1SWDA

Apo-core-streptavidin in complex with biotin (two unoccupied binding sites) at ph 4.5
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
117
structure length
117
Chain Sequence
b'GITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title Structural studies of the streptavidin binding loop.
pubmed rcsb
source organism Streptomyces avidinii
molecule tags Biotin-binding protein
total genus 23
structure length 117
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1swdA00
3T6LA 3MM0A 2C1SA 2RTKA 3SZHA 2UZ2A 1VWNB 1Y55X 1KL5A 2IZKA 2OFBA 1SWSA 1SREA 1MEPA 1RSUB 1SWRA 2RTHB 1SWJA 3VHIA 2FHLA 2CAMA 5IRWA 4IRWA 1SWTA 1KL3A 1IJ8A 2C4IA 1RXHA 1SRJA 3T2XA 2C1QA 2OFAA 4Z2PA 4BX6B 1VWPB 2OF8A 1NDJA 1SLFB 1HQQA 1VWFB 1Y53X 2IZDB 1SWNA 4Y59A 3VHHA 2AVIA 3SZIA 3X00A 4U46A 2RTDB 1SWPA 1KL4A 1STPA 1LDQA 2Y32A 2Y3FA 1RAVA 4BX5B 4Z6JA 1SRFA 1N9MA 4BX7B 1SWQA 3WYPA 4CPHA 4DNEA 1SWLA 2RTNB 4Y5DA 1LDOA 1SWCA 2IZCB 1DF8A 1SLEB 4BCSA 2ZSCA 3RDMA 1AVEA 3WZQA 4JHQA 5B5FA 1NQMA 2RTRB 3FDCA 3PK2A 5K67A 1HXZA 5F2BA 4BJ8A 3RE5A 2RTFB 1N4JA 1NBXA 1AVDA 1NQNA 2QCBA 2UYWA 3T6FA 1SRHA 1VWEB 2RTIB 2WPUA 2RTBB 1MM9A 4Z2VA 1RXJA 1SLDB 1VWLB 4Z28A 1NC9A 4CPFA 4GDAA 2OF9A 2RTEB 3RY1A 1N7YA 1SWGA 2RTPB 2RTAA 2IZGB 5IRUA 4GGTA 3T2WA 3WYQA 1SLGB 1VWDB 1VWQB 1WBIA 1SWDA 1VWIB 1SWBA 2A5BA 2RTLA 2IZHB 2RTCB 1LUQA 3RDOA 1SRGA 4OKAA 3RY2A 1SWOA 3WZOA 2IZJA 5L3YA 1VWOB 5JD2A 1STRB 2FHNX 2A8GA 1RXKA 1VWJB 4YVBA 1SWHA 2G5LA 4GJVA 3VHMA 4CPEA 1VWAB 2IZAA 3WZNA 2IZEB 1HY2A 1VWCB 5CSEA 1VWMB 4JNJA 4BX6A 1RSTB 4GD9A 4Z2OA 2RTQB 1SWUA 1LELA 1SWFA 1VWRB 4Z27A 3SZJA 1LCVA 4I60A 3EW2A 2IZFB 1PTSA 2A5CA 2F01A 1LCZA 1N9YA 4BX5A 1VWHB 1I9HA 1MOYA 1SWAA 5B5GA 3VGWA 3WZPA 4BX7A 4CPIA 1HXLA 1VWBB 2IZLB 2Y3EA 1KFFA 5K68A 4JO6A 2RTJA 3RDQA 1LCWA 3MG5A 1SWKA 2IZBA 1N43A 1SRIA 4GGRA 1SWEA 5IRAA 3RDXA 1VWKB 2RTGB 4BBOA 4GJSA 4GGZA 2IZIA 3RDSA 1Y52X 3RE6A 1VYOA 1MK5A 1VWGB 2GH7A 3RDUA 5CHKA 2JGSA 1STSB 2BC3A 2RTMA 4CPHB 2RTOB 4EKVA 2MF6A 3EW1A
chains in the Genus database with same CATH superfamily
5BYPA 2OVAA 4K19A 3SZHA 4YFPA 2UZ2A 4YBUA 4ZHCA 1EXSA 1SWSA 4MISA 1SREA 1Z24A 4NP1A 3HWGA 5L8NA 3VHIA 2X46A 1EQDA 4XMHA 1S2PA 4FBVA 4YGZA 1IFBA 1D3SA 1QG5A 1AB0A 5HWZA 1SRJA 3BU9A 4YDAA 2OFAA 3T2XA 2AMMX 5HCDC 2KTDA 3NX2A 1OBPA 1QABE 1QY2A 1VWPB 2OF8A 4NV8A 4BX6B 4I3DA 1MX7A 2R56A 4OS8A 3HPEA 5H9AA 1O1UA 1GKAA 2CBRA 1HMTA 2RD7C 5EEDA 4COTA 3VHHA 1SWNA 2BS5A 4Y59A 3S5VA 4EXZA 1BRPA 2MHDA 1JBHA 1EALA 4QAEA 1KL4A 1A18A 2FKGA 3CKGA 5D45A 1HMSA 3PPTA 3WJFA 1N9MA 4OMXA 3VG3A 1FTPA 3EMMA 2LFOA 1BEBA 4CDFA 1SWLA 1GX9A 1YWDA 4ZR2A 4EEJA 3F8AA 3NBXX 5F6ZA 3RKGA 5K06A 3HWFA 3BU1A 4TNNA 5HZ5A 1SLEB 1WUBA 4BCSA 5HCCC 1UZ2X 3FYFA 5D48A 1I78A 4IMOA 3WBGA 3OE3A 1GT5A 2A2UA 1FDQA 1LIFA 1N4JA 4YCHA 1I06A 4HWMA 4KC7A 4ZJ0A 4QZTA 1PBYA 1QWDA 1VPRA 2RTIB 2WPUA 4U8UO 4WFVA 4BVMA 3JS1A 4NNTA 4ORWA 2VFBA 4Z2VA 1SLDB 1JMXA 1T68X 1JIWI 1AQBA 1NC9A 3C76X 5IO7A 4QYNA 5D47A 4GZVA 1KGLA 1YWAA 3RY1A 1BSYA 2I5VO 3KVNA 3RWXA 3FA7A 4AZNA 2FLJA 3VU1A 1JMZA 1DFVA 3RSWA 1LIDA 5IRUA 4ZH9A 1R0UA 3WYQA 4DQ3A 4CDCA 1IKEA 1VWDB 2FTBA 2JU3A 1SWDA 1VWIB 1SWBA 1YUPA 3EBWA 1JQPA 2OVSA 2IZHB 4LKTA 3KFHA 4KT5A 2HYSA 3BLGA 4O9SA 1XKIA 1SWOA 4XMDA 2IZJA 3DTQA 1VWOB 2A0AA 2K62A 5HCEC 2OL6O 1STRB 4HPDA 4QGWA 4FGIB 1SY2A 3WJCA 1SWHA 5IO5A 4CPEA 