGA A;  2VDF A;  1VWB B;  5BVS A;  1KQW A;  3RE5 A;  3RKG A;  1E2T A;  4ORY A;  1VPR A;  4Y0P A;  1OBU A;  2LA7 A;  3F9D A;  4JGL A;  3BU9 A;  3FIQ A;  2MJI A;  3VGW A;  1NDJ A;  4GJV A;  1A57 A;  4YCH A;  5L8N A;  4ZHC A;  2MO5 A;  1SWK A;  4CDD A;  1MX7 A;  1RXH A;  2BT9 A;  2RCQ A;  3I0A A;  2L5P A;  2CM9 A;  1TW4 A;  1LIE A;  1STR B;  4OMX A;  4Z27 A;  1LDO A;  4I9R A;  1NBX A;  4TKH A;  5H8T A;  1YWA A;  2A0A A;  4D6B A;  5H9N A;  1ZNG A;  4KC7 A;  3P6H A;  3PED A;  1SLF B;  4NLJ A;  5EDB A;  4CDE A;  1OEK A;  2OL7 A;  3FW5 A;  1VYG A;  4U46 A;  1SRI A;  4XMD A;  2K62 A;  5HZ9 A;  2PY1 A;  1SWP A; 
#chains in the Genus database with same CATH homology
 2IZB A;  1VWN B;  5IRW A;  3VHM A;  1SWA A;  2MF6 A;  4CPI A;  3T6L A;  1RSU B;  5F2B A;  3RDM A;  1SWF A;  2IZK A;  2UYW A;  3WZQ A;  4BX7 B;  1SRJ A;  3WZN A;  1KL4 A;  3X00 A;  1SWC A;  4BX6 A;  4Y59 A;  1VWR B;  1VYO A;  2IZL B;  5B5F A;  3RDU A;  1SWL A;  1WBI A;  1SWD A;  1SWS A;  5B5G A;  3EW1 A;  2OFB A;  2IZA A;  4GGT A;  3RE6 A;  1SLE B;  3EW2 A;  1Y55 X;  3T2W A;  1SRF A;  2Y3E A;  1STP A;  3PK2 A;  4GGZ A;  1N4J A;  1I9H A;  3SZH A;  1SWJ A;  4BBO A;  4Y5D A;  3RDS A;  2FHL A;  1SWU A;  2ZSC A;  1VWO B;  1MM9 A;  1SWR A;  1HXZ A;  1MEP A;  4IRW A;  1IJ8 A;  1VWI B;  4CPH A;  1SLD B;  4GDA A;  1VWM B;  1VWF B;  1LCV A;  2QCB A;  1VWP B;  1VWQ B;  1SRH A;  2Y32 A;  2RTR B;  1NQM A;  2RTB B;  2RTE B;  2RTD B;  2UZ2 A;  3FDC A;  3MG5 A;  1Y52 X;  4I60 A;  2A5B A;  5CHK A;  4Z28 A;  1Y53 X;  3MM0 A;  4BX5 B;  4CPE A;  1SWB A;  1VWG B;  1SLG B;  4CPH B;  2C4I A;  1KL5 A;  1RST B;  5L3Y A;  3VHH A;  2RTJ A;  1VWH B;  2G5L A;  4CPF A;  2A5C A;  2RTC B;  1DF8 A;  2OFA A;  1SWN A;  1RXK A;  2RTQ B;  5JD2 A;  5K68 A;  3WYQ A;  1PTS A;  4Z2P A;  2C1Q A;  1AVE A;  2AVI A;  1VWJ B;  2JGS A;  2OF9 A;  1VWK B;  1HXL A;  1VWL B;  2IZC B;  2WPU A;  1N9Y A;  2IZE B;  2IZH B;  4BX5 A;  1SRE A;  2RTA A;  4GD9 A;  1MOY A;  1RXJ A;  1SRG A;  1SWO A;  5IRA A;  1VWC B;  2RTH B;  2RTN B;  3WZO A;  4BCS A;  1HQQ A;  2IZI A;  3WZP A;  2C1S A;  1VWA B;  2IZD B;  2RTF B;  4EKV A;  4Z6J A;  2F01 A;  2FHN X;  2Y3F A;  1LDQ A;  1SWE A;  3T2X A;  1LEL A;  1N9M A;  3VHI A;  1KL3 A;  1LCW A;  2A8G A;  4BX6 B;  4DNE A;  4YVB A;  1SWG A;  3WYP A;  2RTP B;  3RDQ A;  4OKA A;  3SZI A;  1STS B;  5CSE A;  4Z2O A;  2IZJ A;  1VWE B;  2CAM A;  3T6F A;  1SWT A;  1RAV A;  2RTO B;  2RTI B;  5IRU A;  1VWB B;  4JHQ A;  3RDO A;  3RE5 A;  2BC3 A;  1SWH A;  1LCZ A;  1N7Y A;  3VGW A;  4GGR A;  2OF8 A;  1NDJ A;  4GJV A;  3RY1 A;  2IZF B;  2IZG B;  2RTM A;  1SWK A;  3RDX A;  4Z2V A;  5K67 A;  1RXH A;  1N43 A;  4BJ8 A;  1KFF A;  4GJS A;  1NQN A;  1STR B;  4JO6 A;  3RY2 A;  4Z27 A;  1LDO A;  1NBX A;  2GH7 A;  1NC9 A;  4BX7 A;  2RTK A;  1SLF B;  1MK5 A;  2RTL A;  1HY2 A;  2RTG B;  4JNJ A;  4U46 A;  1SRI A;  3SZJ A;  1AVD A;  1LUQ A;  1VWD B;  1SWQ A;  1SWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...