1SWUA

Streptavidin mutant y43f
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
b'GITGTWYNQLGSTFIVTAGADGALTGTFESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title Atomic resolution structure of biotin-free Tyr43Phe streptavidin: what is in the binding site?
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Protein binding
total genus 27
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1swuA00
2RTBB 1HY2A 2IZIA 2UZ2A 2IZCB 3FDCA 2ZSCA 4BX7A 1VWCB 2IZHB 1STSB 4GDAA 4GD9A 4OKAA 1SWSA 1VWAB 3MM0A 3VGWA 1N9MA 2FHNX 3SZHA 3WYPA 1Y55X 5IRUA 1SRHA 1LCVA 1SWLA 2MF6A 1SWHA 2RTCB 5IRAA 1HQQA 1RXHA 1VWIB 1DF8A 1LCZA 2RTFB 4GGRA 1RSTB 4CPEA 2FHLA 1SLDB 1SWQA 2Y32A 3VHMA 1VWDB 1IJ8A 1LDOA 1SLGB 4JNJA 2IZEB 2IZGB 1KFFA 2GH7A 3RDSA 3RDOA 2RTJA 3X00A 1NBXA 1AVEA 1NQNA 1RXJA 1KL3A 3PK2A 4EKVA 4Z2VA 1SWRA 3RDMA 1RAVA 1SWOA 2A5CA 4CPHB 3MG5A 4Y5DA 1VWMB 2RTIB 1RSUB 2JGSA 1LUQA 1STPA 3T2WA 4I60A 4GGZA 2IZDB 1SWCA 5F2BA 2A8GA 2RTAA 2IZBA 1SWUA 1KL4A 1VWEB 1SWGA 3RDQA 1VYOA 1SRFA 3RE6A 1VWFB 3T6FA 3VHIA 1RXKA 1SWEA 2C1SA 2OF8A 4U46A 3RE5A 1VWJB 3RY1A 2Y3FA 3WZNA 1SWFA 3EW2A 5CHKA 4CPHA 5CSEA 3SZIA 1SWKA 4Z2PA 2OFAA 3RDXA 1SWBA 4BBOA 1PTSA 2RTMA 1Y53X 1N4JA 1SRIA 3EW1A 4IRWA 4BX6B 2IZLB 2OF9A 1I9HA 1N9YA 1SWTA 1VWQB 4Y59A 4Z27A 2F01A 1NC9A 1NQMA 2RTKA 5IRWA 4Z2OA 2AVIA 4JHQA 2IZKA 2OFBA 5JD2A 1MM9A 1SLEB 2IZAA 2RTDB 2RTEB 1N7YA 2RTRB 2C1QA 1VWPB 4Z28A 2RTPB 3T6LA 5K67A 3WZQA 4Z6JA 2RTGB 4BJ8A 4GJSA 4BX6A 1SRJA 3VHHA 4BX5B 1SWJA 1MK5A 2WPUA 1N43A 1VWBB 3RDUA 2IZJA 2QCBA 1LCWA 1SWNA 3WYQA 5B5FA 1SWPA 2RTHB 1VWNB 2BC3A 1VWLB 5K68A 2A5BA 1SLFB 2RTNB 2RTLA 1Y52X 5B5GA 4JO6A 3RY2A 1LDQA 1VWHB 2CAMA 4GJVA 2Y3EA 4CPFA 1HXZA 1SRGA 1NDJA 1SWAA 1VWRB 1VWKB 2C4IA 3T2XA 3SZJA 3WZPA 1KL5A 4BX7B 5L3YA 2UYWA 4BX5A 1AVDA 2RTQB 1SWDA 1VWGB 1WBIA 4YVBA 1VWOB 4BCSA 1SREA 4CPIA 1MEPA 1STRB 3WZOA 2IZFB 1LELA 1MOYA 4DNEA 4GGTA 1HXLA 2G5LA 2RTOB
chains in the Genus database with same CATH superfamily
4YKOA 3PH5A 1PBOA 1MUPA 2CM9A 2GTLN 4BGFA 3P6EA 4BX7A 1P6PA 1ICNA 2IZHB 3PECA 3MBTA 1I04A 1VWAB 2CBRA 3EYCA 3AUMO 3GE2A 1EIIA 2FHNX 2X56A 3NPOA 3APXA 3VPJE 1JMZA 2QOMA 1ACDA 3EM0A 3ZW1B 1EPAA 1LCVA 1AQBA 1SWLA 4L3RA 1FEMA 2WQ9A 3G7XA 1JYDA 5BVSA 1EALA 1G85A 1N0SA 1SWHA 1GX8A 1GM6A 2LFOA 3SAOA 3TF6A 1HQQA 1RXHA 2O62A 1EIOA 3FEKA 2RTFB 4GGRA 1LIEA 2X4MA 2QO4A 4GNWA 4XMGA 1IKEA 2L9CA 3O2YA 4CPEA 2ALLX 3BSZE 3FELA 3CQNA 1B0OA 1W4TA 3C78X 5HTEA 3WXQA 2GH7A 3BRNA 2FKJA 1ADLA 2RTJA 1NBXA 3HPEA 3PK2A 1QY2A 4EKVA 1GXAA 4KCAA 1SWRA 2CZUA 3B2KA 4QZUA 1FJ1E 2FR2A 4GDZA 1RSUB 3HOLA 2JGSA 3C77X 4A1HA 1STPA 3T2WA 1AELA 2K62A 5HBSA 2Q2MA 1LIBA 3WJDA 4I6SA 5F2BA 4KT5A 1SXYA 3WVMA 4A8ZA 2RTAA 5EZ2A 4L1NA 1KL4A 4OMXA 4AZOA 3WZNA 1SWGA 4C5PA 4O4OA 5CYBA 1SRFA 2L68A 5D8JA 2VDFA 4GUZA 3VHIA 2NNEA 1LNMA 2HZQA 1WUBA 4U46A 2WQAE 3MVFA 3S5VA 1LIDA 2Y3FA 3AKMA 4QYNA 4U9CA 2WEXA 3RSWA 2X8TA 4U8UM 5CSEA 1X8OA 2LB6A 2AL0X 2BS5A 3NQ9A 4XMHA 5HZQA 3RDXA 4BBOA 2R73A 2RTMA 1Y53X 3O19A 1SRIA 4NYRA 4YFPA 5L8NA 2IZLB 2MHDA 2OF9A 2OY1O 1I9HA 1CBRA 1SWTA 4MVEA 4Y59A 5D48A 5HCEC 3S60A 4LZUA 2KTSA 2L67A 3HWGA 2OZQA 3P24A 5AJCA 3VG2A 4IB6A 3RKGA 3TGBA 4GK9A 1OBQA 4PJ2A 3FEPA 1MM9A 1QG5A 4QGWA 4ALBA 5BYPA 2RTRB 4QGVA 4ODDA 4NV8A 1VWPB 4GE1A 1SMPI 2HMBA 5EDCA 2OY7A 3F8AA 5B2AO 4Y0PA 3RZYA 2ACPX 