1SWLA

Core-streptavidin mutant w108f at ph 7.0
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
119
structure length
119
Chain Sequence
b'GITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQFLLTSGTTEANAWKSTLVGHDTFTKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CORE-STREPTAVIDIN
publication title Structural studies of binding site tryptophan mutants in the high-affinity streptavidin-biotin complex.
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Biotin-binding protein
total genus 20
structure length 119
sequence length 119
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1swlA00
2UYWA 1SWDA 4JNJA 1LDQA 1SRGA 3WZPA 1NQMA 1SWOA 2RTLA 1Y53X 5K67A 1IJ8A 1RXKA 1VWEB 4Z6JA 3VHIA 4JHQA 3PK2A 3T6LA 3T2XA 2JGSA 1KL3A 1VYOA 2MF6A 2WPUA 2Y3FA 1RAVA 3WZNA 4CPFA 4GGRA 2IZKA 1VWNB 2RTRB 5B5GA 1STRB 1MEPA 2IZIA 2IZHB 2A5CA 1SWGA 2OFAA 2A8GA 1SWRA 4Z2OA 5IRWA 1VWGB 3VHMA 1SREA 1SWEA 1KL4A 1RXHA 4Z28A 4GGZA 4BX7A 3T6FA 1HXZA 1SRJA 2IZAA 3RE6A 1NDJA 1STPA 2RTEB 1NBXA 4GD9A 1HY2A 1MM9A 5L3YA 4CPHB 3WYPA 4Y59A 1I9HA 5CSEA 3RDSA 1LUQA 1VWFB 1Y52X 2RTJA 5IRUA 4BBOA 1VWIB 4CPHA 1NQNA 3RE5A 2QCBA 2C4IA 2IZGB 1N4JA 1LDOA 1SWKA 3MM0A 4I60A 3MG5A 3RDXA 4CPEA 1VWAB 1AVEA 3FDCA 4GJSA 2RTFB 4OKAA 2IZBA 2IZFB 1KFFA 3T2WA 3SZHA 3RDUA 2A5BA 4Z27A 2ZSCA 4U46A 1VWLB 1SWHA 2UZ2A 3RDQA 3WZOA 4CPIA 1HQQA 3RDOA 3RY2A 1SLEB 1SRFA 4JO6A 2RTBB 4GJVA 4GDAA 5CHKA 1SWTA 3VHHA 1SWQA 4BX5B 2RTGB 1RSTB 1N9YA 4BJ8A 4DNEA 2Y3EA 3VGWA 2IZDB 1SLDB 2RTQB 2RTIB 1SWNA 2C1QA 1SWCA 1VWCB 5IRAA 2RTMA 1SWPA 1LCWA 2G5LA 2RTCB 2OF9A 1VWHB 1SWJA 2BC3A 2IZJA 1VWJB 1AVDA 1VWOB 3X00A 4BCSA 1LCVA 3WYQA 3SZJA 4Z2VA 4GGTA 5F2BA 1SLGB 5B5FA 1SWSA 1N43A 4BX6B 1N7YA 2RTNB 1VWDB 1LCZA 1VWRB 1N9MA 2IZEB 2RTHB 1VWQB 2OFBA 2RTPB 2AVIA 4EKVA 2CAMA 2RTDB 4BX6A 1SWUA 1SLFB 1Y55X 2C1SA 2GH7A 4Z2PA 1RXJA 1PTSA 2IZLB 5JD2A 1SRIA 4BX5A 1LELA 1STSB 1WBIA 1NC9A 1HXLA 1SRHA 1SWFA 2FHLA 4BX7B 4YVBA 2F01A 5K68A 4IRWA 2RTKA 3RDMA 2Y32A 3WZQA 1KL5A 2IZCB 1VWPB 4Y5DA 1VWMB 1SWBA 3SZIA 1RSUB 3EW1A 2RTAA 1VWBB 3RY1A 1SWAA 1MK5A 2FHNX 2OF8A 1MOYA 1VWKB 3EW2A 1SWLA 2RTOB 1DF8A
chains in the Genus database with same CATH superfamily
2UYWA 3SLJA 3D95A 5D48A 4MVIA 5HTDA 4ZCBA 5K67A 3HPEA 1X8UA 2RA6A 3I17A 4LKPA 3P6EA 4CK4A 4YFRA 3CR6A 5FQ8E 3VHIA 1JBHA 4WFUA 3WBGA 1SMPI 3FA6A 3NX2A 3WJEA 1TOUA 4AW8A 3HOLA 1KL3A 1VYOA 2OL6O 1GM6A 3ELZA 4CDEA 1OBQA 5HZ8A 1T0VA 4QGXA 5B5GA 2X45A 3B2JA 1FE3A 3HWEA 3S26A 5IO7A 1SWGA 5B2AO 2A8GA 3CKFA 3HWGA 4Z2OA 1VWGB 4YH0A 1SREA 1KXOA 4Z28A 4BX7A 1JJUA 1KQWA 3BLGA 2QMIA 3RE6A 4BQUA 2OVEA 3T6FA 1PEEA 2WQ9A 1STPA 3CMPA 1NBXA 4CPHB 2W2BA 2X34A 2FTBA 5CSEA 2G79A 4AYHA 1LUQA 1EIOA 1CBSA 1OEEA 3FLLA 1X8PA 1Y52X 3CKGA 2CZTA 3NPOA 3MVFA 5IRUA 4ORRA 2C4IA 2MHDA 3BSZE 3DSZA 3B2HA 4YDAA 4I3CA 1AB0A 2OFMX 4ZR2A 1VWAB 1AVEA 2ASNX 3FDCA 4GJSA 3STKA 5K06A 3S5XA 3IFBA 3C76X 4DCBA 1Y9LA 5HCCC 4CDDA 1D3SA 1BRQA 2MWHA 5LJHA 3WJCA 5DPQA 4ORYA 4GE1A 1LFOA 2AKQA 1BLRA 5BVQA 2QO6A 1LIDA 1KGLA 1TXLA 4CPIA 1HQQA 2A13A 3KFIA 3RY2A 1SLEB 1ICNA 3UEWA 3FELA 2L68A 2JW1A 4NW4A 2RTBB 3KQ0A 1FEMA 4GJVA 1JV4A 1PBOA 4Y0RA 4NV7A 4C5PA 2L67A 3WVMA 5D47A 3KFFA 1LF7A 1YWCA 1BRPA 2MO5A 1SWQA 1SXWA 3RWXA 4YKOA 3ZW1B 4DNEA 1JYDA 4CDFA 2FR3A 2IZDB 1SLDB 2OYBO 1A3YA 3RSWA 2I5VO 1O1UA 1EI5A 2MJIA 5B10O 1ZNKA 4ML7B 4R0BA 5F6ZA 1NP1A 