1SXBA

Crystal structure of reduced bovine erythrocyte superoxide dismutase at 1.9 angstroms resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of reduced bovine erythrocyte superoxide dismutase at 1.9 A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE
total genus 41
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1995-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1sxbA00
1MFMA 1Z9NA 1F1GA 1F1AA 1IBDA 2SODB 4BD4A 4A7GA 1ESOA 1XTLA 1YAZA 4A7VA 2VR6A 3GTTA 1TO5A 1SXNA 1SDAB 2GBVA 3CE1A 2GBTA 1EQWA 1OEZW 4BCZA 1E9OB 2LU5A 2C9VA 1AZVA 1IBFA 1SDYA 3GZPA 1BZOA 1Z9PA 2AQTA 3QQDB 2APSA 1E9QB 2WKOA 2AQPA 3K91A 5KBLA 3L9YA 2Z7YA 1OALA 1UXMA 1XTMA 1SXAA 1IBHA 1RK7A 3ECWA 2WZ5A 1CB4A 1HL5A 2NNXA 3CQPA 3F7LA 4U4IA 2R27A 2AF2A 3KH3A 3GZQA 2WWOA 3HFFA 3KH4A 2WZ0A 3S0PA 3H2QA 4A7QA 2VR7A 1B4TA 4FF9A 1SXZA 1IBBA 2AEOA 2WWNA 1JCVA 4A7GF 1JK9A 1HL4A 1TO4A 1F1DA 3PU7A 2AQNA 2AQQA 4OJAA 1XSOA 3KBEA 1SXBA 2GBUA 1SXCA 3ECUA 4L05A 1FUNA 2Z7UA 2VR8A 1E9OA 4BCYA 1L3NA 1DSWA 2XJKA 1EJ8A 2WYZA 4MCMA 1COBA 1IB5A 1QUPA 1U3NA 1BA9A 1E9PB 2ZKYA 1PU0A 2ZKWA 3KBFA 2AQSA 1OZTG 1F18A 1PTZA 1SPDA 3KM1A 2V0AA 2WZ6A 3HOGA 4OH2A 2C9UA 3H2PA 1JK9B 4N3UA 2E46A 3GTVA 2JCWA 2WKOF 3GQFA 1SRDA 1YAIA 3MKGA 1KMGA 2JLPA 1OZUA 2C9SA 3CQQA 1S4IA 2WYTA 2Q2LA 1N18A 5CU9A 1P1VA 3MNDA 2Z7WA 4N3TA 3HW7A 3SODB 3RE0A 1PZSA 3KM2A 3QQDA 4A7UA 4MCNA 1B4LA 1SXSA 1OAJA 1SOSA 2AQRA 3GZOA 1N19A 5KBMA 4A7SA 5KBKA 2Z7ZA 4A7TA 1CBJA 3ECVA 4B3EA 3F7KA 1DO5A 2ZOWA 3LTVA 1YSOA 2K4WA 2ZKXA 1Q0EA 1UXLA 2E47A 3T5WA 1E9PA 1E9QA 2XJLA 3L9EA
chains in the Genus database with same CATH superfamily