5HZ5A 1QWDA 3Q34A 5H9LA 4BJ8A 3KFHA 1JIWI 3VG4A 4BX6A 2FS7A 4IB9A 4UU2A 2N93A 4OEMA 4BVMA 1MK5A 1N43A 2AT8X 1X71A 3RDUA 2G7BA 4XMEA 3VG3A 2JU8A 3VU1A 1SWPA 3VE2A 1VWNB 4WFUA 1VWLB 1UYOX 4CDCA 3TGCA 2JMBA 1SLFB 5FFHA 1CRBA 2FGSA 4IAXA 2RTNB 4ZFXA 4M6SA 4JO6A 3SLTA 1XCAA 4OMWA 2ZAGA 1SRGA 1VWKB 2OVDA 1SWAA 2C4IA 3SZJA 3WZPA 1LKEA 1RLBE 3L4RA 3NP1A 4ARHA 3S5XA 4B55A 4BX5A 4XMFA 3B2LA 4LQZA 3FR4A 1MVGA 2RTQB 1FE3A 1WBIA 3BS2A 4FBVA 4YVBA 1VWOB 5H9AA 3WJBA 4O3WA 3WZOA 3MX7A 3UEWA 1MOYA 3NR3A 4PSQA 5HTDA 2OL6O 1GT1A 3WYPA 2RTOB 2W2FA 3CMPA 4TNNA 1KZXA 2RTBB 1VPRA 2JW1A 1I78A 3FA6A 4OKAA 3VGWA 1UYNX 4ZHHA 2X45A 1N9MA 3CR6A 4RUUA 2GTLM 4YH0A 1A3YA 2OVEA 1SRHA 1DZMA 4AZMA 3VG6A 2FLJA 1K24A 1ZRYA 2ASNX 5B10O 3P6DA 5IRAA 1SXXA 3BU9A 5BVQA 2QO6A 1A18A 1KT7A 5HZ9A 4I9SA 2KD2A 2FHLA 1SLDB 2AKQA 1G74A 1QY1A 1SWQA 2BT9A 2X34A 3PEDA 4KIIA 1VWDB 1IJ8A 1T8VA 3VHMA 1W5RA 2IZGB 1KFFA 4QYPA 3RDSA 3ZW2A 5KIDA 1QFTA 4Z2VA 1AVEA 2IFBA 3WJCA 2ACOA 2BHVA 3RDMA 1RAVA 1SWOA 4IAWA 5C0NA 2A0AA 3ZW0A 5HWZA 2Z4IA 4EQAC 3S26A 5KICA 2LKKA 3KFIA 5L8OA 1KT4A 1ICMA 1OBUA 1SWCA 4ZH9A 2P8GA 2WUTA 2OYBO 3APUA 2EU7X 2A8GA 3CWKA 4MVLA 2IZBA 4NYQA 1A2DA 1FENA 1VWEB 5EPQA 1JJXA 3B2JA 3RDQA 4OS3A 2GC9A 4U8UO 1RXKA 3FYFA 2C1SA 4XMDA 4YDAA 3RE5A 1JV4A 1G7NA 3RY1A 5F1EA 4CPHA 3PDFA 4MIRA 4YBPA 3GAQA 1HN2A 3BDRA 3CKFA 2A2UA 3PH6A 2OFAA 3PPTA 3SZIA 4XMCA 3FA9A 4TJZA 4A60A 4BX6B 1JJJA 2A3FX 1DZJA 1YWAA 1LIFA 3PQUA 4LKTA 2OFRX 1YWBA 4O4UA 3B2IA 3BX7A 3T1DA 1NC9A 4NLIA 4WBKA 2F73A 1FELA 2OVSA 1AB0A 2MM3A 4YMYA 3IA8A 1VYFA 3DSZA 2OFBA 5JD2A 3CBCA 1SLEB 1ZNDA 3CQRA 3HWFA 4O3ZA 5D45A 2RTDB 2FR3A 2RTEB 3ZUIA 4Y0SA 5IO5A 1D2UA 1DV9A 5H9KA 2GJ5A 5K67A 1OBPA 3I0AA 2G78A 1YP7A 1KQWA 3KZAA 4O4XA 1BRPA 4FBRA 4BX5B 1SWJA 2CBSA 1S2PA 3QKGA 2RN4A 3KVNA 1PEEA 4CSBA 1BM5A 3BLGA 3AKNA 3FW4A 1G5WA 2IZJA 4YCHA 1LCWA 3FIQA 3RWXA 2HNXA 1E00A 2RTHB 5HAEA 1YUPA 3JQOA 1EXSA 4HPAA 4CDDA 2G8CO 1ZNKA 5FAZA 5FQ7E 4JGLA 3ZZVA 3CBSA 2I5VO 3EBKA 1X8PA 1X8NA 1KOIA 1Y52X 2W2BA 4IB8A 4YGGA 5F6BA 3CKGA 2BLGA 1BJ7A 5B5GA 1ZNGA 2X55A 1LDQA 1QY0A 4GRJA 1TOUA 2OFMX 4LZVA 1BWYA 1ML7A 4GETA 3LV4A 1BEBA 3P6CA 2UYWA 3KFFA 4AW8A 3D96A 5EEDA 1AVDA 1ERXA 4N7CA 5LJDA 3STMX 4YFRA 4MVIA 4Y0QA 3UEVA 4TQ2A 1HQPA 2POAA 1STRB 2Q39A 4QQ1A 1BRQA 1KGLA 2HLVA 1W6FA 4NNSA 4D6AA 1ERBA 4GGTA 4ORYA 5HCDC 2G5LA 5LJCA 1O1UA 5CE4A 4ZJ0A 1B4MA 1HY2A 2IZIA 2UZ2A 2WR6A 3ZUOA 3FDCA 2GTLO 3ZW1A 2ZSCA 4TKBA 4OS8A 1ZNLA 1VWCB 4LKPA 1STSB 4AZRA 4ZHGA 1O1VA 1SWSA 3ZWEA 4CDEA 1BSYA 1IFCA 2HKDA 1E02A 5IRUA 3ZW0B 2MJIA 4EXZA 3EBWA 3VG5A 4WFVA 5LKEA 3ELZA 2A13A 1CBQA 1VWIB 4NLJA 1DF8A 1LCZA 2BSZA 3HWDA 4EDEA 3FA8A 3NQ3A 2ZAIA 1RSTB 2F09A 4I95A 4ALOA 1O8VA 3STKA 4QNIA 5F58A 3FIDA 2Y32A 4IABA 4KC8A 1PMPA 4JNJA 1SLGB 3D97A 4YFQA 3RDOA 3X00A 5H8TA 5L8IA 3WJEA 1B8EA 3FMZA 1KL3A 4UU3A 5IXGA 1LFOA 5HZ6A 1KT3A 3V8UA 4CPHB 2FS6A 4Y5DA 2RTIB 3U0DA 1YIVA 4I3BA 3FLLA 1LUQA 1ALBA 4O49A 1BBPA 2IZDB 3EMMA 5B29A 5LJKA 2NNQA 1JQPA 4ES7A 1KT6A 1SWUA 3OJYC 5LJEA 1JBHA 3NX1A 5FQ6E 3FENA 3RE6A 3OBLA 3T6FA 4ORSA 4ON1A 1NP4A 2Z4HA 1SWEA 3JSQA 1HMSA 4ZHFA 1Y9TA 2DM5A 1OPBA 1Z24A 3SLOA 2ANSA 1SWFA 3C76X 3EW2A 3K3LA 5LKFA 3STNA 4EFGA 1UREA 5B3MO 3PQSA 4ORRA 1PTSA 2Q4NA 2CZTA 4N7DA 4U3QA 5D4AA 1E06A 5AEOA 1GT3A 1JZUA 1N9YA 1VWQB 2AMMX 4KC7A 1KT5A 2F01A 3BX8A 1NQMA 3D4RA 1QQSA 