4O3YA 3SLOA 1LIEA 2E4JA 3I0AA 3WJBA 4TKHA 2FS7A 3AKMA 2OF9A 4QNIA 1TVQA 1VWOB 1BBPA 4TNNA 3TGAA 4AZMA 3VG6A 4Z2VA 1U0XA 3SZJA 5KHPA 1MX8A 2RCQA 4AZNA 1S2PA 2Q2PA 2AF5A 3BU9A 3VG3A 3ELXA 3BDRA 3UEVA 4LZUA 2RTNB 1VWDB 4MEEA 1LCZA 3FIQA 2G78A 2POAA 5IO6A 2Q4NA 1VWQB 4YCEA 4COTA 4EKVA 1ERBA 1SWUA 2LBAA 2WUTA 2X46A 3PP6A 4HPBA 4ORWA 5H8TA 4I9SA 3HTYA 3ZQ3A 1BWYA 4GU8A 4MVKA 1SRIA 1HBQA 4MVEA 4QQ1A 1K3BA 2WR6A 1ZNEA 1STSB 4ZFXA 1WBIA 2BS5A 1NC9A 1O1VA 5HZQA 4IB9A 2F01A 3F8AA 3WZQA 3RDMA 1G74A 1OBUA 1T68X 2Y32A 4TQ2A 1QABE 4O4UA 5B27A 3PDFA 1VWPB 2A2UA 2GC9A 5EPQA 1VWMB 4BVMA 1SWBA 1O8VA 4YGZA 2VFCA 2JN3A 3F9DA 1ZRYA 1X71A 2OF8A 3KVNA 1E2TA 3OJYC 2RTOB 1X8OA 1HBPA 4DQ4A 3NR3A 4PJ2A 2GJ5A 1DZMA 3NQKA 4IMOA 4JNJA 1SXUA 1SWOA 2BSZA 2AMMX 2K23A 5CYBA 3OBLA 4OMXA 3BRNA 1RXKA 1VWEB 4ZHGA 1IW2A 1IKEA 3UEXA 3TZSA 2AH7X 4O4SA 4ZGFA 4GETA 4JHQA 4BGFA 2Y3FA 2MM3A 4CPFA 2JU3A 4YFQA 4NV8A 1WUBA 3BS2A 3O2YA 4GGRA 3ZZVA 2IZKA 1QY1A 3JS1A 5BVSA 3PH6A 2G7BA 4U9CA 1SXYA 2IZIA 2OFAA 3EBWA 4WFVA 4ODDA 5FENA 1SWEA 2FR2A 1KL4A 4GGZA 2IFBA 1LKEA 1NDJA 3BX8A 3EM0A 4FBVA 4HPDA 3VU1A 4QZTA 3JSQA 4A60A 2P8GA 3D4RA 2AT6X 1RLBE 4GD9A 5L3YA 3WJFA 2YMSA 3TGBA 3P6FA 4Y59A 1VWFB 5HAEA 5D8JA 3KFGA 5EDCA 3EBKA 1JYJA 4CPHA 3RE5A 4MIRA 1X89A 5EZ2A 4Y0PA 2IZGB 4CPEA 3MM0A 3RDXA 3C77X 5LKFA 4OKAA 5HZ6A 2X4MA 2LBVA 1IFBA 2YG2A 2Z4IA 2QO4A 5HTEA 3T2WA 3WXQA 4ES7A 3VPJE 2A5BA 3ZW2A 4Z27A 2O62A 3AUMO 4U46A 1OSPO 1W4TA 3HOEA 1SWHA 3WZOA 3RDQA 1AELA 3Q6LA 5BYPA 2HKDA 4D6BA 1I78A 3G7XA 3VE1A 4GUZA 5B29A 1OEKA 4A1HA 5CHKA 1NP4A 4YGGA 3P6CA 5D4AA 4IMNA 4U8UO 2HLVA 2HMBA 3IA8A 3N91A 3VHHA 4BX5B 1JJJA 1RSTB 1QFTA 4ZH9A 3U9PC 1N9YA 1H91A 2WSJA 4EDEA 1EPAA 4I3BA 1HMRA 4I3DA 4ALBA 4QRLA 1SWCA 4ZHHA 4CSBA 1GGLA 4TLJA 1ACDA 3L4RA 2W2AA 5F6BA 1QY0A 4YBPA 1ZNHA 5DG4A 3H3IA 4ON1A 4ORUA 1DFVA 2RTCB 4O4XA 2OY8A 3ZI8A 3DTQA 4YMYA 1EUOA 3B2KA 1GKAB 1SWJA 3SOTA 5HWZA 2IZJA 5D45A 1AVDA 3X00A 3FA8A 1CBRA 2F09A 1I06A 2FRSA 2KT4B 4XMGA 2WEXA 3WYQA 4BCSA 1G5WA 2OVAA 4ORSA 1A18A 5F2BA 3C78X 5HA0A 1EQDA 1I4UA 4BX6B 4QAEA 3ZWEA 2JMBA 3ZUIA 3ZW0A 4QZUA 4NYQA 1N9MA 1Y9TA 2AT0X 4NNTA 2OFBA 2PY1A 4NLJA 4YDBA 1JQPA 1SLFB 1Y55X 2GH7A 3PEDA 4A8ZA 2W2FA 4EEJA 5H9LA 5JD2A 2WQAE 5AEOA 1JJXA 3HK1A 1LELA 4CDCA 2Q39A 4O3XB 4Y0QA 4KC8A 4ZJ0A 5L8IA 1MUPA 4EFGA 1NGLA 1B8EA 1W5RA 2FHLA 3OE3A 1R0UA 2X8FA 5EEDA 5HBSA 1IIUA 1PM1X 2RTKA 4BX7B 4YVBA 2IZCB 2ZAIA 4ID2A 4KT5A 5F7GA 1S7DA 2ANSA 4Y5DA 2R56A 3NQ3A 3FR4A 2N93A 3FMZA 1DZKA 5AJBA 4YGHA 1YP6A 1ALBA 3RY1A 5L8OA 2FHNX 1ZNLA 2KD2A 3EC5A 3FR2A 4U8UM 1EPBA 2G8CO 1SWLA 3K3LA 1E06A 1SWDA 1LDQA 1SRGA 3WZPA 1NQMA 1SY0A 1IJ8A 3FR5A 1I05A 2X8SA 4Z6JA 1KT7A 1QWDA 1LIFA 5C0NA 2ZAGA 3PK2A 3P24A 3WOVA 3BX7A 3WZNA 1U17A 5HZ9A 4IAWA 3VG5A 2QO5A 5LJCA 4N7CA 2OY1O 3D97A 5B3MO 1STRB 1E02A 3AEHA 3RZYA 1GT3A 3U03A 1QY2A 3NP1A 2WWPA 5IRWA 3APXA 4RUNA 4O3ZA 4AZOA 1K24A 2CM9A 1EW3A 3P02A 4GDZA 4L1NA 4GZVA 1MM9A 5FQ7E 5IXGA 1MX7A 4OMWA 5F1EA 1LICA 1ADLA 1AQBA 1GX8A 1HMTA 1BEBA 2XSTA 3FA7A 4BBOA 1B0OA 1L6MA 4O9SA 4U8UN 3VE2A 2FKJA 2Z4HA 3ZUOA 2X55A 2LKKA 2RTFB 1TW4A 1YWAA 2IZFB 4I95A 4DQ3A 3SZHA 3NBXX 4QYNA 3RDUA 1E5PA 4ZGUA 2NNQA 2LB6A 4BOEA 2UZ2A 3APUA 5HCDC 2NNEA 2CM4A 2OFRX 5HCEC 4JO6A 2DJGA 3HWFA 1BSQA 4GDAA 1CBIA 1DC9A 1SWTA 1XCAA 1EIIA 3P6DA 3QQ2A 4MVLA 2RTGB 1A2DA 3P6HA 1UYOX 2VDFA 3NQ9A 2Y3EA 3VGWA 3FEKA 