2Q5BA 1I7UB 4N8VG 4DKFH 3JUZA 1YEEH 2OL3L 4PJGB 8FABB 5HYIA 4FNRA 4PJ9A 4X5QA 3RDTD 4KHTL 4HPHA 2Y5QA 1KBGH 3N43F 3O6KL 4U6VL 2ADGB 3O4LE 3HRZA 4G83A 1TZGH 1MIML 1HWWA 3WKNA 1NCTA 4L5FE 4UQ3A 4RZCA 4K7PX 3MLTB 4Q0XH 2V5TA 2EE3A 2FBJH 3VXNB 2DN7A 3MV01 2G5RA 5GS1C 2NZ9D 1A8ZA 4X80H 3CV5A 4NKOA 2QZQA 3PWJA 3CFJA 3BZFA 1UG9A 3H42H 3MGOB 1NKGA 2XG4A 4GEIA 3HS0C 1M2VA 4PS3A 2CMRL 4OJCA 3BE1L 5FYLE 4GQ9L 4M9OA 2YMXH 4XP5H 3COOA 3VO0A 1JPEA 2QHRH 2A5UA 4PV9A 4DIXA 3RFZC 3I9PA 1A0QL 1ETZA 4MQXD 4DGWC 4U6HB 2CDGB 1S9KC 3EGSB 4QRQB 2YKLL 2XVGA 1U8PA 1JTPA 5AOMA 2X6CA 3T1FB 4PAZA 1T83C 1IFHL 2BO0A 2HT2D 4KBPA 4XVUD 3HEIB 3I6GA 4DN3H 2VABB 5DD3L 3BUIA 5C2BL 3LJ3A 4RGNB 3UO1H 4HT1L 2Z93A 1CQKA 1SXCA 3CK0L 1U8LA 1CO1A 1FAIL 1HHGA 4JR9H 1HWGB 4M5YH 2RTTA 3DRTB 1EAPA 4M6OL 2CKBL 1REIA 3GHBH 1TQSA 3MRQA 5L88L 2QSTA 3GMQB 4FP8H 4JLRB 3UZEC 4RMSA 3WNKA 4DESA 1DFXA 4YLBA 5KS9A 1YQVH 4CVWA 1OANA 2WLYA 3H9SE 2BSEA 2WVSA 3D6GA 1CWVA 2X40A 2WUCL 5A2CA 2X1PA 3V8OA 3FQ2A 2NR6D 1J0ZA 5JIIA 3LNFA 3H85A 5D1XA 5DRZA 2YQBA 3O45A 3D3VE 5F7EH 1S7QA 4PTUB 4G80A 4UDTA 3HZ3A 5KYXA 4ZT1A 4AQAA 1PY9A 1RY7B 2FNBA 3KXFE 4JHBA 5DZOA 1DFBL 1MAJA 1Q1PA 3GS4A 4XXWC 1RZJH 1PZ5B 5FO8A 4IDLA 3ME0A 3KXFA 3SSGA 1E3XA 3MRDB 2IH9A 3QAZC 4Y88A 2Q0ZX 3JWOL 4G1EB 4JBSA 2X1XR 2BY1A 1S9XB 2W0KA 3IBOA 4G8IB 5JPMC 4CUCA 3UBGA 3EF7A 4LNRB 1KGYE 4XBPA 2LU4A 1EAOA 3L8QA 1BAFL 2DMGA 3WELA 4U1LA 2EXYC 4HA1A 3VD2A 5CAYB 1AACA 1U8CB 1ZAGA 5EC2A 3O6FD 4U1GB 4ZAKC 2R9HD 3BQUD 5DYFA 4G7RB 5FM4A 1SDAB 2Y07H 3OAWA 2OXHA 1RU9L 3FSAA 2LU5A 2V3FA 3MFFA 2BC4A 4Q0XL 1J8HA 3G5YA 3JWNE 1MREL 4EN2A 2H6UA 3QHZL 1BF8A 2QR0B 1DJYA 2PPAA 2PN5A 3RA7H 2P1YA 2WQ8A 2F7IA 3GIVB 4G5ZH 5IVZA 2BSTB 3IFOA 4JKKA 3BEWA 3BZ5A 3BQVA 3D07A 2D2OA 4QRFA 4M62L 1FVDB 3JV5A 2JXMB 3C2AH 4B3VA 4KH2A 4JRYA 1U8QA 4AJWA 1S7TB 2AGJL 2ZXEB 1PZAA 1OTSD 2HJLB 5EUKA 4MNQA 4ANKA 4X8JB 2ADJB 4PJ9D 3TFKC 1UM5H 1JZFA 3BP5A 5EDSA 5ACMA 1KN2L 2H32H 3U4EA 4B6ZA 4A7QA 1WBZB 3HZVA 4MWFA 3X14A 3LN4A 2K8MA 4J8RA 4U1HB 1UZGA 2P48B 1CDJA 1UM6H 3ZZLA 3UOAB 4DN3L 2VDMB 1I8MA 1YEEL 2OL3H 4MCZA 4P5KA 4BFOA 1JHLH 1WPCA 3Q2WA 2D3LA 3CK0H 5ID1A 4LLQA 