5CE4A 5B3MO 1KT7A 3NQKA 3UEXA 2FGSA 1SA8A 2G79A 2A3FX 1X8OA 3MX7A 1KZXA 2CM9A 4HPAA 5LJDA 3HWDA 2O62A 3S26A 4TQ2A 1SWFA 2OL7A 5EDCA 1BLRA 1OEKA 2G8CO 3B2IA 3APUA 4YH0A 1KXOA 1PTSA 2F01A 3KQ0A 1LCZA 2JW1A 1JYJA 1I9HA 3VGWA 1DZMA 3B2KA 2AH7X 3O2YA 1A3YA 3VPJE 1K24A 2OFRX 4UU2A 4AZMA 3CQNA 3RDQA 3WOVA 1I4UA 3MG5A 2IZBA 3ZW1A 1N43A 1SRIA 4OS0A 1L6MA 1PMPA 5IXGA 4TKHA 2L9CA 3VE1A 2RTGB 1JZUA 1Y52X 3ELXA 4WHIA 1O8VA 3EC5A 4R0BA 1MK5A 3FMZA 3I17A 5HA0A 5FQ7E 2RA6A 2POAA 2XKLA 3P6DA 5B5FA 2GJ5A 3FELA 3ZW0A 3MM0A 1CJ5A 1VYFA 3O19A 2RCQA 3EBKA 4FQBB 5LKFA 1KL5A 3AKNA 4DCBA 4U8UM 1G5WA 3FEPA 1JJJA 5KICA 5HTDA 1OPBA 1MEPA 3S5XA 1RSUB 1TOUA 1SWJA 3UAQA 1H91A 3BDRA 3PP6A 1YP7A 1GT1A 2OY8A 3ZUOA 2Z4HA 4L3RA 5DPQA 4ALBA 1K3BA 5IRWA 1PM1X 4NLIA 3CKFA 2JU8A 4GU8A 3KFGA 3TGAA 3UEUA 1YWCA 4BGFA 2C1QA 1TXLA 1E06A 3PDFA 2FKJA 4CV7A 1E00A 2W2FA 1NDJA 4GKCA 1HN2A 1SLFB 1G85A 1Y53X 2X45A 2IZDB 5F1EA 1W4TA 3X00A 3PECA 1DZKA 5AJBA 5H9NA 1RAVA 4L1NA 3P6GA 4ZHHA 1PEEA 3P24A 4ORUA 1TOWA 1SWQA 3WYPA 4AZOA 5JR8A 4LKPA 4ZHFA 4QNIA 4FBOA 2AL0X 4Y5DA 4LZUA 4DNEA 2X34A 1KT3A 5DG4A 3HWEA 4MVLA 4HPBA 1DF8A 4M6SA 2G78A 3TZSA 2WEXA 2ACOA 3WJEA 4EFGA 1AVEA 3FEKA 3QQ2A 1NQMA 3FDCA 2HZRA 1GT3A 1FJ1E 4BJ8A 1CBRA 3LV4A 2OY7A 3RE5A 1BSQA 2BLGA 5F58A 2RTFB 1QFVA 1ZNKA 2AF5A 2X4MA 2BS6A 3RZYA 2I5ZO 5L8OA 4RUNA 4ZCBA 5EDBA 3D4RA 3CBCA 1VWLB 3NP1A 3IA8A 4N7DA 3KFFA 2HZQA 1T8VA 4MVEA 1N7YA 1SWGA 4AZRA 4A8ZA 5KIDA 1RBPA 2A13A 2ZAGA 1OSPO 2FT9A 3LTWA 4A60A 4GGTA 1ERXA 3T2WA 1SLGB 5HA1A 4XMEA 2X32A 1BJ7A 3BS2A 4HPCA 4FBRA 4U3QA 4XMFA 5H8TA 3SLJA 1LUQA 1S44A 1JV4A 1GKAB 2W2BA 5JD2A 2AT5X 5EZ2A 1KZWA 3FENA 4O3YA 2A8GA 3BY0A 4O4XA 1RXKA 4IABA 4GJVA 3V8UA 1D2UA 1GX8A 4KIIA 5HZ9A 4MIRA 3P6CA 1ACDA 4GETA 2IZEB 2MM3A 2QO4A 4YKMA 3CQRA 3WZNA 3DSZA 5B29A 1NGLA 3CWKA 1VWMB 3IFBA 4IB8A 1JJUA 1RSTB 2QOSC 4Z2OA 4ID2A 2Q39A 1IKJA 1I04A 2KW1A 1U18A 2RCTA 4UU3A 1LELA 4YBPA 2BT9A 1EUOA 4YGHA 4NLJA 3TGCA 2IZFB 1QY0A 1IFCA 1N9YA 1QFTA 2MO5A 4BX5A 1VYGA 1EIOA 3AUMO 1SWAA 4PSQA 5D4AA 2QO6A 2CBSA 5B5GA 4BX7A 3STNA 1NP4A 1VWBB 3SLTA 3EM0A 5K68A 1OPAA 1SY0A 3P6HA 4JO6A 2RTJA 1LCWA 3Q6LA 1TW4A 5IRAA 1SWEA 2WEWA 3UEWA 3LHNA 4ZHGA 2ACPX 3TF6A 1KT5A 5B10O 3F6ZB 4QZUA 1E02A 2BC3A 2RTMA 4U8UN 4I3BA 3VG6A 4Y0RA 4CK4A 4CPHB 2FR2A 1B0OA 2OL8O 5HTEA 4D6BA 4EQAC 1SY3A 2C1SA 2X8SA 4I95A 4KC8A 1VWNB 1Y55X 2ASNX 2AT3X 2OFBA 2CZTA 1A57A 1EPBA 1MX8A 2GC9A 3D9WA 2RTHB 1T0VA 2WQ9A 3D97A 4NNSA 3B2JA 3RBYA 3SAOA 3ZW2A 4AZQA 1HBQA 3HOEA 4IRWA 1SWTA 1KL3A 2WQAE 1IJ8A 4QYPA 1B8EA 1Y0GA 1RXHA 2C4IA 1LKEA 4GH7A 4GNWA 4QRLA 1ZRYA 4OMWA 3VG4A 3ZQ3A 4Z2PA 1ZNLA 3NQ9A 4GNYA 5C0NA 2LB6A 1G74A 1PBOA 2NP1A 5B2AO 3STMX 2ALLX 1HQQA 1VWFB 2JOZA 5AEOA 1QQSA 4ZGFA 2FS6A 2W2AA 2WWPA 2AVIA 2NNDA 3SZIA 4IMNA 1LICA 4TJZA 4ORXA 1LDQA 1STPA 2JN3A 2LBAA 2Y32A 1NP1A 1SRFA 1KT4A 3PEDA 4XMGA 1OBQA 2RTNB 2JMBA 1BWYA 1LDOA 2M4LA 1SWCA 2QMIA 2YMSA 4CDDA 4LQZA 1U0XA 2OFMX 5BVSA 3ZW1B 3ELZA 5LJBA 2ZSCA 4GDZA 3RDMA 5IO6A 4JHQA 5FQ6E 2HLVA 2RTRB 4XMCA 4AYHA 2EU7X 3FW4A 1EW3A 1X8PA 1W6FA 4MEEA 3E3CA 1ALBA 1SXUA 1EIIA 2OVDA 3CMPA 3UEVA 1AVDA 2QCBA 3D96A 4NV7A 1EPAA 1VWEB 3ZW0B 3GAQA 3VG5A 5HZ6A 1KQWA 2YG2A 1MM9A 3HTYA 3ZWEA 1RXJA 4M7MA 3TGBA 4ZFXA 1UREA 5FAZA 2RTEB 3F9DA 4I6SA 3AEHA 3U9PC 1DV9A 1U17A 3BRNA 4YFRA 3BX7A 4HFOA 4ZH6A 4GK9A 2IZGB 4CDEA 2R73A 3VG2A 