4AYHA 1MDCA 4TKHA 4CV7A 4Z2OA 1GT5A 2AVIA 4O4SA 1LICA 2PY1A 4CDFA 2QM9A 5BVTA 2L5PA 5D47A 5EEEA 4ML7B 1QFVA 2C1QA 3FA7A 1PBYA 5AJBA 5IO6A 2RTPB 2W2AA 3LHNA 3T6LA 1QABE 4FBOA 1GGLA 1R0UA 3FR2A 3Q6LA 5IO7A 2RTGB 1YWDA 2VFCA 3OE3A 4OELA 1SRJA 3E3CA 2VFBA 4IBAA 4QZTA 3VHHA 4EEJA 5AQ6A 4ORUA 2FTBA 1E2TA 2RA6A 2R74A 1DC9A 1S44A 3I17A 3NX2A 5KHPA 1S7DA 4NV7A 1SWNA 3EC5A 3KFGA 1IW2A 2BC3A 2NNDA 2X8FA 5K68A 4IMNA 4CK4A 4COTA 4ZHDA 3TZSA 1OPAA 1OEKA 2PI3O 1D3SA 3WJGA 3TGAA 2FWVA 1JJUA 4AZNA 2OL8O 3RBYA 1MX7A 1NGLA 1CJ5A 3FW5A 3O22A 4I9RA 2JU3A 3RY2A 4CPFA 3PP6A 1HXZA 3VG7A 1NDJA 3T2XA 3ELXA 4DQ4A 1KL5A 5L3YA 2QMIA 2AH7X 1PM1X 2A2GA 3BY0A 1SWDA 1VWGB 2RD7C 4HFOA 2DJFA 4YCEA 1GX3A 1U17A 4YGHA 4YGZA 4HPBA 4CPIA 5LJGA 2M4LA 1UZ2X 1YWCA 2IZFB 4GNYA 1DF3A 1KXOA 3FR5A 4DNEA 4KH8A 1HXLA 1MX8A 3F9DA 2X8SA 2K23A 3VE1A 3QQ2A 2IZCB 3ZQ3A 2RQ0A 2OL7A 5B11O 3OD9A 4GDAA 1X8QA 4GD9A 4YBUA 3MM0A 1OEJA 5DG4A 4O9SA 2RCTA 1GT4A 1K3BA 2AT0X 2Q2PA 1OSPO 2AF5A 4M7MA 3SZHA 2LBVA 1Y55X 4MEEA 3HOEA 1I05A 2XSTA 4O3XB 1X8UA 3APVA 1HBQA 2RCQA 5F6ZA 1GKAA 3SOTA 5FENA 2BS6A 3NBXX 2MF6A 2CM4A 2RTCB 5HCCC 1BSOA 1U0XA 2WEWA 1FTPA 5LJHA 3U03A 4FQBB 4GH7A 2AT3X 1SA8A 3WOVA 2G79A 4BX7B 1JYJA 1TVQA 1NP1A 2AT6X 2MO5A 4MVKA 2MWHA 4GZVA 1CBSA 1LDOA 3P6FA 2E4JA 2IZEB 1HMTA 1RXJA 1NQNA 4BQUA 1EUOA 2JN3A 3LTWA 2A5CA 4IB7A 2Q9SA 4ORWA 4A1YA 2XKLA 2LBAA 3MG5A 1VWMB 2X32A 3U9PC 2FKGA 5JR8A 1DFVA 3NQKA 4I60A 4GGZA 2OY8A 3HTYA 3P02A 4GKCA 3UEUA 1T68X 4ID2A 2YMSA 4NP1A 1E5PA 1ZNEA 2KW1A 2I5ZO 2QO5A 2QOSC 3ZI8A 4ZGFA 5B27A 1VYOA 4U8UN 1HBPA 1VWFB 4YKMA 1OEEA 5LJBA 4RUNA 3F6ZB 4O3YA 3AEHA 1SY0A 2OF8A 4GU8A 1IIUA 4ZGUA 4BOEA 5HA1A 2JU7A 1VWJB 2LA7A 2WSJA 3NADA 1EI5A 4NW4A 2JOZA 1YP6A 5CHKA 1SWKA 4Z2PA 5F7GA 1SWBA 1KQXA 5EDBA 1N4JA 1HMRA 3EW1A 4IRWA 1A57A 1SXWA 1DZPA 1VYGA 4Z27A 4AZPA 3WJFA 1T0VA 3HWEA 2RTKA 5IRWA 4HPCA 4JHQA 2IZKA 3N91A 1SXUA 2AT5X 4FGIB 5HA0A 2IZAA 4D6BA 1EPBA 1LPJA 1SY3A 1N7YA 1TW4A 2OY5O 1TOWA 1B56A 1TXLA 2OVAA 4IMOA 4Z28A 1KZWA 3D95A 4TKJA 1L6MA 1RBPA 3WZQA 4Z6JA 1LF7A 3DTQA 4ZH6A 4GJSA 1Y9LA 1GX9A 5HZ8A 1BSQA 3IFBA 1EW3A 3BU1A 3SLJA 1JMXA 2WPUA 2FT9A 1CBIA 4HPDA 4Y0RA 1VWBB 1X89A 3JS1A 2QCBA 2HZRA 4R0BA 3WYQA 5B5FA 1XKIA 1Y0GA 2NP1A 4AZQA 4DCBA 5K06A 1U18A 4ZCBA 4TLJA 2A5BA 4OS0A 3KQ0A 2RTLA 2R56A 2KT4B 5DPQA 3WBGA 2X46A 2FRSA 4WHIA 4ZR2A 3UEXA 3B2HA 1I4UA 1VWHB 2CAMA 2HYSA 2Y3EA 3P6HA 4GJVA 5H9NA 1VWRB 4HWMA 4ZHCA 2YG2A 2WWPA 1DZKA 1FDQA 4K19A 1SY1A 5FQ8E 4DQ3A 4INNA 4I3CA 2KTDA 3D9WA 1IFBA 3APWA 4MISA 4NNTA 3UAQA 4I3DA 4BCSA 1I06A 3P6GA 1SREA 1ZNHA 1MEPA 3H3IA 3HK1A 4QAEA 4QRLA 4YDBA 1GKAB 1BLRA 1EQDA 4ORXA 1IKJA 4QGXA 1LELA 1H91A 1SY2A 2GTFX 1AVGI 2DJGA
chains in the Genus database with same CATH topology
2RTBB 1HY2A 2IZIA 2UZ2A 2IZCB 3FDCA 2ZSCA 4BX7A 1VWCB 2IZHB 1STSB 4GDAA 4GD9A 4OKAA 1SWSA 1VWAB 3MM0A 3VGWA 1N9MA 2FHNX 3SZHA 3WYPA 1Y55X 5IRUA 1SRHA 1LCVA 1SWLA 2MF6A 1SWHA 2RTCB 5IRAA 1HQQA 1RXHA 1VWIB 1DF8A 1LCZA 2RTFB 4GGRA 1RSTB 4CPEA 2FHLA 1SLDB 1SWQA 2Y32A 3VHMA 1VWDB 1IJ8A 1LDOA 1SLGB 4JNJA 2IZEB 2IZGB 1KFFA 2GH7A 3RDSA 3RDOA 2RTJA 3X00A 1NBXA 1AVEA 1NQNA 1RXJA 1KL3A 3PK2A 4EKVA 4Z2VA 1SWRA 3RDMA 1RAVA 1SWOA 2A5CA 4CPHB 3MG5A 4Y5DA 1VWMB 2RTIB 1RSUB 2JGSA 1LUQA 1STPA 3T2WA 4I60A 4GGZA 2IZDB 1SWCA 5F2BA 2A8GA 2RTAA 2IZBA 1SWUA 1KL4A 1VWEB 1SWGA 3RDQA 