4CVXA 5LJYH 4NIYE 1MCQA 1OW0A 4LCWE 5KEZA 3HR5B 2EC9U 1AR2A 2X7LA 3V6OC 5JW4Q 3RVUC 1B2WL 2NY6B 1UTDA 3NP4A 5I19H 1FL5A 2HP4A 3MRMB 4JG9A 4ZMLA 3IEAA 4JPWL 1V3LA 4QRTA 4M3HA 4R96B 5IW1A 2BHYA 1BWMA 3LNDA 4H8PA 5D2NA 4L9DA 4N0CD 5L4IA 4N28A 4NHUA 4RETB 2ESVD 5MEQB 1G0DA 3LKPB 4JB9L 3IKKA 2VM9A 1MCOH 3I3EA 3SJVA 4RGND 3EGXB 2BP3A 2C1PA 4MDJB 3L5HA 1JWUB 1OTUD 3TBVA 1A0QH 2I9TB 1QTSA 4NQVB 5F93C 2DQHL 3NSYA 5AD0A 3RNQB 2V5RA 2QGCA 3ZZSA 1T0MB 4V1DB 3SYPA 1V05A 4AGLA 4MAUL 3RYMA 1C7SA 5IJKC 1HXMB 1BDYA 3L2LA 1QHPA 1NC2B 2BK8A 2RFXA 3KG5A 1NBZB 4KXBA 4KV5E 1U8KB 4LCCB 2PKDA 4NGHH 2JNZA 2P5WE 4ABQA 3NZHL 2OJEB 5CINL 1J11A 2WXNA 1CICA 3DXAB 3JV4A 4KJQD 4E42A 4JRLA 2VDMH 3MA9L 3WENA 4L0PB 1U42A 1MSPA 3ZSSA 1U36A 4PJGF 3LXBA 3UC0H 5EF2A 1TLMA 3LZFL 2H8PB 3OKDB 3PJNA 5C0DA 3OXSA 1E27B 5AKTA 3FAWA 4XMPL 4KTEH 1JF1B 3CZEA 5DRWB 2F53B 4OCMC 1NL0H 3M86A 2OX5A 3GLEA 5HDBE 2CDFB 3QXVA 3DTDA 1WO2A 1FZOA 3BAYA 2YC1B 2XIBA 4IKIA 4WV1A 4X9FA 2O6EA 3C2AL 4J3UA 1GCFA 1BQ5A 4Z7UE 4DF9A 1R9FA 2JJVA 4LLVA 5HGHA 1KDJA 2C3HA 2B4CC 3HFFA 3V8CA 3I75A 2I60L 1UKTA 2F74B 3WIFB 3BHBB 4NC1E 2XQYK 3WEXA 2PYFB 3ISWA 4JDTL 3G6JB 5MEOA 4WW1A 5DK0A 1TSRA 3WKPA 4P9HL 3VFTB 2E7BA 5BV7C 2DEWX 1DJGA 3X1BA 4ZMQA 3VXRA 5KJ7E 5CU5A 4RX4D 4ZDHA 1OTUC 5FO7A 1DL7L 2ARJB 2JIXB 5KVFL 1A65A 4UQDA 2MOVA 3DBSA 1KZQA 4PRHA 4WSJA 3VJ6B 3RA7L 1TTAA 1ZANL 1PIGA 2WUBL 4JFQA 3DX8B 1DSFL 4JFSA 4LHUA 5IG7A 3JV6B 4ZTOH 4PV8B 3OD3A 1UA6L 4QGYA 4GKSA 1AZNA 5ITFA 3SQBA 3DJRA 3RKDC 3O11B 4HUCA 4ONHB 5DZVA 4P4KC 2Z0BA 5I16A 2LLNA 3QUYD 1RSFA 3SE9H 4NZTL 1CD8A 3QUGA 4PS8A 1MNNA 4OUUB 1I7RB 3BIBX 1AI1L 1XCQB 3F5WA 2DQHH 4KRPB 4MA7L 3V9CA 4OGAD 4FD0A 3ZKSD 1DZBA 2KYIA 3K5RA 3LKNB 4H2CA 5E2TH 1XGRB 2LGNA 4BZ1L 4UT6L 3DX6B 3C5XA 3CFEB 1S5HA 4AUUA 3OKKB 1HJCA 4KTGA 2FK9A 1NQBA 4NXSA 3CSPA 5AUMA 5AW6B 1XF5B 3RI5K 3H9SD 4EDXB 2AJSL 4MYPA 3Q8CA 5BZWB 1PNDA 3FUHA 