2AT8X 1X8UA 4Y0QA 4O4OA 2A5BA 1LNMA 2RTLA 3FIQA 1FELA 1Y9TA 1FENA 1HQPA 1ML7A 2NNEA 3P6FA 4YDBA 3RDOA 1SRGA 5AQ6A 3WZOA 2HMBA 5L3YA 1OEEA 4EDEA 1ADLA 2Z4IA 2FHNX 3FA8A 3O22A 1B56A 1GXAA 2VDFA 3BX8A 1SXXA 4YVBA 3VHMA 3ZI8A 4O49A 2X8FA 2Q2PA 5KHPA 2IZAA 3U0DA 1E5PA 1HY2A 1LPJA 5LJEA 2BHVA 3WJDA 4BX6A 4OS3A 4ZGUA 1DZPA 1CBIA 3STKA 4ORSA 3C78X 2RTQB 1SWUA 2OZQA 1VWRB 1P6PA 2DJGA 1BRQA 4Z27A 1LCVA 1SXYA 2IFBA 3FW5A 4I60A 3EW2A 3MBTA 2CM4A 2A5CA 1LFOA 4TKBA 2N93A 1VWHB 1MOYA 1RLBE 2L67A 4IB6A 4YCEA 4MVIA 2KTSA 2IZLB 2Y3EA 5LJHA 1KFFA 1YP6A 3S60A 3GE2A 1LIEA 3NQ3A 1GGLA 2LKKA 2Q2MA 3PQUA 3CBSA 3OJYC 4A1HA 4ON1A 1X89A 4O3WA 1A2DA 4Y0PA 4GGRA 3NR3A 4NW4A 3RDXA 1VWKB 4YKOA 2AT0X 4GGZA 2IZIA 3I0AA 4ES7A 4DQ4A 3RE6A 4IB9A 1GX3A 4O3XB 1VWGB 5B27A 3FR2A 5CHKA 2JGSA 1OBUA 4EKVA 2RTOB 3H3IA 3EW1A 3PQSA 5HZ8A 2RQ0A 3T6LA 2G7BA 1BSOA 2RTKA 3OD9A 4GRJA 3APXA 2P8GA 3WJGA 4D6AA 2IZKA 1DZJA 1EI5A 3SLOA 4O4SA 3T1DA 1IW2A 2ZAIA 1SWRA 4OELA 2FHLA 3B2LA 3HK1A 1KOIA 1SMPI 2CAMA 5EEEA 1JYDA 1ZNEA 2QOMA 3FA9A 5H9KA 2FRSA 3SOTA 3WJBA 4ALOA 4CSBA 5AJCA 1BM5A 4PJ2A 2FS7A 4IAWA 4TKJA 4U9CA 4AW8A 1ICNA 2JU7A 4YGGA 1CRBA 1UYNX 4GUZA 4WFUA 5FENA 2AKQA 2DJFA 4NYQA 3OBLA 5EPQA 1G7NA 4LZVA 4U46A 2RTDB 1SWPA 3D95A 2Y3FA 1QY1A 2MWHA 1W5RA 2PY1A 2HKDA 3MVFA 3NADA 4BX5B 5D8JA 4Z6JA 4BX7B 3WVMA 3KFIA 1E2TA 1ZNHA 2GTLO 3APWA 3KZAA 3JQOA 3FIDA 5CYBA 4CPHA 2L68A 5LJKA 1IIUA 1KT6A 2IZCB 1ZNGA 5LJCA 1O1VA 3FR4A 4A1YA 1MDCA 4B55A 5BVQA 3G7XA 3FA6A 3K3LA 3WZQA 3CR6A 2X8TA 3FR5A 1HXZA 3PK2A 4YFQA 5F2BA 5F6BA 1X8QA 5HBSA 5K67A 2XSTA 4QGXA 4KH8A 4MVKA 1NBXA 1NQNA 1ZNDA 2ANSA 2UYWA 2FR3A 1SRHA 2VFCA 1FE3A 1Y9LA 2KD2A 3AKMA 3C77X 4AZPA 1SXWA 4ORRA 2RTBB 2WUTA 2PI3O 1MVGA 4KCAA 2X55A 2OVEA 4O3ZA 5HZQA 4Z28A 2L5PA 3PH5A 4CPFA 2GTFX 4GDAA 2OF9A 4N7CA 1X8NA 2Q4NA 1X71A 2LA7A 1HBPA 2WSJA 2RTPB 3QKGA 2QO5A 2RTAA 3P02A 2GTLN 2OY5O 2HNXA 3PH6A 2RN4A 5H9LA 1OEJA 2R74A 2F73A 2OY1O 1BBPA 1VWQB 1WBIA 2BSZA 4OEMA 4GE1A 5FFHA 2RTCB 1UYOX 1CBSA 3N91A 3RY2A 4OKAA 1ERBA 3VE2A 2MJIA 1KQXA 4I3CA 4I9SA 3HOLA 4QQ1A 4ML7B 5L8IA 1VWJB 1MUPA 2G5LA 3FLLA 2CZUA 4TLJA 4Y0SA 4BQUA 1VWAB 2X56A 3P6EA 4JGLA 1LF7A 1SY1A 1VWCB 2DM5A 2QM9A 4RUUA 5CSEA 4NYRA 4QGVA 4JNJA 1GT4A 1GM6A 3ZUIA 2KT4B 4GD9A 2WR6A 4IB7A 5HAEA 3Q34A 4IAXA 2Q9SA 3T6FA 5F7GA 4YMYA 5LKEA 3VG7A 4INNA 1TVQA 1I05A 3SZJA 2OYBO 2NNQA 3BSZE 4I9RA 3U03A 5LJGA 4ODDA 3ZZVA 4C5PA 3WZPA 1S7DA 1XCAA 4CPIA 1AELA 1HXLA 1B4MA 3NPOA 4ZHDA 3NX1A 2LBVA 2E4JA 2GTLM 2K23A 2A2GA 2FWVA 4ARHA 3JSQA 1SWKA 4O4UA 3WXQA 1YIVA 5BVTA 1HMRA 1YWBA 2AT6X 1CBQA 4IBAA 1DF3A 3B2HA 4BBOA 1FEMA 1AVGI 1N0SA 4GJSA 3APVA 5FQ8E 3RDSA 1JJXA 1VYOA 4BOEA 4ORYA 2GH7A 3RDUA 1LIBA 1ICMA 1DC9A 1STSB 3EYCA 5B11O 4WBKA 2MF6A 2F09A 3L4RA
chains in the Genus database with same CATH topology
3T6LA 3MM0A 2C1SA 2RTKA 3SZHA 2UZ2A 1VWNB 1Y55X 1KL5A 2IZKA 2OFBA 1SWSA 1SREA 1MEPA 1RSUB 1SWRA 2RTHB 1SWJA 3VHIA 2FHLA 2CAMA 5IRWA 4IRWA 1SWTA 1KL3A 1IJ8A 2C4IA 1RXHA 1SRJA 3T2XA 2C1QA 2OFAA 4Z2PA 4BX6B 1VWPB 2OF8A 1NDJA 1SLFB 1HQQA 1VWFB 1Y53X 2IZDB 1SWNA 4Y59A 3VHHA 2AVIA 3SZIA 3X00A 4U46A 2RTDB 1SWPA 1KL4A 1STPA 1LDQA 2Y32A 2Y3FA 1RAVA 4BX5B 4Z6JA 1SRFA 1N9MA 4BX7B 1SWQA 3WYPA 4CPHA 4DNEA 1SWLA 2RTNB 4Y5DA 1LDOA 1SWCA 2IZCB 1DF8A 1SLEB 4BCSA 2ZSCA 3RDMA 1AVEA 3WZQA 4JHQA 5B5FA 1NQMA 2RTRB 3FDCA 3PK2A 5K67A 1HXZA 