1VYOA 1SRFA 3RE6A 1VWFB 3T6FA 3VHIA 1RXKA 1SWEA 2C1SA 2OF8A 4U46A 3RE5A 1VWJB 3RY1A 2Y3FA 3WZNA 1SWFA 3EW2A 5CHKA 4CPHA 5CSEA 3SZIA 1SWKA 4Z2PA 2OFAA 3RDXA 1SWBA 4BBOA 1PTSA 2RTMA 1Y53X 1N4JA 1SRIA 3EW1A 4IRWA 4BX6B 2IZLB 2OF9A 1I9HA 1N9YA 1SWTA 1VWQB 4Y59A 4Z27A 2F01A 1NC9A 1NQMA 2RTKA 5IRWA 4Z2OA 2AVIA 4JHQA 2IZKA 2OFBA 5JD2A 1MM9A 1SLEB 2IZAA 2RTDB 2RTEB 1N7YA 2RTRB 2C1QA 1VWPB 4Z28A 2RTPB 3T6LA 5K67A 3WZQA 4Z6JA 2RTGB 4BJ8A 4GJSA 4BX6A 1SRJA 3VHHA 4BX5B 1SWJA 1MK5A 2WPUA 1N43A 1VWBB 3RDUA 2IZJA 2QCBA 1LCWA 1SWNA 3WYQA 5B5FA 1SWPA 2RTHB 1VWNB 2BC3A 1VWLB 5K68A 2A5BA 1SLFB 2RTNB 2RTLA 1Y52X 5B5GA 4JO6A 3RY2A 1LDQA 1VWHB 2CAMA 4GJVA 2Y3EA 4CPFA 1HXZA 1SRGA 1NDJA 1SWAA 1VWRB 1VWKB 2C4IA 3T2XA 3SZJA 3WZPA 1KL5A 4BX7B 5L3YA 2UYWA 4BX5A 1AVDA 2RTQB 1SWDA 1VWGB 1WBIA 4YVBA 1VWOB 4BCSA 1SREA 4CPIA 1MEPA 1STRB 3WZOA 2IZFB 1LELA 1MOYA 4DNEA 4GGTA 1HXLA 2G5LA 2RTOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RTB B;  1HY2 A;  2IZI A;  2UZ2 A;  2IZC B;  3FDC A;  2ZSC A;  4BX7 A;  1VWC B;  2IZH B;  1STS B;  4GDA A;  4GD9 A;  4OKA A;  1SWS A;  1VWA B;  3MM0 A;  3VGW A;  1N9M A;  2FHN X;  3SZH A;  3WYP A;  1Y55 X;  5IRU A;  1SRH A;  1LCV A;  1SWL A;  2MF6 A;  1SWH A;  2RTC B;  5IRA A;  1HQQ A;  1RXH A;  1VWI B;  1DF8 A;  1LCZ A;  2RTF B;  4GGR A;  1RST B;  4CPE A;  2FHL A;  1SLD B;  1SWQ A;  2Y32 A;  3VHM A;  1VWD B;  1IJ8 A;  1LDO A;  1SLG B;  4JNJ A;  2IZE B;  2IZG B;  1KFF A;  2GH7 A;  3RDS A;  3RDO A;  2RTJ A;  3X00 A;  1NBX A;  1AVE A;  1NQN A;  1RXJ A;  1KL3 A;  3PK2 A;  4EKV A;  4Z2V A;  1SWR A;  3RDM A;  1RAV A;  1SWO A;  2A5C A;  4CPH B;  3MG5 A;  4Y5D A;  1VWM B;  2RTI B;  1RSU B;  2JGS A;  1LUQ A;  1STP A;  3T2W A;  4I60 A;  4GGZ A;  2IZD B;  1SWC A;  5F2B A;  2A8G A;  2RTA A;  2IZB A;  1SWU A;  1KL4 A;  1VWE B;  1SWG A;  3RDQ A;  1VYO A;  1SRF A;  3RE6 A;  1VWF B;  3T6F A;  3VHI A;  1RXK A;  1SWE A;  2C1S A;  2OF8 A;  4U46 A;  3RE5 A;  1VWJ B;  3RY1 A;  2Y3F A;  3WZN A;  1SWF A;  3EW2 A;  5CHK A;  4CPH A;  5CSE A;  3SZI A;  1SWK A;  4Z2P A;  2OFA A;  3RDX A;  1SWB A;  4BBO A;  1PTS A;  2RTM A;  1Y53 X;  1N4J A;  1SRI A;  3EW1 A;  4IRW A;  4BX6 B;  2IZL B;  2OF9 A;  1I9H A;  1N9Y A;  1SWT A;  1VWQ B;  4Y59 A;  4Z27 A;  2F01 A;  1NC9 A;  1NQM A;  2RTK A;  5IRW A;  4Z2O A;  2AVI A;  4JHQ A;  2IZK A;  2OFB A;  5JD2 A;  1MM9 A;  1SLE B;  2IZA A;  2RTD B;  2RTE B;  1N7Y A;  2RTR B;  2C1Q A;  1VWP B;  4Z28 A;  2RTP B;  3T6L A;  5K67 A;  3WZQ A;  4Z6J A;  2RTG B;  4BJ8 A;  4GJS A;  4BX6 A;  1SRJ A;  3VHH A;  4BX5 B;  1SWJ A;  1MK5 A;  2WPU A;  1N43 A;  1VWB B;  3RDU A;  2IZJ A;  2QCB A;  1LCW A;  1SWN A;  3WYQ A;  5B5F A;  1SWP A;  2RTH B;  1VWN B;  2BC3 A;  1VWL B;  5K68 A;  2A5B A;  1SLF B;  2RTN B;  2RTL A;  1Y52 X;  5B5G A;  4JO6 A;  3RY2 A;  1LDQ A;  1VWH B;  2CAM A;  4GJV A;  2Y3E A;  4CPF A;  1HXZ A;  1SRG A;  1NDJ A;  1SWA A;  1VWR B;  1VWK B;  2C4I A;  3T2X A;  3SZJ A;  3WZP A;  1KL5 A;  4BX7 B;  5L3Y A;  2UYW A;  4BX5 A;  1AVD A;  2RTQ B;  1SWD A;  1VWG B;  1WBI A;  4YVB A;  1VWO B;  4BCS A;  1SRE A;  4CPI A;  1MEP A;  1STR B;  3WZO A;  2IZF B;  1LEL A;  1MOY A;  4DNE A;  4GGT A;  1HXL A;  2G5L A;  2RTO B; 
#chains in the Genus database with same CATH topology