4OCXH 5C3TA 3LX9A 1CXIA 2VDML 3MA9H 1G6RL 3HC4L 4MJ5B 4TMPA 1NEUA 1U30A 3ZTJH 3RVXC 1PZUB 3QZOA 1IGTA 4YHNA 3EW3B 3Q3GA 4HUXB 2EAEA 5DTFA 4JHAL 3VTMA 4FLOA 2EVJA 5I76B 1ERNA 1WC7B 2NOYA 3QH3B 3DURB 3IMTA 4KRNA 5BS0B 4X0KB 2Y5TA 4LDEB 3B34A 4P23B 1G6RA 3CZFA 3KVQA 3KL3A 3WXWH 5FO9B 3KW7A 4PJCA 3WV0A 2F58L 3ABZA 2AJXH 2GG1A 3PNWB 1YEGH 3A6CL 5BUAA 1JV5B 3OC8A 2C1OA 4O51B 4ODHL 4P46B 3BPNB 1BVZA 5E8PA 4HG4J 12E8H 4OF6A 2Z9TA 3RZCC 2LABA 4KY2A 4QCIA 5LGJB 3H2QA 4PJIE 5JUEH 4F7TB 4LPYA 2XG5B 2RA1A 2WXOA 4PJ8B 1NBVH 5DGRA 3GSWB 1CLVA 3IN0A 4PCKA 1G87A 2DV6A 3OAUH 5FA4B 4WUUB 5HHME 2BVQB 1MRCL 2V2XB 4XNUL 1FZMB 4RRPG 4UT6A 3ENEA 5CJOH 3ARDC 3KS0J 2VXSL 2HFEB 2AK4D 3QBTB 4XI5D 1H6TA 5H37G 3RWEA 3U25A 5L4FA 4KO5A 5DI8B 1U58A 4O2FB 3IK2A 5GGVL 5T1DH 5F7UA 3WG7B 3RVWC 4NKMB 5HJGA 2XWEA 3JWOC 4PS4H 2Y25A 1AY1L 2F8OA 4MA8L 3WJMB 1YY9C 3HG1D 3P4MA 3NAAH 4NP4H 1D5ZA 3RVVD 3FQ4A 1HYSC 4MMYB 1T3FB 4K15A 1FNHA 3L3IB 2ESVE 1Q90A 4ICWA 4NQEE 3QPQD 4N2IA 2JI1A 1P4BH 5C09B 3QVAA 5AOKA 5IB1B 4I18A 3TO4C 1GZHA 1UH2A 4LLUA 3UBFA 1KGCD 2FD6H 2PP8A 2EUVA 1BAWA 3V6FB 2Y24A 2GUYA 1RZ7H 2BIQA 2XY1A 4PJ8C 4AENA 1IBGH 2XZAL 2ZF8A 1XZ0A 5EEYA 1EEZB 2VW7A 2E27H 1MCIA 2WOYA 2WPGA 4Y4FD 4EIUA 5TH2A 5E2TL 4LCWD 2OMUB 3WEOA 1I3RB 5C70A 4X7CC 3TU6A 3OSVA 3QUYB 3GJFH 4KNSA 1YC8A 4DFIA 1BOGA 1KCVL 4F7EA 2OS7A 3U36B 5EBLA 4NO0A 4W70A 1TPXB 1E9PA 1M7UA 2VLKB 3BEVB 4HVBA 2QELA 4O9HL 1NDMB 1MWAH 2JQAA 2ZUUA 1Y07A 2WNXA 4ABWA 3FOLA 4EN3C 3ZKNC 4D3CL 1HINH 2VERA 3AABA 1B0WA 3IU3A 3TBWA 4DAGL 2ICWA 4QRUB 3AREC 3CPUA 5ESVA 3GJEA 4A2DA 3PLYA 4KRPD 1XHHA 1OGAD 3OAYK 4RQQA 4HPYH 4MD5A 7FABL 4J3WA 1WEJH 4RIRB 3TEYA 5T33L 3GMMA 3TVMA 4GLRH 1KIQA 2VH5L 4G8GD 4IU3B 3ZMNA 4LRNH 4NCDA 2HWZL 4HUUB 2L7QA 2ZUTA 1OAYL 5BVPH 5GZNC 2IWEA 5FYKU 4PJHA 4KX7A 1LM8V 5K9KA 1YPZE 1O7DE 1HK6A 2A9ML 5BV7H 3DX9B 4E9YA 3K6FA 1R0AH 3GSVB 2OKMA 3MXWH 3NN8B 