5F2BA 4BJ8A 3RE5A 2RTFB 1N4JA 1NBXA 1AVDA 1NQNA 2QCBA 2UYWA 3T6FA 1SRHA 1VWEB 2RTIB 2WPUA 2RTBB 1MM9A 4Z2VA 1RXJA 1SLDB 1VWLB 4Z28A 1NC9A 4CPFA 4GDAA 2OF9A 2RTEB 3RY1A 1N7YA 1SWGA 2RTPB 2RTAA 2IZGB 5IRUA 4GGTA 3T2WA 3WYQA 1SLGB 1VWDB 1VWQB 1WBIA 1SWDA 1VWIB 1SWBA 2A5BA 2RTLA 2IZHB 2RTCB 1LUQA 3RDOA 1SRGA 4OKAA 3RY2A 1SWOA 3WZOA 2IZJA 5L3YA 1VWOB 5JD2A 1STRB 2FHNX 2A8GA 1RXKA 1VWJB 4YVBA 1SWHA 2G5LA 4GJVA 3VHMA 4CPEA 1VWAB 2IZAA 3WZNA 2IZEB 1HY2A 1VWCB 5CSEA 1VWMB 4JNJA 4BX6A 1RSTB 4GD9A 4Z2OA 2RTQB 1SWUA 1LELA 1SWFA 1VWRB 4Z27A 3SZJA 1LCVA 4I60A 3EW2A 2IZFB 1PTSA 2A5CA 2F01A 1LCZA 1N9YA 4BX5A 1VWHB 1I9HA 1MOYA 1SWAA 5B5GA 3VGWA 3WZPA 4BX7A 4CPIA 1HXLA 1VWBB 2IZLB 2Y3EA 1KFFA 5K68A 4JO6A 2RTJA 3RDQA 1LCWA 3MG5A 1SWKA 2IZBA 1N43A 1SRIA 4GGRA 1SWEA 5IRAA 3RDXA 1VWKB 2RTGB 4BBOA 4GJSA 4GGZA 2IZIA 3RDSA 1Y52X 3RE6A 1VYOA 1MK5A 1VWGB 2GH7A 3RDUA 5CHKA 2JGSA 1STSB 2BC3A 2RTMA 4CPHB 2RTOB 4EKVA 2MF6A 3EW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T6L A;  3MM0 A;  2C1S A;  2RTK A;  3SZH A;  2UZ2 A;  1VWN B;  1Y55 X;  1KL5 A;  2IZK A;  2OFB A;  1SWS A;  1SRE A;  1MEP A;  1RSU B;  1SWR A;  2RTH B;  1SWJ A;  3VHI A;  2FHL A;  2CAM A;  5IRW A;  4IRW A;  1SWT A;  1KL3 A;  1IJ8 A;  2C4I A;  1RXH A;  1SRJ A;  3T2X A;  2C1Q A;  2OFA A;  4Z2P A;  4BX6 B;  1VWP B;  2OF8 A;  1NDJ A;  1SLF B;  1HQQ A;  1VWF B;  1Y53 X;  2IZD B;  1SWN A;  4Y59 A;  3VHH A;  2AVI A;  3SZI A;  3X00 A;  4U46 A;  2RTD B;  1SWP A;  1KL4 A;  1STP A;  1LDQ A;  2Y32 A;  2Y3F A;  1RAV A;  4BX5 B;  4Z6J A;  1SRF A;  1N9M A;  4BX7 B;  1SWQ A;  3WYP A;  4CPH A;  4DNE A;  1SWL A;  2RTN B;  4Y5D A;  1LDO A;  1SWC A;  2IZC B;  1DF8 A;  1SLE B;  4BCS A;  2ZSC A;  3RDM A;  1AVE A;  3WZQ A;  4JHQ A;  5B5F A;  1NQM A;  2RTR B;  3FDC A;  3PK2 A;  5K67 A;  1HXZ A;  5F2B A;  4BJ8 A;  3RE5 A;  2RTF B;  1N4J A;  1NBX A;  1AVD A;  1NQN A;  2QCB A;  2UYW A;  3T6F A;  1SRH A;  1VWE B;  2RTI B;  2WPU A;  2RTB B;  1MM9 A;  4Z2V A;  1RXJ A;  1SLD B;  1VWL B;  4Z28 A;  1NC9 A;  4CPF A;  4GDA A;  2OF9 A;  2RTE B;  3RY1 A;  1N7Y A;  1SWG A;  2RTP B;  2RTA A;  2IZG B;  5IRU A;  4GGT A;  3T2W A;  3WYQ A;  1SLG B;  1VWD B;  1VWQ B;  1WBI A;  1SWD A;  1VWI B;  1SWB A;  2A5B A;  2RTL A;  2IZH B;  2RTC B;  1LUQ A;  3RDO A;  1SRG A;  4OKA A;  3RY2 A;  1SWO A;  3WZO A;  2IZJ A;  5L3Y A;  1VWO B;  5JD2 A;  1STR B;  2FHN X;  2A8G A;  1RXK A;  1VWJ B;  4YVB A;  1SWH A;  2G5L A;  4GJV A;  3VHM A;  4CPE A;  1VWA B;  2IZA A;  3WZN A;  2IZE B;  1HY2 A;  1VWC B;  5CSE A;  1VWM B;  4JNJ A;  4BX6 A;  1RST B;  4GD9 A;  4Z2O A;  2RTQ B;  1SWU A;  1LEL A;  1SWF A;  1VWR B;  4Z27 A;  3SZJ A;  1LCV A;  4I60 A;  3EW2 A;  2IZF B;  1PTS A;  2A5C A;  2F01 A;  1LCZ A;  1N9Y A;  4BX5 A;  1VWH B;  1I9H A;  1MOY A;  1SWA A;  5B5G A;  3VGW A;  3WZP A;  4BX7 A;  4CPI A;  1HXL A;  1VWB B;  2IZL B;  2Y3E A;  1KFF A;  5K68 A;  4JO6 A;  2RTJ A;  3RDQ A;  1LCW A;  3MG5 A;  1SWK A;  2IZB A;  1N43 A;  1SRI A;  4GGR A;  1SWE A;  5IRA A;  3RDX A;  1VWK B;  2RTG B;  4BBO A;  4GJS A;  4GGZ A;  2IZI A;  3RDS A;  1Y52 X;  3RE6 A;  1VYO A;  1MK5 A;  1VWG B;  2GH7 A;  3RDU A;  5CHK A;  2JGS A;  1STS B;  2BC3 A;  2RTM A;  4CPH B;  2RTO B;  4EKV A;  2MF6 A;  3EW1 A; 
#chains in the Genus database with same CATH topology