 4YKO A;  3PH5 A;  1PBO A;  1MUP A;  2CM9 A;  2GTL N;  4BGF A;  3P6E A;  4BX7 A;  1P6P A;  1ICN A;  2IZH B;  3PEC A;  3MBT A;  1I04 A;  1VWA B;  2CBR A;  3EYC A;  3AUM O;  3GE2 A;  1EII A;  2FHN X;  2X56 A;  3NPO A;  3APX A;  3VPJ E;  1JMZ A;  2QOM A;  1ACD A;  3EM0 A;  3ZW1 B;  1EPA A;  1LCV A;  1AQB A;  1SWL A;  4L3R A;  1FEM A;  2WQ9 A;  3G7X A;  1JYD A;  5BVS A;  1EAL A;  1G85 A;  1N0S A;  1SWH A;  1GX8 A;  1GM6 A;  2LFO A;  3SAO A;  3TF6 A;  1HQQ A;  1RXH A;  2O62 A;  1EIO A;  3FEK A;  2RTF B;  4GGR A;  1LIE A;  2X4M A;  2QO4 A;  4GNW A;  4XMG A;  1IKE A;  2L9C A;  3O2Y A;  4CPE A;  2ALL X;  3BSZ E;  3FEL A;  3CQN A;  1B0O A;  1W4T A;  3C78 X;  5HTE A;  3WXQ A;  2GH7 A;  3BRN A;  2FKJ A;  1ADL A;  2RTJ A;  1NBX A;  3HPE A;  3PK2 A;  1QY2 A;  4EKV A;  1GXA A;  4KCA A;  1SWR A;  2CZU A;  3B2K A;  4QZU A;  1FJ1 E;  2FR2 A;  4GDZ A;  1RSU B;  3HOL A;  2JGS A;  3C77 X;  4A1H A;  1STP A;  3T2W A;  1AEL A;  2K62 A;  5HBS A;  2Q2M A;  1LIB A;  3WJD A;  4I6S A;  5F2B A;  4KT5 A;  1SXY A;  3WVM A;  4A8Z A;  2RTA A;  5EZ2 A;  4L1N A;  1KL4 A;  4OMX A;  4AZO A;  3WZN A;  1SWG A;  4C5P A;  4O4O A;  5CYB A;  1SRF A;  2L68 A;  5D8J A;  2VDF A;  4GUZ A;  3VHI A;  2NNE A;  1LNM A;  2HZQ A;  1WUB A;  4U46 A;  2WQA E;  3MVF A;  3S5V A;  1LID A;  2Y3F A;  3AKM A;  4QYN A;  4U9C A;  2WEX A;  3RSW A;  2X8T A;  4U8U M;  5CSE A;  1X8O A;  2LB6 A;  2AL0 X;  2BS5 A;  3NQ9 A;  4XMH A;  5HZQ A;  3RDX A;  4BBO A;  2R73 A;  2RTM A;  1Y53 X;  3O19 A;  1SRI A;  4NYR A;  4YFP A;  5L8N A;  2IZL B;  2MHD A;  2OF9 A;  2OY1 O;  1I9H A;  1CBR A;  1SWT A;  4MVE A;  4Y59 A;  5D48 A;  5HCE C;  3S60 A;  4LZU A;  2KTS A;  2L67 A;  3HWG A;  2OZQ A;  3P24 A;  5AJC A;  3VG2 A;  4IB6 A;  3RKG A;  3TGB A;  4GK9 A;  1OBQ A;  4PJ2 A;  3FEP A;  1MM9 A;  1QG5 A;  4QGW A;  4ALB A;  5BYP A;  2RTR B;  4QGV A;  4ODD A;  4NV8 A;  1VWP B;  4GE1 A;  1SMP I;  2HMB A;  5EDC A;  2OY7 A;  3F8A A;  5B2A O;  4Y0P A;  3RZY A;  2ACP X;  5HZ5 A;  1QWD A;  3Q34 A;  5H9L A;  4BJ8 A;  3KFH A;  1JIW I;  3VG4 A;  4BX6 A;  2FS7 A;  4IB9 A;  4UU2 A;  2N93 A;  4OEM A;  4BVM A;  1MK5 A;  1N43 A;  2AT8 X;  1X71 A;  3RDU A;  2G7B A;  4XME A;  3VG3 A;  2JU8 A;  3VU1 A;  1SWP A;  3VE2 A;  1VWN B;  4WFU A;  1VWL B;  1UYO X;  4CDC A;  3TGC A;  2JMB A;  1SLF B;  5FFH A;  1CRB A;  2FGS A;  4IAX A;  2RTN B;  4ZFX A;  4M6S A;  4JO6 A;  3SLT A;  1XCA A;  4OMW A;  2ZAG A;  1SRG A;  1VWK B;  2OVD A;  1SWA A;  2C4I A;  3SZJ A;  3WZP A;  1LKE A;  1RLB E;  3L4R A;  3NP1 A;  4ARH A;  3S5X A;  4B55 A;  4BX5 A;  4XMF A;  3B2L A;  4LQZ A;  3FR4 A;  1MVG A;  2RTQ B;  1FE3 A;  1WBI A;  3BS2 A;  4FBV A;  4YVB A;  1VWO B;  5H9A A;  3WJB A;  4O3W A;  3WZO A;  3MX7 A;  3UEW A;  1MOY A;  3NR3 A;  4PSQ A;  5HTD A;  2OL6 O;  1GT1 A;  3WYP A;  2RTO B;  2W2F A;  3CMP A;  4TNN A;  1KZX A;  2RTB B;  1VPR A;  2JW1 A;  1I78 A;  3FA6 A;  4OKA A;  3VGW A;  1UYN X;  4ZHH A;  2X45 A;  1N9M A;  3CR6 A;  4RUU A;  2GTL M;  4YH0 A;  1A3Y A;  2OVE A;  1SRH A;  1DZM A;  4AZM A;  3VG6 A;  2FLJ A;  1K24 A;  1ZRY A;  2ASN X;  5B10 O;  3P6D A;  5IRA A;  1SXX A;  3BU9 A;  5BVQ A;  2QO6 A;  1A18 A;  1KT7 A;  5HZ9 A;  4I9S A;  2KD2 A;  2FHL A;  1SLD B;  2AKQ A;  1G74 A;  1QY1 A;  1SWQ A;  2BT9 A;  2X34 A;  3PED A;  4KII A;  1VWD B;  1IJ8 A;  1T8V A;  3VHM A;  1W5R A;  2IZG B;  1KFF A;  4QYP A;  3RDS