3BAXA 1MJJB 3TNNB 3FQXA 5B21A 3WMQA 1S78D 1NTDA 3ZTCC 3KLHC 2PTUA 4BZ1H 2ZNXA 3RWFB 3DOSA 3HI5L 1YECH 3NSDA 3AS1A 2CIKA 4U3SA 3SKJH 1DVFA 3UDWA 4Y2DB 4Z7OF 4MVBC 2YD6A 3KZ8A 3TCTA 3UJTH 4OFIA 1LD9B 2AJSH 3EYQC 3L5WA 5C0AE 5JXAH 4Q2ZB 3Q6FA 3ARVA 3B2VL 4XNUH 3LKRB 4FG6D 1BEYL 2YIHA 3BMWA 2PO6A 4PJFF 5EPMB 3AWGA 4F1SA 1DQVA 5DYOB 1ETA1 2J4WL 5MHSD 2FX8H 4H2AA 4IBSA 1KY6A 3B6SB 4JZOA 5I66A 2NW2A 3QDGB 4R5VA 3ULVD 3RWIA 5JHDE 1A6ZB 3G6AB 5IZ7A 4ZODA 1SRDA 1V3JA 1YYCA 1NKRA 2JH2A 3DIDA 4LL9A 1HYRC 3VFMB 2CO2A 3EYOB 4KI5C 3NG5A 3AQXA 4G6FD 3M88A 4Z3EA 2Z92A 5E1GA 1UYWL 2EKSB 2HN7A 4KK5C 1MFBL 4DP4X 3GSNL 3D05A 5CZVL 3G08A 1FZJA 2XKUA 3MO1B 5DUMH 2V9QA 3KLQA 3BI9X 3UCRA 2JCCA 3CUPB 2VDQH 3D0LA 4UOQA 3M45A 3MA7A 3NCEB 4YHOH 2NXZC 5I6PA 2EUWA 1ODAA 2H41A 5CLZA 2KKQA 2X4NB 3G5VB 3HC2A 3HG0A 4MCYB 1W91A 3UP1A 3T6VA 1M1XB 1KBVA 1MZZA 2DJ4A 1FQ9C 3NFNA 4B53A 2XKSA 4C4KT 1JGLL 1EXUA 1L0XA 1RZFH 2HFGL 1F1GA 2DLHA 5FYJU 2CUHA 3AMKA 3M1CA 1NLDL 2KH2B 3U0PB 5E24E 2B4CL 2GCYA 3Q9PA 1IT9H 4BUGA 1MEXL 2Z34A 5SV3A 5I75B 3SDYH 2CRMA 1UZ8B 1RVFL 4PJ7F 2HX7A 3JXAA 3TVMC 4YSPA 4JM4H 1FL6A 5C8JA 5AG8A 2PWEA 3V0FA 1OAYH 3FMGH 3MODH 4HJUA 4LEBA 4HJEA 1FNEA 1NIBA 5E8DH 4XNZB 3L08A 2R1WA 2VLKD 4DTGH 2H0JA 4U7KA 3N42B 2AITA 4KKLD 1EO5A 3GJFA 2NX5A 3ZSTA 2Z4QA 4JL1A 2P5EB 4LEEA 1PVHA 2CUMA 1S3KL 2WLLA 1FN4B 1FGVH 3VVVA 3U9WA 3GI8H 4X4ME 4DOHE 5GJSL 3B2VH 3NPSB 4K9EH 1AAJA 4L8SC 4PMFA 3PGCB 4ZS7L 3Q8EA 1D5XB 2MNWA 1NA8A 4YDJB 2KL6A 4Q9RH 5JYLA 1GRWA 7TAAA 2L4OA 3QIUC 1R5VB 1U6AH 5KSAA 1CFSA 1WEJL 2AQSA 4OGYL 4W6YB 5JHLH 3P3TA 5D2LB 1G9EA 1TU2A 5BS0D 5C08B 5E08H 5M95B 4S2SB 1DBAH 5D72L 1FC2D 2CO1A 2XZCL 3ARQA 3SYAA 4FKHA 4OLYH 1WZAA 2E3VA 1CIDA 4PWIA 4EIGB 2YBRA 3OVUB 3RJOA 4XMKH 2QQKH 1W2KT 3LEXB 3WGVB 5J7CC 4GG6B 3VXPA 5HYQB 3EJCA 1V27A 2O5NA 4NO5A 3TONA 1XAKA 3SDXA 3FQNA 3HRPA 2O6FA 1U8HA 5KYUA 3L1OH 5C0GB 2GYSA 4UWQB 