 5BYP A;  2OVA A;  4K19 A;  3SZH A;  4YFP A;  2UZ2 A;  4YBU A;  4ZHC A;  1EXS A;  1SWS A;  4MIS A;  1SRE A;  1Z24 A;  4NP1 A;  3HWG A;  5L8N A;  3VHI A;  2X46 A;  1EQD A;  4XMH A;  1S2P A;  4FBV A;  4YGZ A;  1IFB A;  1D3S A;  1QG5 A;  1AB0 A;  5HWZ A;  1SRJ A;  3BU9 A;  4YDA A;  2OFA A;  3T2X A;  2AMM X;  5HCD C;  2KTD A;  3NX2 A;  1OBP A;  1QAB E;  1QY2 A;  1VWP B;  2OF8 A;  4NV8 A;  4BX6 B;  4I3D A;  1MX7 A;  2R56 A;  4OS8 A;  3HPE A;  5H9A A;  1O1U A;  1GKA A;  2CBR A;  1HMT A;  2RD7 C;  5EED A;  4COT A;  3VHH A;  1SWN A;  2BS5 A;  4Y59 A;  3S5V A;  4EXZ A;  1BRP A;  2MHD A;  1JBH A;  1EAL A;  4QAE A;  1KL4 A;  1A18 A;  2FKG A;  3CKG A;  5D45 A;  1HMS A;  3PPT A;  3WJF A;  1N9M A;  4OMX A;  3VG3 A;  1FTP A;  3EMM A;  2LFO A;  1BEB A;  4CDF A;  1SWL A;  1GX9 A;  1YWD A;  4ZR2 A;  4EEJ A;  3F8A A;  3NBX X;  5F6Z A;  3RKG A;  5K06 A;  3HWF A;  3BU1 A;  4TNN A;  5HZ5 A;  1SLE B;  1WUB A;  4BCS A;  5HCC C;  1UZ2 X;  3FYF A;  5D48 A;  1I78 A;  4IMO A;  3WBG A;  3OE3 A;  1GT5 A;  2A2U A;  1FDQ A;  1LIF A;  1N4J A;  4YCH A;  1I06 A;  4HWM A;  4KC7 A;  4ZJ0 A;  4QZT A;  1PBY A;  1QWD A;  1VPR A;  2RTI B;  2WPU A;  4U8U O;  4WFV A;  4BVM A;  3JS1 A;  4NNT A;  4ORW A;  2VFB A;  4Z2V A;  1SLD B;  1JMX A;  1T68 X;  1JIW I;  1AQB A;  1NC9 A;  3C76 X;  5IO7 A;  4QYN A;  5D47 A;  4GZV A;  1KGL A;  1YWA A;  3RY1 A;  1BSY A;  2I5V O;  3KVN A;  3RWX A;  3FA7 A;  4AZN A;  2FLJ A;  3VU1 A;  1JMZ A;  1DFV A;  3RSW A;  1LID A;  5IRU A;  4ZH9 A;  1R0U A;  3WYQ A;  4DQ3 A;  4CDC A;  1IKE A;  1VWD B;  2FTB A;  2JU3 A;  1SWD A;  1VWI B;  1SWB A;  1YUP A;  3EBW A;  1JQP A;  2OVS A;  2IZH B;  4LKT A;  3KFH A;  4KT5 A;  2HYS A;  3BLG A;  4O9S A;  1XKI A;  1SWO A;  4XMD A;  2IZJ A;  3DTQ A;  1VWO B;  2A0A A;  2K62 A;  5HCE C;  2OL6 O;  1STR B;  4HPD A;  4QGW A;  4FGI B;  1SY2 A;  3WJC A;  1SWH A;  5IO5 A;  4CPE A;  5CE4 A;  5B3M O;  1KT7 A;  3NQK A;  3UEX A;  2FGS A;  1SA8 A;  2G79 A;  2A3F X;  1X8O A;  3MX7 A;  1KZX A;  2CM9 A;  4HPA A;  5LJD A;  3HWD A;  2O62 A;  3S26 A;  4TQ2 A;  1SWF A;  2OL7 A;  5EDC A;  1BLR A;  1OEK A;  2G8C O;  3B2I A;  3APU A;  4YH0 A;  1KXO A;  1PTS A;  2F01 A;  3KQ0 A;  1LCZ A;  2JW1 A;  1JYJ A;  1I9H A;  3VGW A;  1DZM A;  3B2K A;  2AH7 X;  3O2Y A;  1A3Y A;  3VPJ E;  1K24 A;  2OFR X;  4UU2 A;  4AZM A;  3CQN A;  3RDQ A;  3WOV A;  1I4U A;  3MG5 A;  2IZB A;  3ZW1 A;  1N43 A;  1SRI A;  4OS0 A;  1L6M A;  1PMP A;  5IXG A;  4TKH A;  2L9C A;  3VE1 A;  2RTG B;  1JZU A;  1Y52 X;  3ELX A;  4WHI A;  1O8V A;  3EC5 A;  4R0B A;  1MK5 A;  3FMZ A;  3I17 A;  5HA0 A;  5FQ7 E;  2RA6 A;  2POA A;  2XKL A;  3P6D A;  5B5F A;  2GJ5 A;  3FEL A;  3ZW0 A;  3MM0 A;  1CJ5 A;  1VYF A;  3O19 A;  2RCQ A;  3EBK A;  4FQB B;  5LKF A;  1KL5 A;  3AKN A;  4DCB A;  4U8U M;  1G5W A;  3FEP A;  1JJJ A;  5KIC A;  5HTD A;  1OPB A;  1MEP A;  3S5X A;  1RSU B;  1TOU A;  1SWJ A;  3UAQ A;  1H91 A;  3BDR A;  3PP6 A;  1YP7 A;  1GT1 A;  2OY8 A;  3ZUO A;  2Z4H A;  4L3R A;  5DPQ A;  4ALB A;  1K3B A;  5IRW A;  1PM1 X;  4NLI A;  3CKF A;  2JU8 A;  4GU8 A;  3KFG A;  3TGA A;  3UEU A;  1YWC A;  4BGF A;  2C1Q A;  1TXL A;  1E06 A;  3PDF A;  2FKJ A;  4CV7 A;  1E00 A;  2W2F A;  1NDJ A;  4GKC A;  1HN2 A;  1SLF B;  1G85 A;  1Y53 X;  2X45 A;  2IZD B;  5F1E A;  1W4T A;  3X00 A;  3PEC A;  1DZK A;  5AJB A;  5H9N A;  1RAV