A;  3ZW2 A;  5KID A;  1QFT A;  4Z2V A;  1AVE A;  2IFB A;  3WJC A;  2ACO A;  2BHV A;  3RDM A;  1RAV A;  1SWO A;  4IAW A;  5C0N A;  2A0A A;  3ZW0 A;  5HWZ A;  2Z4I A;  4EQA C;  3S26 A;  5KIC A;  2LKK A;  3KFI A;  5L8O A;  1KT4 A;  1ICM A;  1OBU A;  1SWC A;  4ZH9 A;  2P8G A;  2WUT A;  2OYB O;  3APU A;  2EU7 X;  2A8G A;  3CWK A;  4MVL A;  2IZB A;  4NYQ A;  1A2D A;  1FEN A;  1VWE B;  5EPQ A;  1JJX A;  3B2J A;  3RDQ A;  4OS3 A;  2GC9 A;  4U8U O;  1RXK A;  3FYF A;  2C1S A;  4XMD A;  4YDA A;  3RE5 A;  1JV4 A;  1G7N A;  3RY1 A;  5F1E A;  4CPH A;  3PDF A;  4MIR A;  4YBP A;  3GAQ A;  1HN2 A;  3BDR A;  3CKF A;  2A2U A;  3PH6 A;  2OFA A;  3PPT A;  3SZI A;  4XMC A;  3FA9 A;  4TJZ A;  4A60 A;  4BX6 B;  1JJJ A;  2A3F X;  1DZJ A;  1YWA A;  1LIF A;  3PQU A;  4LKT A;  2OFR X;  1YWB A;  4O4U A;  3B2I A;  3BX7 A;  3T1D A;  1NC9 A;  4NLI A;  4WBK A;  2F73 A;  1FEL A;  2OVS A;  1AB0 A;  2MM3 A;  4YMY A;  3IA8 A;  1VYF A;  3DSZ A;  2OFB A;  5JD2 A;  3CBC A;  1SLE B;  1ZND A;  3CQR A;  3HWF A;  4O3Z A;  5D45 A;  2RTD B;  2FR3 A;  2RTE B;  3ZUI A;  4Y0S A;  5IO5 A;  1D2U A;  1DV9 A;  5H9K A;  2GJ5 A;  5K67 A;  1OBP A;  3I0A A;  2G78 A;  1YP7 A;  1KQW A;  3KZA A;  4O4X A;  1BRP A;  4FBR A;  4BX5 B;  1SWJ A;  2CBS A;  1S2P A;  3QKG A;  2RN4 A;  3KVN A;  1PEE A;  4CSB A;  1BM5 A;  3BLG A;  3AKN A;  3FW4 A;  1G5W A;  2IZJ A;  4YCH A;  1LCW A;  3FIQ A;  3RWX A;  2HNX A;  1E00 A;  2RTH B;  5HAE A;  1YUP A;  3JQO A;  1EXS A;  4HPA A;  4CDD A;  2G8C O;  1ZNK A;  5FAZ A;  5FQ7 E;  4JGL A;  3ZZV A;  3CBS A;  2I5V O;  3EBK A;  1X8P A;  1X8N A;  1KOI A;  1Y52 X;  2W2B A;  4IB8 A;  4YGG A;  5F6B A;  3CKG A;  2BLG A;  1BJ7 A;  5B5G A;  1ZNG A;  2X55 A;  1LDQ A;  1QY0 A;  4GRJ A;  1TOU A;  2OFM X;  4LZV A;  1BWY A;  1ML7 A;  4GET A;  3LV4 A;  1BEB A;  3P6C A;  2UYW A;  3KFF A;  4AW8 A;  3D96 A;  5EED A;  1AVD A;  1ERX A;  4N7C A;  5LJD A;  3STM X;  4YFR A;  4MVI A;  4Y0Q A;  3UEV A;  4TQ2 A;  1HQP A;  2POA A;  1STR B;  2Q39 A;  4QQ1 A;  1BRQ A;  1KGL A;  2HLV A;  1W6F A;  4NNS A;  4D6A A;  1ERB A;  4GGT A;  4ORY A;  5HCD C;  2G5L A;  5LJC A;  1O1U A;  5CE4 A;  4ZJ0 A;  1B4M A;  1HY2 A;  2IZI A;  2UZ2 A;  2WR6 A;  3ZUO A;  3FDC A;  2GTL O;  3ZW1 A;  2ZSC A;  4TKB A;  4OS8 A;  1ZNL A;  1VWC B;  4LKP A;  1STS B;  4AZR A;  4ZHG A;  1O1V A;  1SWS A;  3ZWE A;  4CDE A;  1BSY A;  1IFC A;  2HKD A;  1E02 A;  5IRU A;  3ZW0 B;  2MJI A;  4EXZ A;  3EBW A;  3VG5 A;  4WFV A;  5LKE A;  3ELZ A;  2A13 A;  1CBQ A;  1VWI B;  4NLJ A;  1DF8 A;  1LCZ A;  2BSZ A;  3HWD A;  4EDE A;  3FA8 A;  3NQ3 A;  2ZAI A;  1RST B;  2F09 A;  4I95 A;  4ALO A;  1O8V A;  3STK A;  4QNI A;  5F58 A;  3FID A;  2Y32 A;  4IAB A;  4KC8 A;  1PMP A;  4JNJ A;  1SLG B;  3D97 A;  4YFQ A;  3RDO A;  3X00 A;  5H8T A;  5L8I A;  3WJE A;  1B8E A;  3FMZ A;  1KL3 A;  4UU3 A;  5IXG A;  1LFO A;  5HZ6 A;  1KT3 A;  3V8U A;  4CPH B;  2FS6 A;  4Y5D A;  2RTI B;  3U0D A;  1YIV A;  4I3B A;  3FLL A;  1LUQ A;  1ALB A;  4O49 A;  1BBP A;  2IZD B;  3EMM A;  5B29 A;  5LJK A;  2NNQ A;  1JQP A;  4ES7 A;  1KT6 A;  1SWU A;  3OJY C;  5LJE A;  1JBH A;  3NX1 A;  5FQ6 E;  3FEN A;  3RE6 A;  3OBL A;  3T6F A;  4ORS A;  4ON1 A;  1NP4 A;  2Z4H A;  1SWE A;  3JSQ A;  1HMS A;  4ZHF A;  1Y9T A;  2DM5 A;  1OPB A;  1Z24 A;  3SLO A;  2ANS A;  1SWF A;  3C76 X;  