1IFCA 4LZVA 1VPRA 4KIIA 2RTIB 1SWNA 2C1QA 3FIDA 1GT5A 1ZNDA 4INNA 4U3QA 4NLIA 3FA9A 2KTDA 4OS8A 1SY1A 1XKIA 1D2UA 1VWCB 5IRAA 1KOIA 1SWPA 3T1DA 2BLGA 4QYPA 2VFBA 1OPAA 4MISA 4XMDA 4LQZA 4ZH6A 1Z24A 1VWHB 2KW1A 2BC3A 1QFVA 3V8UA 4YFPA 1VWJB 2JU7A 4OS3A 5IO5A 3QKGA 2AT5X 1LCVA 5F58A 4GGTA 5H9NA 1KQXA 4O3WA 1IKJA 1UYNX 5LJEA 1ML7A 1SWSA 4KC7A 2FGSA 2X32A 3MBTA 1N7YA 3SAOA 3P6GA 2RQ0A 3STNA 1VWRB 3B2IA 3EMMA 2IZEB 2RTHB 3VG2A 4WBKA 2RTPB 2AVIA 4AZRA 2CAMA 3LV4A 4BX6A 4OS0A 1VYGA 4IBAA 2OY7A 1YWDA 1GT1A 4Z2PA 1DV9A 2IZLB 4NNSA 3KZAA 1HMSA 5FQ6E 1SY3A 1G7NA 1AVGI 1UZ2X 1YUPA 3VG4A 3ZW1A 1HN2A 1HXLA 1SWFA 4WHIA 3FEPA 2R74A 1MVGA 4FGIB 5K68A 3FENA 5L8NA 2FLJA 1KL5A 3F6ZB 2ACPX 2ALLX 2CBSA 2FS6A 2LA7A 2X8TA 2GTLO 2JU8A 5B11O 4O4OA 1BM5A 2HZQA 4TKBA 2RTAA 1VYFA 1VWBB 4KH8A 2K62A 3PQSA 2LFOA 5LJKA 3Q34A 1VWKB 1W6FA 5BVTA 1A57A 1JZUA 1DF8A 2DM5A 1DZJA 2X56A 3CBSA 4FBOA 4IABA 2QOSC 1S44A 3APWA 4ZHFA 2EU7X 2RTLA 1Y53X 4XMCA 5EDBA 5HZ5A 1DF3A 1BSOA 1LNMA 3CBCA 2HZRA 1JIWI 4XMEA 2QOMA 4ZHDA 1KZWA 1YP7A 3NX1A 3T2XA 2JGSA 2MF6A 2WPUA 3OD9A 2HYSA 4YCHA 1RAVA 3T6LA 4A1YA 1U18A 5KICA 1KT3A 2HNXA 1LIBA 1VWNB 4ALOA 1UREA 2RTRB 3GE2A 2A0AA 4FQBB 1SXXA 1MEPA 1EXSA 2CZUA 2A5CA 2IZHB 3GAQA 2PI3O 1SWRA 5AJCA 1KT5A 4Y0SA 1X8NA 3VHMA 4GH7A 1G85A 1RXHA 1FENA 2Q9SA 1HXZA 1SRJA 2IZAA 4RUUA 3LTWA 4JGLA 3WJDA 4AZPA 1QQSA 3BU1A 3FW5A 4TJZA 2RCTA 2RTEB 3TGCA 1HY2A 4YBUA 4FBRA 3WYPA 2AT8X 1I9HA 3RDSA 4QGVA 3RKGA 3BY0A 3JQOA 4QGWA 2RTJA 1VWIB 5H9AA 3UEUA 4ORXA 1NQNA 4XMFA 3S5VA 5LKEA 2F73A 2QCBA 1CRBA 1N4JA 1LDOA 1RBPA 1SWKA 2AL0X 3MG5A 4I60A 2L5PA 4I6SA 1N0SA 4M6SA 4HPAA 4IB8A 3U0DA 2IZBA 2OL7A 1KT6A 4I9RA 1QG5A 1KFFA 2FKGA 4OELA 1DZPA 1YIVA 5LJGA 2BHVA 2ZSCA 3PH5A 4O49A 2NP1A 3SLTA 2GTLM 2OVSA 4N7DA 4D6AA 1VWLB 4EXZA 2WEWA 2R73A 2DJFA 3E3CA 3ZW0B 2RD7C 1SRFA 2L9CA 2FT9A 1JMZA 2BT9A 4GK9A 1ERXA 4K19A 3STMX 4ZHCA 1KT4A 1GX3A 3O19A 2FWVA 2AT3X 3FW4A 4KCAA 3CWKA 3UAQA 4M7MA 4HPCA 2RN4A 4BJ8A 5HA1A 3WJGA 5CE4A 4TKJA 2ACOA 2OY5O 1FDQA 3D9WA 2RTQB 4GNYA 4OEMA 2OZQA 5EEEA 1LPJA 5FAZA 4ARHA 1BJ7A 3VG7A 1PBYA 4NYRA 5KIDA 4HFOA 3MX7A 1HQPA 1OBPA 1ICMA 1ZNGA 2RTMA 4IB6A 1LCWA 2KTSA 2G5LA 1P6PA 4AZQA 3S60A 4NP1A 1GT4A 3AKNA 4HWMA 5AQ6A 2GTFX 4L3RA 1BSYA 3D96A 1E00A 1Y0GA 1TOWA 1GX9A 4YKMA 3NADA 3KFHA 1SLGB 5B5FA 4IAXA 1KZXA 3TF6A 1N43A 1FELA 1GXAA 3B2LA 4GRJA 5FFHA 2GTLN 4UU2A 4UU3A 2JOZA 3CQRA 2NNDA 2A3FX 3FYFA 1SA8A 2CBRA 1I04A 2RTDB 4IB7A 5JR8A 2C1SA 1OPBA 3PPTA 5LJDA 1RXJA 1PTSA 4BX5A 5LJBA 2I5ZO 1B4MA 3EYCA 2BS6A 1OEJA 3LHNA 1CBQA 1SRHA 3O22A 4PSQA 1CJ5A 3PECA 4IRWA 2OVDA 3HWDA 4GKCA 4B55A 3PQUA 4LKTA 1MDCA 3APVA 1JMXA 1SY2A 1T8VA 2M4LA 5H9KA 1YWBA 1EALA 4CV7A 3SZIA 1RSUB 3EW1A 4XMHA 2XKLA 1FTPA 3RBYA 1SWAA 1GKAA 1PMPA 1MK5A 1FJ1E 2A2GA 1MOYA 1X8QA 2OL8O 2QM9A 4GNWA 3EW2A 4EQAC 3RDOA 1B56A 2Q2MA 3CQNA
chains in the Genus database with same CATH topology
2UYWA 1SWDA 4JNJA 1LDQA 1SRGA 3WZPA 1NQMA 1SWOA 2RTLA 1Y53X 5K67A 1IJ8A 1RXKA 1VWEB 4Z6JA 3VHIA 4JHQA 3PK2A 3T6LA 3T2XA 2JGSA 1KL3A 1VYOA 2MF6A 2WPUA 2Y3FA 1RAVA 3WZNA 4CPFA 4GGRA 2IZKA 1VWNB 2RTRB 5B5GA 1STRB 1MEPA 2IZIA 2IZHB 2A5CA 1SWGA 2OFAA 2A8GA 1SWRA 4Z2OA 5IRWA 1VWGB 3VHMA 1SREA 1SWEA 1KL4A 1RXHA 4Z28A 4GGZA 4BX7A 3T6FA 1HXZA 1SRJA 2IZAA 3RE6A 1NDJA 1STPA 2RTEB 1NBXA 4GD9A 1HY2A 1MM9A 5L3YA 4CPHB 3WYPA 4Y59A 1I9HA 5CSEA 3RDSA 1LUQA 1VWFB 1Y52X 2RTJA 5IRUA 4BBOA 1VWIB 4CPHA 1NQNA 3RE5A 2QCBA 2C4IA 2IZGB 1N4JA 1LDOA 1SWKA 3MM0A 4I60A 3MG5A 3RDXA 4CPEA 1VWAB 1AVEA 3FDCA 4GJSA 2RTFB 4OKAA 2IZBA 2IZFB 1KFFA 3T2WA 3SZHA 3RDUA 2A5BA 4Z27A 2ZSCA 4U46A 1VWLB 1SWHA 2UZ2A 3RDQA 3WZOA 4CPIA 1HQQA 3RDOA 3RY2A 1SLEB 1SRFA 4JO6A 2RTBB 4GJVA 4GDAA 5CHKA 1SWTA 3VHHA 1SWQA 4BX5B 2RTGB 1RSTB 1N9YA 4BJ8A 4DNEA 2Y3EA 3VGWA 2IZDB 1SLDB 2RTQB 2RTIB 1SWNA 2C1QA 1SWCA 1VWCB 5IRAA 2RTMA 1SWPA 1LCWA 2G5LA 2RTCB 2OF9A 1VWHB 1SWJA 2BC3A 2IZJA 1VWJB 1AVDA 1VWOB 3X00A 4BCSA 1LCVA 3WYQA 3SZJA 4Z2VA 4GGTA 5F2BA 1SLGB 5B5FA 1SWSA 1N43A 4BX6B 1N7YA 2RTNB 1VWDB 1LCZA 1VWRB 1N9MA 2IZEB 2RTHB 1VWQB 2OFBA 2RTPB 2AVIA 4EKVA 2CAMA 2RTDB 4BX6A 1SWUA 1SLFB 1Y55X 2C1SA 2GH7A 4Z2PA 1RXJA 1PTSA 2IZLB 5JD2A 1SRIA 4BX5A 1LELA 1STSB 1WBIA 1NC9A 1HXLA 1SRHA 1SWFA 2FHLA 4BX7B 4YVBA 2F01A 5K68A 4IRWA 2RTKA 3RDMA 2Y32A 3WZQA 1KL5A 2IZCB 1VWPB 4Y5DA 1VWMB 1SWBA 3SZIA 1RSUB 3EW1A 2RTAA 1VWBB 3RY1A 1SWAA 1MK5A 2FHNX 2OF8A 1MOYA 1VWKB 3EW2A 1SWLA 2RTOB 1DF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UYW A;  1SWD A;  4JNJ A;  1LDQ A;  1SRG A;  3WZP A;  1NQM A;  1SWO A;  2RTL A;  1Y53 X;  5K67 A;  1IJ8 A;  1RXK A;  1VWE B;  4Z6J A;  3VHI A;  4JHQ A;  3PK2 A;  3T6L A;  3T2X A;  2JGS A;  1KL3 A;  1VYO A;  2MF6 A;  2WPU A;  2Y3F A;  1RAV A;  3WZN A;  4CPF A;  4GGR A;  2IZK A;  1VWN B;  2RTR B;  5B5G A;  1STR B;  1MEP A;  2IZI A;  2IZH B;  2A5C A;  1SWG A;  2OFA A;  2A8G A;  1SWR A;  4Z2O A;  5IRW A;  1VWG B;  3VHM A;  1SRE A;  1SWE A;  1KL4 A;  1RXH A;  4Z28 A;  4GGZ A;  4BX7 A;  3T6F A;  1HXZ A;  1SRJ A;  2IZA A;  3RE6 A;  1NDJ A;  1STP A;  2RTE B;  1NBX A;  4GD9 A;  1HY2 A;  1MM9 A;  5L3Y A;  4CPH B;  3WYP A;  4Y59 A;  1I9H A;  5CSE A;  3RDS A;  1LUQ A;  1VWF B;  1Y52 X;  2RTJ A;  5IRU A;  4BBO A;  1VWI B;  4CPH A;  1NQN A;  3RE5 A;  2QCB A;  2C4I A;  2IZG B;  1N4J A;  1LDO A;  1SWK A;  3MM0 A;  4I60 A;  3MG5 A;  3RDX A;  4CPE A;  1VWA B;  1AVE A;  3FDC A;  4GJS A;  2RTF B;  4OKA A;  2IZB A;  2IZF B;  1KFF A;  3T2W A;  3SZH A;  3RDU A;  2A5B A;  4Z27 A;  2ZSC A;  4U46 A;  1VWL B;  1SWH A;  2UZ2 A;  3RDQ A;  3WZO A;  4CPI A;  1HQQ A;  3RDO A;  3RY2 A;  1SLE B;  1SRF A;  4JO6 A;  2RTB B;  4GJV A;  4GDA A;  5CHK A;  1SWT A;  3VHH A;  1SWQ A;  4BX5 B;  2RTG B;  1RST B;  1N9Y A;  4BJ8 A;  4DNE A;  2Y3E A;  3VGW A;  2IZD B;  1SLD B;  2RTQ B;  2RTI B;  1SWN A;  2C1Q A;  1SWC A;  1VWC B;  5IRA A;  2RTM A;  1SWP A;  1LCW A;  2G5L A;  2RTC B;  2OF9 A;  1VWH B;  1SWJ A;  2BC3 A;  2IZJ A;  1VWJ B;  1AVD A;  1VWO B;  3X00 A;  4BCS A;  1LCV A;  3WYQ A;  3SZJ A;  4Z2V A;  4GGT A;  5F2B A;  1SLG B;  5B5F A;  1SWS A;  1N43 A;  4BX6 B;  1N7Y A;  2RTN B;  1VWD B;  1LCZ A;  1VWR B;  1N9M A;  2IZE B;  2RTH B;  1VWQ B;  2OFB A;  2RTP B;  2AVI A;  4EKV A;  2CAM A;  2RTD B;  4BX6 A;  1SWU A;  1SLF B;  1Y55 X;  2C1S A;  2GH7 A;  4Z2P A;  1RXJ A;  1PTS A;  2IZL B;  5JD2 A;  1SRI A;  4BX5 A;  1LEL A;  1STS B;  1WBI A;  1NC9 A;  1HXL A;  1SRH A;  1SWF A;  2FHL A;  4BX7 B;  4YVB A;  2F01 A;  5K68 A;  4IRW A;  2RTK A;  3RDM A;  2Y32 A;  3WZQ A;  1KL5 A;  2IZC B;  1VWP B;  4Y5D A;  1VWM B;  1SWB A;  3SZI A;  1RSU B;  3EW1 A;  2RTA A;  1VWB B;  3RY1 A;  1SWA A;  1MK5 A;  2FHN X;  2OF8 A;  1MOY A;  1VWK B;  3EW2 A;  1SWL A;  2RTO B;  1DF8 A; 