A;  4L1N A;  3P6G A;  4ZHH A;  1PEE A;  3P24 A;  4ORU A;  1TOW A;  1SWQ A;  3WYP A;  4AZO A;  5JR8 A;  4LKP A;  4ZHF A;  4QNI A;  4FBO A;  2AL0 X;  4Y5D A;  4LZU A;  4DNE A;  2X34 A;  1KT3 A;  5DG4 A;  3HWE A;  4MVL A;  4HPB A;  1DF8 A;  4M6S A;  2G78 A;  3TZS A;  2WEX A;  2ACO A;  3WJE A;  4EFG A;  1AVE A;  3FEK A;  3QQ2 A;  1NQM A;  3FDC A;  2HZR A;  1GT3 A;  1FJ1 E;  4BJ8 A;  1CBR A;  3LV4 A;  2OY7 A;  3RE5 A;  1BSQ A;  2BLG A;  5F58 A;  2RTF B;  1QFV A;  1ZNK A;  2AF5 A;  2X4M A;  2BS6 A;  3RZY A;  2I5Z O;  5L8O A;  4RUN A;  4ZCB A;  5EDB A;  3D4R A;  3CBC A;  1VWL B;  3NP1 A;  3IA8 A;  4N7D A;  3KFF A;  2HZQ A;  1T8V A;  4MVE A;  1N7Y A;  1SWG A;  4AZR A;  4A8Z A;  5KID A;  1RBP A;  2A13 A;  2ZAG A;  1OSP O;  2FT9 A;  3LTW A;  4A60 A;  4GGT A;  1ERX A;  3T2W A;  1SLG B;  5HA1 A;  4XME A;  2X32 A;  1BJ7 A;  3BS2 A;  4HPC A;  4FBR A;  4U3Q A;  4XMF A;  5H8T A;  3SLJ A;  1LUQ A;  1S44 A;  1JV4 A;  1GKA B;  2W2B A;  5JD2 A;  2AT5 X;  5EZ2 A;  1KZW A;  3FEN A;  4O3Y A;  2A8G A;  3BY0 A;  4O4X A;  1RXK A;  4IAB A;  4GJV A;  3V8U A;  1D2U A;  1GX8 A;  4KII A;  5HZ9 A;  4MIR A;  3P6C A;  1ACD A;  4GET A;  2IZE B;  2MM3 A;  2QO4 A;  4YKM A;  3CQR A;  3WZN A;  3DSZ A;  5B29 A;  1NGL A;  3CWK A;  1VWM B;  3IFB A;  4IB8 A;  1JJU A;  1RST B;  2QOS C;  4Z2O A;  4ID2 A;  2Q39 A;  1IKJ A;  1I04 A;  2KW1 A;  1U18 A;  2RCT A;  4UU3 A;  1LEL A;  4YBP A;  2BT9 A;  1EUO A;  4YGH A;  4NLJ A;  3TGC A;  2IZF B;  1QY0 A;  1IFC A;  1N9Y A;  1QFT A;  2MO5 A;  4BX5 A;  1VYG A;  1EIO A;  3AUM O;  1SWA A;  4PSQ A;  5D4A A;  2QO6 A;  2CBS A;  5B5G A;  4BX7 A;  3STN A;  1NP4 A;  1VWB B;  3SLT A;  3EM0 A;  5K68 A;  1OPA A;  1SY0 A;  3P6H A;  4JO6 A;  2RTJ A;  1LCW A;  3Q6L A;  1TW4 A;  5IRA A;  1SWE A;  2WEW A;  3UEW A;  3LHN A;  4ZHG A;  2ACP X;  3TF6 A;  1KT5 A;  5B10 O;  3F6Z B;  4QZU A;  1E02 A;  2BC3 A;  2RTM A;  4U8U N;  4I3B A;  3VG6 A;  4Y0R A;  4CK4 A;  4CPH B;  2FR2 A;  1B0O A;  2OL8 O;  5HTE A;  4D6B A;  4EQA C;  1SY3 A;  2C1S A;  2X8S A;  4I95 A;  4KC8 A;  1VWN B;  1Y55 X;  2ASN X;  2AT3 X;  2OFB A;  2CZT A;  1A57 A;  1EPB A;  1MX8 A;  2GC9 A;  3D9W A;  2RTH B;  1T0V A;  2WQ9 A;  3D97 A;  4NNS A;  3B2J A;  3RBY A;  3SAO A;  3ZW2 A;  4AZQ A;  1HBQ A;  3HOE A;  4IRW A;  1SWT A;  1KL3 A;  2WQA E;  1IJ8 A;  4QYP A;  1B8E A;  1Y0G A;  1RXH A;  2C4I A;  1LKE A;  4GH7 A;  4GNW A;  4QRL A;  1ZRY A;  4OMW A;  3VG4 A;  3ZQ3 A;  4Z2P A;  1ZNL A;  3NQ9 A;  4GNY A;  5C0N A;  2LB6 A;  1G74 A;  1PBO A;  2NP1 A;  5B2A O;  3STM X;  2ALL X;  1HQQ A;  1VWF B;  2JOZ A;  5AEO A;  1QQS A;  4ZGF A;  2FS6 A;  2W2A A;  2WWP A;  2AVI A;  2NND A;  3SZI A;  4IMN A;  1LIC A;  4TJZ A;  4ORX A;  1LDQ A;  1STP A;  2JN3 A;  2LBA A;  2Y32 A;  1NP1 A;  1SRF A;  1KT4 A;  3PED A;  4XMG A;  1OBQ A;  2RTN B;  2JMB A;  1BWY A;  1LDO A;  2M4L A;  1SWC A;  2QMI A;  2YMS A;  4CDD A;  4LQZ A;  1U0X A;  2OFM X;  5BVS A;  3ZW1 B;  3ELZ A;  5LJB A;  2ZSC A;  4GDZ A;  3RDM A;  5IO6 A;  4JHQ A;  5FQ6 E;  2HLV A;  2RTR B;  4XMC A;  4AYH A;  2EU7 X;  3FW4 A;  1EW3 A;  1X8P A;  1W6F A;  4MEE A;  3E3C A;  1ALB A;  1SXU A;  1EII A;  2OVD A;  3CMP A;  3UEV A;  1AVD A;  2QCB A;  3D96 A;  4NV7 A;  1EPA A;  1VWE B;  3ZW0 B;  3GAQ A;  3VG5 A;  5HZ6 A;  1KQW A;  2YG2 A;  1MM9 A;  3HTY A;  3ZWE A;  1RXJ A;  