3EW2 A;  3K3L A;  5LKF A;  3STN A;  4EFG A;  1URE A;  5B3M O;  3PQS A;  4ORR A;  1PTS A;  2Q4N A;  2CZT A;  4N7D A;  4U3Q A;  5D4A A;  1E06 A;  5AEO A;  1GT3 A;  1JZU A;  1N9Y A;  1VWQ B;  2AMM X;  4KC7 A;  1KT5 A;  2F01 A;  3BX8 A;  1NQM A;  3D4R A;  1QQS A;  4AYH A;  1MDC A;  4TKH A;  4CV7 A;  4Z2O A;  1GT5 A;  2AVI A;  4O4S A;  1LIC A;  2PY1 A;  4CDF A;  2QM9 A;  5BVT A;  2L5P A;  5D47 A;  5EEE A;  4ML7 B;  1QFV A;  2C1Q A;  3FA7 A;  1PBY A;  5AJB A;  5IO6 A;  2RTP B;  2W2A A;  3LHN A;  3T6L A;  1QAB E;  4FBO A;  1GGL A;  1R0U A;  3FR2 A;  3Q6L A;  5IO7 A;  2RTG B;  1YWD A;  2VFC A;  3OE3 A;  4OEL A;  1SRJ A;  3E3C A;  2VFB A;  4IBA A;  4QZT A;  3VHH A;  4EEJ A;  5AQ6 A;  4ORU A;  2FTB A;  1E2T A;  2RA6 A;  2R74 A;  1DC9 A;  1S44 A;  3I17 A;  3NX2 A;  5KHP A;  1S7D A;  4NV7 A;  1SWN A;  3EC5 A;  3KFG A;  1IW2 A;  2BC3 A;  2NND A;  2X8F A;  5K68 A;  4IMN A;  4CK4 A;  4COT A;  4ZHD A;  3TZS A;  1OPA A;  1OEK A;  2PI3 O;  1D3S A;  3WJG A;  3TGA A;  2FWV A;  1JJU A;  4AZN A;  2OL8 O;  3RBY A;  1MX7 A;  1NGL A;  1CJ5 A;  3FW5 A;  3O22 A;  4I9R A;  2JU3 A;  3RY2 A;  4CPF A;  3PP6 A;  1HXZ A;  3VG7 A;  1NDJ A;  3T2X A;  3ELX A;  4DQ4 A;  1KL5 A;  5L3Y A;  2QMI A;  2AH7 X;  1PM1 X;  2A2G A;  3BY0 A;  1SWD A;  1VWG B;  2RD7 C;  4HFO A;  2DJF A;  4YCE A;  1GX3 A;  1U17 A;  4YGH A;  4YGZ A;  4HPB A;  4CPI A;  5LJG A;  2M4L A;  1UZ2 X;  1YWC A;  2IZF B;  4GNY A;  1DF3 A;  1KXO A;  3FR5 A;  4DNE A;  4KH8 A;  1HXL A;  1MX8 A;  3F9D A;  2X8S A;  2K23 A;  3VE1 A;  3QQ2 A;  2IZC B;  3ZQ3 A;  2RQ0 A;  2OL7 A;  5B11 O;  3OD9 A;  4GDA A;  1X8Q A;  4GD9 A;  4YBU A;  3MM0 A;  1OEJ A;  5DG4 A;  4O9S A;  2RCT A;  1GT4 A;  1K3B A;  2AT0 X;  2Q2P A;  1OSP O;  2AF5 A;  4M7M A;  3SZH A;  2LBV A;  1Y55 X;  4MEE A;  3HOE A;  1I05 A;  2XST A;  4O3X B;  1X8U A;  3APV A;  1HBQ A;  2RCQ A;  5F6Z A;  1GKA A;  3SOT A;  5FEN A;  2BS6 A;  3NBX X;  2MF6 A;  2CM4 A;  2RTC B;  5HCC C;  1BSO A;  1U0X A;  2WEW A;  1FTP A;  5LJH A;  3U03 A;  4FQB B;  4GH7 A;  2AT3 X;  1SA8 A;  3WOV A;  2G79 A;  4BX7 B;  1JYJ A;  1TVQ A;  1NP1 A;  2AT6 X;  2MO5 A;  4MVK A;  2MWH A;  4GZV A;  1CBS A;  1LDO A;  3P6F A;  2E4J A;  2IZE B;  1HMT A;  1RXJ A;  1NQN A;  4BQU A;  1EUO A;  2JN3 A;  3LTW A;  2A5C A;  4IB7 A;  2Q9S A;  4ORW A;  4A1Y A;  2XKL A;  2LBA A;  3MG5 A;  1VWM B;  2X32 A;  3U9P C;  2FKG A;  5JR8 A;  1DFV A;  3NQK A;  4I60 A;  4GGZ A;  2OY8 A;  3HTY A;  3P02 A;  4GKC A;  3UEU A;  1T68 X;  4ID2 A;  2YMS A;  4NP1 A;  1E5P A;  1ZNE A;  2KW1 A;  2I5Z O;  2QO5 A;  2QOS C;  3ZI8 A;  4ZGF A;  5B27 A;  1VYO A;  4U8U N;  1HBP A;  1VWF B;  4YKM A;  1OEE A;  5LJB A;  4RUN A;  3F6Z B;  4O3Y A;  3AEH A;  1SY0 A;  2OF8 A;  4GU8 A;  1IIU A;  4ZGU A;  4BOE A;  5HA1 A;  2JU7 A;  1VWJ B;  2LA7 A;  2WSJ A;  3NAD A;  1EI5 A;  4NW4 A;  2JOZ A;  1YP6 A;  5CHK A;  1SWK A;  4Z2P A;  5F7G A;  1SWB A;  1KQX A;  5EDB A;  1N4J A;  1HMR A;  3EW1 A;  4IRW A;  1A57 A;  1SXW A;  1DZP A;  1VYG A;  4Z27 A;  4AZP A;  3WJF A;  1T0V A;  3HWE A;  2RTK A;  5IRW A;  4HPC A;  4JHQ A;  2IZK A;  3N91 A;  1SXU A;  2AT5 X;  4FGI B;  5HA0 A;  2IZA A;  4D6B A;  1EPB A;  1LPJ A;  1SY3 A;  1N7Y A;  1TW4 A;  2OY5 O;  1TOW A;  1B56 A;  1TXL A;  2OVA A;  4IMO A;  4Z28 A;  1KZW A;  3D95 A;  4TKJ A;  1L6M A;  1RBP A;  3WZQ A;  4Z6J A;  1LF7 A;  3DTQ A;  4ZH6 A;  4GJS A;  1Y9L A;  1GX9 A;  5HZ8 A;  1BSQ A;  3IFB A;  1EW3 A;  3BU1 A;  3SLJ A;  1JMX A;  2WPU A;  2FT9 A;  1CBI A;  4HPD A;  4Y0R A;  1VWB B;  1X89 A;  3JS1 A;  2QCB A;  2HZR A;  4R0B A;  3WYQ A;  5B5F A;  1XKI A;  1Y0G A;  2NP1 A;  4AZQ A;  4DCB A;  5K06 A;  1U18 A;  4ZCB A;  4TLJ A;  2A5B A;  4OS0 A;  3KQ0 A;  2RTL A;  2R56 A;  2KT4 B;  5DPQ A;  3WBG A;  2X46 A;  2FRS A;  4WHI A;  4ZR2 A;  3UEX A;  3B2H A;  1I4U A;  1VWH B;  2CAM A;  2HYS A;  2Y3E A;  3P6H A;  4GJV A;  5H9N A;  1VWR B;  4HWM A;  4ZHC A;  2YG2 A;  2WWP A;  1DZK A;  1FDQ A;  4K19 A;  1SY1 A;  5FQ8 E;  4DQ3 A;  4INN A;  4I3C A;  2KTD A;  3D9W A;  1IFB A;  3APW A;  4MIS A;  4NNT A;  3UAQ A;  4I3D A;  4BCS A;  1I06 A;  3P6G A;  1SRE A;  1ZNH A;  1MEP A;  3H3I A;  3HK1 A;  4QAE A;  4QRL A;  4YDB A;  1GKA B;  1BLR A;  1EQD A;  4ORX A;  1IKJ A;  4QGX A;  1LEL A;  1H91 A;  1SY2 A;  2GTF X;  1AVG I;  2DJG A; 
#chains in the Genus database with same CATH homology
 2RTB B;  1HY2 A;  2IZI A;  2UZ2 A;  2IZC B;  3FDC A;  2ZSC A;  4BX7 A;  1VWC B;  2IZH B;  1STS B;  4GDA A;  4GD9 A;  4OKA A;  1SWS A;  1VWA B;  3MM0 A;  3VGW A;  1N9M A;  2FHN X;  3SZH A;  3WYP A;  1Y55 X;  5IRU A;  1SRH A;  1LCV A;  1SWL A;  2MF6 A;  1SWH A;  2RTC B;  5IRA A;  1HQQ A;  1RXH A;  1VWI B;  1DF8 A;  1LCZ A;  2RTF B;  4GGR A;  1RST B;  4CPE A;  2FHL A;  1SLD B;  1SWQ A;  2Y32 A;  3VHM A;  1VWD B;  1IJ8 A;  1LDO A;  1SLG B;  4JNJ A;  2IZE B;  2IZG B;  1KFF A;  2GH7 A;  3RDS A;  3RDO A;  2RTJ A;  3X00 A;  1NBX A;  1AVE A;  1NQN A;  1RXJ A;  1KL3 A;  3PK2 A;  4EKV A;  4Z2V A;  1SWR A;  3RDM A;  1RAV A;  1SWO A;  2A5C A;  4CPH B;  3MG5 A;  4Y5D A;  1VWM B;  2RTI B;  1RSU B;  2JGS A;  1LUQ A;  1STP A;  3T2W A;  4I60 A;  4GGZ A;  2IZD B;  1SWC A;  5F2B A;  2A8G A;  2RTA A;  2IZB A;  1SWU A;  1KL4 A;  1VWE B;  1SWG A;  3RDQ A;  1VYO A;  1SRF A;  3RE6 A;  1VWF B;  3T6F A;  3VHI A;  1RXK A;  1SWE A;  2C1S A;  2OF8 A;  4U46 A;  3RE5 A;  1VWJ B;  3RY1 A;  2Y3F A;  3WZN A;  1SWF A;  3EW2 A;  5CHK A;  4CPH A;  5CSE A;  3SZI A;  1SWK A;  4Z2P A;  2OFA A;  3RDX A;  1SWB A;  4BBO A;  1PTS A;  2RTM A;  1Y53 X;  1N4J A;  1SRI A;  3EW1 A;  4IRW A;  4BX6 B;  2IZL B;  2OF9 A;  1I9H A;  1N9Y A;  1SWT A;  1VWQ B;  4Y59 A;  4Z27 A;  2F01 A;  1NC9 A;  1NQM A;  2RTK A;  5IRW A;  4Z2O A;  2AVI A;  4JHQ A;  2IZK A;  2OFB A;  5JD2 A;  1MM9 A;  1SLE B;  2IZA A;  2RTD B;  2RTE B;  1N7Y A;  2RTR B;  2C1Q A;  1VWP B;  4Z28 A;  2RTP B;  3T6L A;  5K67 A;  3WZQ A;  4Z6J A;  2RTG B;  4BJ8 A;  4GJS A;  4BX6 A;  1SRJ A;  3VHH A;  4BX5 B;  1SWJ A;  1MK5 A;  2WPU A;  1N43 A;  1VWB B;  3RDU A;  2IZJ A;  2QCB A;  1LCW A;  1SWN A;  3WYQ A;  5B5F A;  1SWP A;  2RTH B;  1VWN B;  2BC3 A;  1VWL B;  5K68 A;  2A5B A;  1SLF B;  2RTN B;  2RTL A;  1Y52 X;  5B5G A;  4JO6 A;  3RY2 A;  1LDQ A;  1VWH B;  2CAM A;  4GJV A;  2Y3E A;  4CPF A;  1HXZ A;  1SRG A;  1NDJ A;  1SWA A;  1VWR B;  1VWK B;  2C4I A;  3T2X A;  3SZJ A;  3WZP A;  1KL5 A;  4BX7 B;  5L3Y A;  2UYW A;  4BX5 A;  1AVD A;  2RTQ B;  1SWD A;  1VWG B;  1WBI A;  4YVB A;  1VWO B;  4BCS A;  1SRE A;  4CPI A;  1MEP A;  1STR B;  3WZO A;  2IZF B;  1LEL A;  1MOY A;  4DNE A;  4GGT A;  1HXL A;  2G5L A;  2RTO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...