#chains in the Genus database with same CATH topology
 2UYW A;  3SLJ A;  3D95 A;  5D48 A;  4MVI A;  5HTD A;  4ZCB A;  5K67 A;  3HPE A;  1X8U A;  2RA6 A;  3I17 A;  4LKP A;  3P6E A;  4CK4 A;  4YFR A;  3CR6 A;  5FQ8 E;  3VHI A;  1JBH A;  4WFU A;  3WBG A;  1SMP I;  3FA6 A;  3NX2 A;  3WJE A;  1TOU A;  4AW8 A;  3HOL A;  1KL3 A;  1VYO A;  2OL6 O;  1GM6 A;  3ELZ A;  4CDE A;  1OBQ A;  5HZ8 A;  1T0V A;  4QGX A;  5B5G A;  2X45 A;  3B2J A;  1FE3 A;  3HWE A;  3S26 A;  5IO7 A;  1SWG A;  5B2A O;  2A8G A;  3CKF A;  3HWG A;  4Z2O A;  1VWG B;  4YH0 A;  1SRE A;  1KXO A;  4Z28 A;  4BX7 A;  1JJU A;  1KQW A;  3BLG A;  2QMI A;  3RE6 A;  4BQU A;  2OVE A;  3T6F A;  1PEE A;  2WQ9 A;  1STP A;  3CMP A;  1NBX A;  4CPH B;  2W2B A;  2X34 A;  2FTB A;  5CSE A;  2G79 A;  4AYH A;  1LUQ A;  1EIO A;  1CBS A;  1OEE A;  3FLL A;  1X8P A;  1Y52 X;  3CKG A;  2CZT A;  3NPO A;  3MVF A;  5IRU A;  4ORR A;  2C4I A;  2MHD A;  3BSZ E;  3DSZ A;  3B2H A;  4YDA A;  4I3C A;  1AB0 A;  2OFM X;  4ZR2 A;  1VWA B;  1AVE A;  2ASN X;  3FDC A;  4GJS A;  3STK A;  5K06 A;  3S5X A;  3IFB A;  3C76 X;  4DCB A;  1Y9L A;  5HCC C;  4CDD A;  1D3S A;  1BRQ A;  2MWH A;  5LJH A;  3WJC A;  5DPQ A;  4ORY A;  4GE1 A;  1LFO A;  2AKQ A;  1BLR A;  5BVQ A;  2QO6 A;  1LID A;  1KGL A;  1TXL A;  4CPI A;  1HQQ A;  2A13 A;  3KFI A;  3RY2 A;  1SLE B;  1ICN A;  3UEW A;  3FEL A;  2L68 A;  2JW1 A;  4NW4 A;  2RTB B;  3KQ0 A;  1FEM A;  4GJV A;  1JV4 A;  1PBO A;  4Y0R A;  4NV7 A;  4C5P A;  2L67 A;  3WVM A;  5D47 A;  3KFF A;  1LF7 A;  1YWC A;  1BRP A;  2MO5 A;  1SWQ A;  1SXW A;  3RWX A;  4YKO A;  3ZW1 B;  4DNE A;  1JYD A;  4CDF A;  2FR3 A;  2IZD B;  1SLD B;  2OYB O;  1A3Y A;  3RSW A;  2I5V O;  1O1U A;  1EI5 A;  2MJI A;  5B10 O;  1ZNK A;  4ML7 B;  4R0B A;  5F6Z A;  1NP1 A;  4O3Y A;  3SLO A;  1LIE A;  2E4J A;  3I0A A;  3WJB A;  4TKH A;  2FS7 A;  3AKM A;  2OF9 A;  4QNI A;  1TVQ A;  1VWO B;  1BBP A;  4TNN A;  3TGA A;  4AZM A;  3VG6 A;  4Z2V A;  1U0X A;  3SZJ A;  5KHP A;  1MX8 A;  2RCQ A;  4AZN A;  1S2P A;  2Q2P A;  2AF5 A;  3BU9 A;  3VG3 A;  3ELX A;  3BDR A;  3UEV A;  4LZU A;  2RTN B;  1VWD B;  4MEE A;  1LCZ A;  3FIQ A;  2G78 A;  2POA A;  5IO6 A;  2Q4N A;  1VWQ B;  4YCE A;  4COT A;  4EKV A;  1ERB A;  1SWU A;  2LBA A;  2WUT A;  2X46 A;  3PP6 A;  4HPB A;  4ORW A;  5H8T A;  4I9S A;  3HTY A;  3ZQ3 A;  1BWY A;  4GU8 A;  4MVK A;  1SRI A;  1HBQ A;  4MVE A;  4QQ1 A;  1K3B A;  2WR6 A;  1ZNE A;  1STS B;  4ZFX A;  1WBI A;  2BS5 A;  1NC9 A;  1O1V A;  5HZQ A;  4IB9 A;  2F01 A;  3F8A A;  3WZQ A;  3RDM A;  1G74 A;  1OBU A;  1T68 X;  2Y32 A;  4TQ2 A;  1QAB E;  4O4U A;  5B27 A;  3PDF A;  1VWP B;  2A2U A;  2GC9 A;  5EPQ A;  1VWM B;  4BVM A;  1SWB A;  1O8V A;  4YGZ A;  2VFC A;  2JN3 A;  3F9D A;  1ZRY A;  1X71 A;  2OF8 A;  3KVN A;  1E2T A;  3OJY C;  2RTO B;  1X8O A;  1HBP A;  4DQ4 A;  3NR3 A;  4PJ2 A;  2GJ5 A;  1DZM A;  3NQK A;  4IMO A;  4JNJ A;  1SXU A;  1SWO A;  2BSZ A;  2AMM X;  2K23 A;  5CYB A;  3OBL A;  4OMX A;  3BRN A;  1RXK A;  1VWE B;  4ZHG A;  1IW2 A;  1IKE A;  3UEX A;  3TZS A;  2AH7 X;  4O4S A;  4ZGF A;  4GET A;  4JHQ A;  4BGF A;  2Y3F A;  2MM3 A;  4CPF A;  2JU3 A;  4YFQ A;  4NV8 A;  1WUB A;  3BS2 A;  3O2Y A;  4GGR A;  3ZZV A;  2IZK A;  1QY1 A;  3JS1 A;  5BVS A;  3PH6 A;  2G7B A;  4U9C A;  1SXY A;  2IZI A;  2OFA A;  3EBW A;  4WFV A;  4ODD A;  5FEN A;  1SWE A;  2FR2 