4M7M A;  3TGB A;  4ZFX A;  1URE A;  5FAZ A;  2RTE B;  3F9D A;  4I6S A;  3AEH A;  3U9P C;  1DV9 A;  1U17 A;  3BRN A;  4YFR A;  3BX7 A;  4HFO A;  4ZH6 A;  4GK9 A;  2IZG B;  4CDE A;  2R73 A;  3VG2 A;  2AT8 X;  1X8U A;  4Y0Q A;  4O4O A;  2A5B A;  1LNM A;  2RTL A;  3FIQ A;  1FEL A;  1Y9T A;  1FEN A;  1HQP A;  1ML7 A;  2NNE A;  3P6F A;  4YDB A;  3RDO A;  1SRG A;  5AQ6 A;  3WZO A;  2HMB A;  5L3Y A;  1OEE A;  4EDE A;  1ADL A;  2Z4I A;  2FHN X;  3FA8 A;  3O22 A;  1B56 A;  1GXA A;  2VDF A;  3BX8 A;  1SXX A;  4YVB A;  3VHM A;  3ZI8 A;  4O49 A;  2X8F A;  2Q2P A;  5KHP A;  2IZA A;  3U0D A;  1E5P A;  1HY2 A;  1LPJ A;  5LJE A;  2BHV A;  3WJD A;  4BX6 A;  4OS3 A;  4ZGU A;  1DZP A;  1CBI A;  3STK A;  4ORS A;  3C78 X;  2RTQ B;  1SWU A;  2OZQ A;  1VWR B;  1P6P A;  2DJG A;  1BRQ A;  4Z27 A;  1LCV A;  1SXY A;  2IFB A;  3FW5 A;  4I60 A;  3EW2 A;  3MBT A;  2CM4 A;  2A5C A;  1LFO A;  4TKB A;  2N93 A;  1VWH B;  1MOY A;  1RLB E;  2L67 A;  4IB6 A;  4YCE A;  4MVI A;  2KTS A;  2IZL B;  2Y3E A;  5LJH A;  1KFF A;  1YP6 A;  3S60 A;  3GE2 A;  1LIE A;  3NQ3 A;  1GGL A;  2LKK A;  2Q2M A;  3PQU A;  3CBS A;  3OJY C;  4A1H A;  4ON1 A;  1X89 A;  4O3W A;  1A2D A;  4Y0P A;  4GGR A;  3NR3 A;  4NW4 A;  3RDX A;  1VWK B;  4YKO A;  2AT0 X;  4GGZ A;  2IZI A;  3I0A A;  4ES7 A;  4DQ4 A;  3RE6 A;  4IB9 A;  1GX3 A;  4O3X B;  1VWG B;  5B27 A;  3FR2 A;  5CHK A;  2JGS A;  1OBU A;  4EKV A;  2RTO B;  3H3I A;  3EW1 A;  3PQS A;  5HZ8 A;  2RQ0 A;  3T6L A;  2G7B A;  1BSO A;  2RTK A;  3OD9 A;  4GRJ A;  3APX A;  2P8G A;  3WJG A;  4D6A A;  2IZK A;  1DZJ A;  1EI5 A;  3SLO A;  4O4S A;  3T1D A;  1IW2 A;  2ZAI A;  1SWR A;  4OEL A;  2FHL A;  3B2L A;  3HK1 A;  1KOI A;  1SMP I;  2CAM A;  5EEE A;  1JYD A;  1ZNE A;  2QOM A;  3FA9 A;  5H9K A;  2FRS A;  3SOT A;  3WJB A;  4ALO A;  4CSB A;  5AJC A;  1BM5 A;  4PJ2 A;  2FS7 A;  4IAW A;  4TKJ A;  4U9C A;  4AW8 A;  1ICN A;  2JU7 A;  4YGG A;  1CRB A;  1UYN X;  4GUZ A;  4WFU A;  5FEN A;  2AKQ A;  2DJF A;  4NYQ A;  3OBL A;  5EPQ A;  1G7N A;  4LZV A;  4U46 A;  2RTD B;  1SWP A;  3D95 A;  2Y3F A;  1QY1 A;  2MWH A;  1W5R A;  2PY1 A;  2HKD A;  3MVF A;  3NAD A;  4BX5 B;  5D8J A;  4Z6J A;  4BX7 B;  3WVM A;  3KFI A;  1E2T A;  1ZNH A;  2GTL O;  3APW A;  3KZA A;  3JQO A;  3FID A;  5CYB A;  4CPH A;  2L68 A;  5LJK A;  1IIU A;  1KT6 A;  2IZC B;  1ZNG A;  5LJC A;  1O1V A;  3FR4 A;  4A1Y A;  1MDC A;  4B55 A;  5BVQ A;  3G7X A;  3FA6 A;  3K3L A;  3WZQ A;  3CR6 A;  2X8T A;  3FR5 A;  1HXZ A;  3PK2 A;  4YFQ A;  5F2B A;  5F6B A;  1X8Q A;  5HBS A;  5K67 A;  2XST A;  4QGX A;  4KH8 A;  4MVK A;  1NBX A;  1NQN A;  1ZND A;  2ANS A;  2UYW A;  2FR3 A;  1SRH A;  2VFC A;  1FE3 A;  1Y9L A;  2KD2 A;  3AKM A;  3C77 X;  4AZP A;  1SXW A;  4ORR A;  2RTB B;  2WUT A;  2PI3 O;  1MVG A;  4KCA A;  2X55 A;  2OVE A;  4O3Z A;  5HZQ A;  4Z28 A;  2L5P A;  3PH5 A;  4CPF A;  2GTF X;  4GDA A;  2OF9 A;  4N7C A;  1X8N A;  2Q4N A;  1X71 A;  2LA7 A;  1HBP A;  2WSJ A;  2RTP B;  3QKG A;  2QO5 A;  2RTA A;  3P02 A;  2GTL N;  2OY5 O;  2HNX A;  3PH6 A;  2RN4 A;  5H9L A;  1OEJ A;  2R74 A;  2F73 A;  2OY1 O;  1BBP A;  1VWQ B;  1WBI A;  2BSZ A;  4OEM A;  4GE1 A;  5FFH A;  2RTC B;  1UYO X;  1CBS A;  3N91 A;  3RY2 A;  4OKA A;  1ERB A;  3VE2 A;  2MJI A;  1KQX A;  4I3C A;  4I9S A;  3HOL A;  4QQ1 A;  4ML7 B;  5L8I A;  1VWJ B;  1MUP