A;  1KL4 A;  4GGZ A;  2IFB A;  1LKE A;  1NDJ A;  3BX8 A;  3EM0 A;  4FBV A;  4HPD A;  3VU1 A;  4QZT A;  3JSQ A;  4A60 A;  2P8G A;  3D4R A;  2AT6 X;  1RLB E;  4GD9 A;  5L3Y A;  3WJF A;  2YMS A;  3TGB A;  3P6F A;  4Y59 A;  1VWF B;  5HAE A;  5D8J A;  3KFG A;  5EDC A;  3EBK A;  1JYJ A;  4CPH A;  3RE5 A;  4MIR A;  1X89 A;  5EZ2 A;  4Y0P A;  2IZG B;  4CPE A;  3MM0 A;  3RDX A;  3C77 X;  5LKF A;  4OKA A;  5HZ6 A;  2X4M A;  2LBV A;  1IFB A;  2YG2 A;  2Z4I A;  2QO4 A;  5HTE A;  3T2W A;  3WXQ A;  4ES7 A;  3VPJ E;  2A5B A;  3ZW2 A;  4Z27 A;  2O62 A;  3AUM O;  4U46 A;  1OSP O;  1W4T A;  3HOE A;  1SWH A;  3WZO A;  3RDQ A;  1AEL A;  3Q6L A;  5BYP A;  2HKD A;  4D6B A;  1I78 A;  3G7X A;  3VE1 A;  4GUZ A;  5B29 A;  1OEK A;  4A1H A;  5CHK A;  1NP4 A;  4YGG A;  3P6C A;  5D4A A;  4IMN A;  4U8U O;  2HLV A;  2HMB A;  3IA8 A;  3N91 A;  3VHH A;  4BX5 B;  1JJJ A;  1RST B;  1QFT A;  4ZH9 A;  3U9P C;  1N9Y A;  1H91 A;  2WSJ A;  4EDE A;  1EPA A;  4I3B A;  1HMR A;  4I3D A;  4ALB A;  4QRL A;  1SWC A;  4ZHH A;  4CSB A;  1GGL A;  4TLJ A;  1ACD A;  3L4R A;  2W2A A;  5F6B A;  1QY0 A;  4YBP A;  1ZNH A;  5DG4 A;  3H3I A;  4ON1 A;  4ORU A;  1DFV A;  2RTC B;  4O4X A;  2OY8 A;  3ZI8 A;  3DTQ A;  4YMY A;  1EUO A;  3B2K A;  1GKA B;  1SWJ A;  3SOT A;  5HWZ A;  2IZJ A;  5D45 A;  1AVD A;  3X00 A;  3FA8 A;  1CBR A;  2F09 A;  1I06 A;  2FRS A;  2KT4 B;  4XMG A;  2WEX A;  3WYQ A;  4BCS A;  1G5W A;  2OVA A;  4ORS A;  1A18 A;  5F2B A;  3C78 X;  5HA0 A;  1EQD A;  1I4U A;  4BX6 B;  4QAE A;  3ZWE A;  2JMB A;  3ZUI A;  3ZW0 A;  4QZU A;  4NYQ A;  1N9M A;  1Y9T A;  2AT0 X;  4NNT A;  2OFB A;  2PY1 A;  4NLJ A;  4YDB A;  1JQP A;  1SLF B;  1Y55 X;  2GH7 A;  3PED A;  4A8Z A;  2W2F A;  4EEJ A;  5H9L A;  5JD2 A;  2WQA E;  5AEO A;  1JJX A;  3HK1 A;  1LEL A;  4CDC A;  2Q39 A;  4O3X B;  4Y0Q A;  4KC8 A;  4ZJ0 A;  5L8I A;  1MUP A;  4EFG A;  1NGL A;  1B8E A;  1W5R A;  2FHL A;  3OE3 A;  1R0U A;  2X8F A;  5EED A;  5HBS A;  1IIU A;  1PM1 X;  2RTK A;  4BX7 B;  4YVB A;  2IZC B;  2ZAI A;  4ID2 A;  4KT5 A;  5F7G A;  1S7D A;  2ANS A;  4Y5D A;  2R56 A;  3NQ3 A;  3FR4 A;  2N93 A;  3FMZ A;  1DZK A;  5AJB A;  4YGH A;  1YP6 A;  1ALB A;  3RY1 A;  5L8O A;  2FHN X;  1ZNL A;  2KD2 A;  3EC5 A;  3FR2 A;  4U8U M;  1EPB A;  2G8C O;  1SWL A;  3K3L A;  1E06 A;  1SWD A;  1LDQ A;  1SRG A;  3WZP A;  1NQM A;  1SY0 A;  1IJ8 A;  3FR5 A;  1I05 A;  2X8S A;  4Z6J A;  1KT7 A;  1QWD A;  1LIF A;  5C0N A;  2ZAG A;  3PK2 A;  3P24 A;  3WOV A;  3BX7 A;  3WZN A;  1U17 A;  5HZ9 A;  4IAW A;  3VG5 A;  2QO5 A;  5LJC A;  4N7C A;  2OY1 O;  3D97 A;  5B3M O;  1STR B;  1E02 A;  3AEH A;  3RZY A;  1GT3 A;  3U03 A;  1QY2 A;  3NP1 A;  2WWP A;  5IRW A;  3APX A;  4RUN A;  4O3Z A;  4AZO A;  1K24 A;  2CM9 A;  1EW3 A;  3P02 A;  4GDZ A;  4L1N A;  4GZV A;  1MM9 A;  5FQ7 E;  5IXG A;  1MX7 A;  4OMW A;  5F1E A;  1LIC A;  1ADL A;  1AQB A;  1GX8 A;  1HMT A;  1BEB A;  2XST A;  3FA7 A;  4BBO A;  1B0O A;  1L6M A;  4O9S A;  4U8U N;  3VE2 A;  2FKJ A;  2Z4H A;  3ZUO A;  2X55 A;  2LKK A;  2RTF B;  1TW4 A;  1YWA A;  2IZF B;  4I95 A;  4DQ3 A;  3SZH A;  3NBX X;  4QYN A;  3RDU A;  1E5P A;  4ZGU A;  2NNQ A;  2LB6 A;  4BOE A;  2UZ2 A;  3APU A;  5HCD C;  2NNE A;  2CM4 A;  2OFR X;  5HCE C;  4JO6 A;  2DJG A;  3HWF A;  1BSQ A;  4GDA A;  1CBI A;  1DC9 A;  1SWT A;  1XCA A;  1EII A;  3P6D A;  3QQ2 A;  4MVL A;  2RTG B;  1A2D A;  3P6H A;  1UYO X;  2VDF A;  3NQ9 A;  2Y3E A;  3VGW A;  3FEK A;  1IFC A;  4LZV A;  1VPR A;  4KII A;  2RTI B;  1SWN A;  2C1Q A;  3FID A;  1GT5 A;  1ZND A;  4INN A;  4U3Q A;  4NLI A;  3FA9 A;  2KTD A;  4OS8 A;  1SY1 A;  1XKI A;  1D2U A;  1VWC B;  5IRA A;  1KOI A;  1SWP A;  3T1D A;  2BLG A;  4QYP A;  2VFB A;  1OPA A;  4MIS A;  4XMD A;  4LQZ A;  4ZH6 A;  1Z24 A;  1VWH B;  2KW1 A;  2BC3 A;  1QFV A;  3V8U A;  4YFP A;  1VWJ B;  2JU7 A;  4OS3 A;  5IO5 A;  3QKG A;  2AT5 X;  1LCV A;  5F58 A;  4GGT A;  5H9N A;  1KQX A;  4O3W A;  1IKJ A;  1UYN X;  5LJE A;  1ML7 A;  1SWS A;  4KC7 A;  2FGS A;  2X32 A;  3MBT A;  1N7Y A;  3SAO A;  3P6G A;  2RQ0 A;  3STN A;  1VWR B;  3B2I A;  3EMM A;  2IZE B;  2RTH B;  3VG2 A;  4WBK A;  2RTP B;  2AVI A;  4AZR A;  2CAM A;  3LV4 A;  4BX6 A;  4OS0 A;  1VYG A;  4IBA A;  2OY7 A;  1YWD A;  1GT1 A;  4Z2P A;  1DV9 A;  2IZL B;  4NNS A;  3KZA A;  1HMS A;  5FQ6 E;  1SY3 A;  1G7N A;  1AVG I;  1UZ2 X;  1YUP A;  3VG4 A;  3ZW1 A;  1HN2 A;  1HXL A;  1SWF A;  4WHI A;  3FEP A;  2R74 A;  1MVG A;  4FGI B;  5K68 A;  3FEN A;  5L8N A;  2FLJ A;  1KL5 A;  3F6Z B;  2ACP X;  2ALL X;  2CBS A;  2FS6 A;  2LA7 A;  2X8T A;  2GTL O;  2JU8 A;  5B11 O;  4O4O A;  1BM5 A;  2HZQ A;  4TKB A;  2RTA A;  1VYF A;  1VWB B;  4KH8 A;  2K62 A;  3PQS A;  2LFO A;  5LJK A;  3Q34 A;  1VWK B;  1W6F A;  5BVT A;  1A57 A;  1JZU A;  1DF8 A;  2DM5 A;  1DZJ A;  2X56 A;  3CBS A;  4FBO A;  4IAB A;  2QOS C;  1S44 A;  3APW A;  4ZHF A;  2EU7 X;  2RTL A;  1Y53 X;  4XMC A;  5EDB A;  5HZ5 A;  1DF3 A;  1BSO A;  1LNM A;  3CBC A;  2HZR A;  1JIW I;  4XME A;  2QOM A;  4ZHD A;  1KZW A;  1YP7 A;  3NX1 A;  3T2X A;  2JGS A;  2MF6 A;  2WPU A;  3OD9 A;  2HYS A;  4YCH A;  1RAV A;  3T6L A;  4A1Y A;  1U18 A;  5KIC A;  1KT3 A;  2HNX A;  1LIB A;  1VWN B;  4ALO A;  1URE A;  2RTR B;  3GE2 A;  2A0A A;  4FQB B;  1SXX A;  1MEP A;  1EXS A;  2CZU A;  2A5C A;  2IZH B;  3GAQ A;  2PI3 O;  1SWR A;  5AJC A;  1KT5 A;  4Y0S A;  1X8N A;  3VHM A;  4GH7 A;  1G85 A;  1RXH A;  1FEN A;  2Q9S A;  1HXZ A;  1SRJ A;  2IZA A;  4RUU A;  3LTW A;  4JGL A;  3WJD A;  4AZP A;  1QQS A;  3BU1 A;  3FW5 A;  4TJZ A;  2RCT A;  2RTE B;  3TGC A;  1HY2 A;  4YBU A;  4FBR A;  3WYP A;  2AT8 X;  1I9H A;  3RDS A;  4QGV A;  3RKG A;  3BY0 A;  3JQO A;  4QGW A;  2RTJ A;  1VWI B;  5H9A A;  3UEU A;  4ORX A;  1NQN A;  4XMF A;  3S5V A;  5LKE A;  2F73 A;  2QCB A;  1CRB A;  1N4J A;  1LDO A;  1RBP A;  1SWK A;  2AL0 X;  3MG5 A;  4I60 A;  2L5P A;  4I6S A;  1N0S A;  4M6S A;  4HPA A;  4IB8 A;  3U0D A;  2IZB A;  2OL7 A;  1KT6 A;  4I9R A;  1QG5 A;  1KFF A;  2FKG A;  4OEL A;  1DZP A;  1YIV A;  5LJG A;  2BHV A;  2ZSC A;  3PH5 A;  4O49 A;  2NP1 A;  3SLT A;  2GTL M;  2OVS A;  4N7D A;  4D6A A;  1VWL B;  4EXZ A;  2WEW A;  2R73 A;  2DJF A;  3E3C A;  3ZW0 B;  2RD7 C;  1SRF A;  2L9C A;  2FT9 A;  1JMZ A;  2BT9 A;  4GK9 A;  1ERX A;  4K19 A;  3STM X;  4ZHC A;  1KT4 A;  1GX3 A;  3O19 A;  2FWV A;  2AT3 X;  3FW4 A;  4KCA A;  3CWK A;  3UAQ A;  4M7M A;  4HPC A;  2RN4 A;  4BJ8 A;  5HA1 A;  3WJG A;  5CE4 A;  4TKJ A;  2ACO A;  2OY5 O;  1FDQ A;  3D9W A;  2RTQ B;  4GNY A;  4OEM A;  2OZQ A;  5EEE A;  1LPJ A;  5FAZ A;  4ARH A;  1BJ7 A;  3VG7 A;  1PBY A;  4NYR A;  5KID A;  4HFO A;  3MX7 A;  1HQP A;  1OBP A;  1ICM A;  1ZNG A;  2RTM A;  4IB6 A;  1LCW A;  2KTS A;  2G5L