A;  2G5L A;  3FLL A;  2CZU A;  4TLJ A;  4Y0S A;  4BQU A;  1VWA B;  2X56 A;  3P6E A;  4JGL A;  1LF7 A;  1SY1 A;  1VWC B;  2DM5 A;  2QM9 A;  4RUU A;  5CSE A;  4NYR A;  4QGV A;  4JNJ A;  1GT4 A;  1GM6 A;  3ZUI A;  2KT4 B;  4GD9 A;  2WR6 A;  4IB7 A;  5HAE A;  3Q34 A;  4IAX A;  2Q9S A;  3T6F A;  5F7G A;  4YMY A;  5LKE A;  3VG7 A;  4INN A;  1TVQ A;  1I05 A;  3SZJ A;  2OYB O;  2NNQ A;  3BSZ E;  4I9R A;  3U03 A;  5LJG A;  4ODD A;  3ZZV A;  4C5P A;  3WZP A;  1S7D A;  1XCA A;  4CPI A;  1AEL A;  1HXL A;  1B4M A;  3NPO A;  4ZHD A;  3NX1 A;  2LBV A;  2E4J A;  2GTL M;  2K23 A;  2A2G A;  2FWV A;  4ARH A;  3JSQ A;  1SWK A;  4O4U A;  3WXQ A;  1YIV A;  5BVT A;  1HMR A;  1YWB A;  2AT6 X;  1CBQ A;  4IBA A;  1DF3 A;  3B2H A;  4BBO A;  1FEM A;  1AVG I;  1N0S A;  4GJS A;  3APV A;  5FQ8 E;  3RDS A;  1JJX A;  1VYO A;  4BOE A;  4ORY A;  2GH7 A;  3RDU A;  1LIB A;  1ICM A;  1DC9 A;  1STS B;  3EYC A;  5B11 O;  4WBK A;  2MF6 A;  2F09 A;  3L4R A; 
#chains in the Genus database with same CATH homology
 3T6L A;  3MM0 A;  2C1S A;  2RTK A;  3SZH A;  2UZ2 A;  1VWN B;  1Y55 X;  1KL5 A;  2IZK A;  2OFB A;  1SWS A;  1SRE A;  1MEP A;  1RSU B;  1SWR A;  2RTH B;  1SWJ A;  3VHI A;  2FHL A;  2CAM A;  5IRW A;  4IRW A;  1SWT A;  1KL3 A;  1IJ8 A;  2C4I A;  1RXH A;  1SRJ A;  3T2X A;  2C1Q A;  2OFA A;  4Z2P A;  4BX6 B;  1VWP B;  2OF8 A;  1NDJ A;  1SLF B;  1HQQ A;  1VWF B;  1Y53 X;  2IZD B;  1SWN A;  4Y59 A;  3VHH A;  2AVI A;  3SZI A;  3X00 A;  4U46 A;  2RTD B;  1SWP A;  1KL4 A;  1STP A;  1LDQ A;  2Y32 A;  2Y3F A;  1RAV A;  4BX5 B;  4Z6J A;  1SRF A;  1N9M A;  4BX7 B;  1SWQ A;  3WYP A;  4CPH A;  4DNE A;  1SWL A;  2RTN B;  4Y5D A;  1LDO A;  1SWC A;  2IZC B;  1DF8 A;  1SLE B;  4BCS A;  2ZSC A;  3RDM A;  1AVE A;  3WZQ A;  4JHQ A;  5B5F A;  1NQM A;  2RTR B;  3FDC A;  3PK2 A;  5K67 A;  1HXZ A;  5F2B A;  4BJ8 A;  3RE5 A;  2RTF B;  1N4J A;  1NBX A;  1AVD A;  1NQN A;  2QCB A;  2UYW A;  3T6F A;  1SRH A;  1VWE B;  2RTI B;  2WPU A;  2RTB B;  1MM9 A;  4Z2V A;  1RXJ A;  1SLD B;  1VWL B;  4Z28 A;  1NC9 A;  4CPF A;  4GDA A;  2OF9 A;  2RTE B;  3RY1 A;  1N7Y A;  1SWG A;  2RTP B;  2RTA A;  2IZG B;  5IRU A;  4GGT A;  3T2W A;  3WYQ A;  1SLG B;  1VWD B;  1VWQ B;  1WBI A;  1SWD A;  1VWI B;  1SWB A;  2A5B A;  2RTL A;  2IZH B;  2RTC B;  1LUQ A;  3RDO A;  1SRG A;  4OKA A;  3RY2 A;  1SWO A;  3WZO A;  2IZJ A;  5L3Y A;  1VWO B;  5JD2 A;  1STR B;  2FHN X;  2A8G A;  1RXK A;  1VWJ B;  4YVB A;  1SWH A;  2G5L A;  4GJV A;  3VHM A;  4CPE A;  1VWA B;  2IZA A;  3WZN A;  2IZE B;  1HY2 A;  1VWC B;  5CSE A;  1VWM B;  4JNJ A;  4BX6 A;  1RST B;  4GD9 A;  4Z2O A;  2RTQ B;  1SWU A;  1LEL A;  1SWF A;  1VWR B;  4Z27 A;  3SZJ A;  1LCV A;  4I60 A;  3EW2 A;  2IZF B;  1PTS A;  2A5C A;  2F01 A;  1LCZ A;  1N9Y A;  4BX5 A;  1VWH B;  1I9H A;  1MOY A;  1SWA A;  5B5G A;  3VGW A;  3WZP A;  4BX7 A;  4CPI A;  1HXL A;  1VWB B;  2IZL B;  2Y3E A;  1KFF A;  5K68 A;  4JO6 A;  2RTJ A;  3RDQ A;  1LCW A;  3MG5 A;  1SWK A;  2IZB A;  1N43 A;  1SRI A;  4GGR A;  1SWE A;  5IRA A;  3RDX A;  1VWK B;  2RTG B;  4BBO A;  4GJS A;  4GGZ A;  2IZI A;  3RDS A;  1Y52 X;  3RE6 A;  1VYO A;  1MK5 A;  1VWG B;  2GH7 A;  3RDU A;  5CHK A;  2JGS A;  1STS B;  2BC3 A;  2RTM A;  4CPH B;  2RTO B;  4EKV A;  2MF6 A;  3EW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...