A;  1P6P A;  4AZQ A;  3S60 A;  4NP1 A;  1GT4 A;  3AKN A;  4HWM A;  5AQ6 A;  2GTF X;  4L3R A;  1BSY A;  3D96 A;  1E00 A;  1Y0G A;  1TOW A;  1GX9 A;  4YKM A;  3NAD A;  3KFH A;  1SLG B;  5B5F A;  4IAX A;  1KZX A;  3TF6 A;  1N43 A;  1FEL A;  1GXA A;  3B2L A;  4GRJ A;  5FFH A;  2GTL N;  4UU2 A;  4UU3 A;  2JOZ A;  3CQR A;  2NND A;  2A3F X;  3FYF A;  1SA8 A;  2CBR A;  1I04 A;  2RTD B;  4IB7 A;  5JR8 A;  2C1S A;  1OPB A;  3PPT A;  5LJD A;  1RXJ A;  1PTS A;  4BX5 A;  5LJB A;  2I5Z O;  1B4M A;  3EYC A;  2BS6 A;  1OEJ A;  3LHN A;  1CBQ A;  1SRH A;  3O22 A;  4PSQ A;  1CJ5 A;  3PEC A;  4IRW A;  2OVD A;  3HWD A;  4GKC A;  4B55 A;  3PQU A;  4LKT A;  1MDC A;  3APV A;  1JMX A;  1SY2 A;  1T8V A;  2M4L A;  5H9K A;  1YWB A;  1EAL A;  4CV7 A;  3SZI A;  1RSU B;  3EW1 A;  4XMH A;  2XKL A;  1FTP A;  3RBY A;  1SWA A;  1GKA A;  1PMP A;  1MK5 A;  1FJ1 E;  2A2G A;  1MOY A;  1X8Q A;  2OL8 O;  2QM9 A;  4GNW A;  3EW2 A;  4EQA C;  3RDO A;  1B56 A;  2Q2M A;  3CQN A; 
#chains in the Genus database with same CATH homology
 2UYW A;  1SWD A;  4JNJ A;  1LDQ A;  1SRG A;  3WZP A;  1NQM A;  1SWO A;  2RTL A;  1Y53 X;  5K67 A;  1IJ8 A;  1RXK A;  1VWE B;  4Z6J A;  3VHI A;  4JHQ A;  3PK2 A;  3T6L A;  3T2X A;  2JGS A;  1KL3 A;  1VYO A;  2MF6 A;  2WPU A;  2Y3F A;  1RAV A;  3WZN A;  4CPF A;  4GGR A;  2IZK A;  1VWN B;  2RTR B;  5B5G A;  1STR B;  1MEP A;  2IZI A;  2IZH B;  2A5C A;  1SWG A;  2OFA A;  2A8G A;  1SWR A;  4Z2O A;  5IRW A;  1VWG B;  3VHM A;  1SRE A;  1SWE A;  1KL4 A;  1RXH A;  4Z28 A;  4GGZ A;  4BX7 A;  3T6F A;  1HXZ A;  1SRJ A;  2IZA A;  3RE6 A;  1NDJ A;  1STP A;  2RTE B;  1NBX A;  4GD9 A;  1HY2 A;  1MM9 A;  5L3Y A;  4CPH B;  3WYP A;  4Y59 A;  1I9H A;  5CSE A;  3RDS A;  1LUQ A;  1VWF B;  1Y52 X;  2RTJ A;  5IRU A;  4BBO A;  1VWI B;  4CPH A;  1NQN A;  3RE5 A;  2QCB A;  2C4I A;  2IZG B;  1N4J A;  1LDO A;  1SWK A;  3MM0 A;  4I60 A;  3MG5 A;  3RDX A;  4CPE A;  1VWA B;  1AVE A;  3FDC A;  4GJS A;  2RTF B;  4OKA A;  2IZB A;  2IZF B;  1KFF A;  3T2W A;  3SZH A;  3RDU A;  2A5B A;  4Z27 A;  2ZSC A;  4U46 A;  1VWL B;  1SWH A;  2UZ2 A;  3RDQ A;  3WZO A;  4CPI A;  1HQQ A;  3RDO A;  3RY2 A;  1SLE B;  1SRF A;  4JO6 A;  2RTB B;  4GJV A;  4GDA A;  5CHK A;  1SWT A;  3VHH A;  1SWQ A;  4BX5 B;  2RTG B;  1RST B;  1N9Y A;  4BJ8 A;  4DNE A;  2Y3E A;  3VGW A;  2IZD B;  1SLD B;  2RTQ B;  2RTI B;  1SWN A;  2C1Q A;  1SWC A;  1VWC B;  5IRA A;  2RTM A;  1SWP A;  1LCW A;  2G5L A;  2RTC B;  2OF9 A;  1VWH B;  1SWJ A;  2BC3 A;  2IZJ A;  1VWJ B;  1AVD A;  1VWO B;  3X00 A;  4BCS A;  1LCV A;  3WYQ A;  3SZJ A;  4Z2V A;  4GGT A;  5F2B A;  1SLG B;  5B5F A;  1SWS A;  1N43 A;  4BX6 B;  1N7Y A;  2RTN B;  1VWD B;  1LCZ A;  1VWR B;  1N9M A;  2IZE B;  2RTH B;  1VWQ B;  2OFB A;  2RTP B;  2AVI A;  4EKV A;  2CAM A;  2RTD B;  4BX6 A;  1SWU A;  1SLF B;  1Y55 X;  2C1S A;  2GH7 A;  4Z2P A;  1RXJ A;  1PTS A;  2IZL B;  5JD2 A;  1SRI A;  4BX5 A;  1LEL A;  1STS B;  1WBI A;  1NC9 A;  1HXL A;  1SRH A;  1SWF A;  2FHL A;  4BX7 B;  4YVB A;  2F01 A;  5K68 A;  4IRW A;  2RTK A;  3RDM A;  2Y32 A;  3WZQ A;  1KL5 A;  2IZC B;  1VWP B;  4Y5D A;  1VWM B;  1SWB A;  3SZI A;  1RSU B;  3EW1 A;  2RTA A;  1VWB B;  3RY1 A;  1SWA A;  1MK5 A;  2FHN X;  2OF8 A;  1MOY A;  1VWK B;  3EW2 A;  1SWL A;  2RTO B;  1DF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...