4NT6A 4OKDA 1XX9C 5EC1A 3CH8A 4HS3B 3OKLB 5I8CA 4XNZC 5DLLA 5DLML 4S1SH 3OWEA 1XL4A 4AQ8A 3B43A 4EI5D 1IQDA 2MCG1 3EH4B 2GFBB 1G9NH 4OKVA 3CFKB 3QIBC 2BVUA 1KN4H 4FYQA 3AAZA 3SPHA 4HWBH 4QKXB 4N2GA 2O61B 1NFDB 2I9LB 3QDGE 4PMEA 4RAUB 5E51A 4IBZA 3A23A 5FR3A 1MY7A 1KXTB 2X4PA 3TYGH 2R0WL 4MZIA 3M8OH 5HY9A 5LN8A 2FX8L 4Y1AB 4ZD3H 4GT0A 2WIMA 1ACCA 4ILDA 5F0JB 5IOPB 2PXYD 4O2CB 4PRDB 4IJ3C 5E9DE 4M8QA 1ZA6A 2V9RA 3BLPX 2AW2A 2ZX9A 3DUUB 3H6JA 3QWOA 5IT2L 2EVFA 5MENE 2MKWA 3DUSB 1NWPA 3F62A 3QSKB 5LO7A 3GXPA 4DZBA 5JLZB 4NZJA 3CVHL 1DEEA 1DBKH 4ATWA 3NRPA 2A74B 3L81A 1A9BA 1QA9B 3E6FA 1BFTA 4Z5RB 4POUB 4KRMB 3X3FL 5F9OH 5IB4A 5ITBL 4GIOA 4MJ6B 5DZJA 3TA3B 1ZGLM 5B7FA 3EZJB 1F90H 4B9FA 3S0PA 1JGVH 2B0SH 3FRPG 3BJ91 2GJZA 3QZMA 3CX5J 1KIRA 2WLNA 3BGFC 5JHAA 1GYUA 4K8RL 2J5LB 4A7GF 3LS4L 1RJZA 2DIAA 2GC4C 2Y1AA 4IRJB 3NIFE 4LVOC 2EDTA 4WO0A 5DEFB 1U21A 4D9RE 3NVQA 4ZXBA 5DQ9B 5HI3C 3T0EE 2V6HA 4I4WA 3S35L 2AABH 3P9LA 4LQFH 2HFFB 4JL2A 5KSVB 4M6NH 2WQXA 2QADD 5AVZB 3V7AE 1YEDA 2AEPL 3MRRA 1KF9B 2EDOA 4JFFE 1WV7T 4XNAA 1ACZA 2W0LA 5J1TC 4H7VA 4ZX5A 4Z0BH 3T2QA 4QR7A 4UYQA 1ZLVK 3A4AA 2K45A 2PR9A 4S0HA 1QFWL 4P05A 4PRBB 2C9SA 3IGFA 4NS0A 4PRPA 5D1ZB 2R1XB 1NCAH 5E5MB 3W39A 2X38A 1L9NA 1N70A 3FKUS 3IFLH 3MRHB 3OR6B 1N68A 2G9HB 2NUPA 4EF3A 1QBML 3WAJA 4FZEH 2A73A 2NSXA 4KXCA 1D6VL 5E23A 3ZTDC 3VGHA 2MQGA 1VSCA 1UENA 3H3KA 3NSFA 3D0AA 5HYSB 1R3IH 3KYMB 4K4KA 2ZOLB 3GS0A 2A6JB 1DJWA 4S1SL 4GQZA 3RGVC 1UD3A 2ED9A 1MW1A 3S5ZA 3D06A 5DVMA 3TWCH 1UXLA 4ZS7H 1AD0A 2C9AA 1V8HA 1UEMA 1XCTA 2JB5H 1N5YH 1E6OH 3UTPD 4N0UA 4GKNA 3QUMH 4G9DB 3OWRA 2CGRL 2E6PA 4UM8A 1S9WA 1FVCA 4XC1H 1RIVH 3AACA 3KNBB 2Z6FA 4H25A 1N6UA 4UZGA 5A43C 4IDJL 3ZTNH 1N59B 4Z7VA 2IBZY 3NCYP 1HZLA 1MJUL 2YUVA 4Y7OC 5I30L 1H9VA 4ZPTB 5AAMC 4DKAA 3FYIB 3KJ4C 3BAKA 3HTLX 2O1AA 4N1CA 5ILTL 1MCSA 2A7BA 1TZHB 1KG0A 4HIEB 5CP7A 2UZXB 2IH1A 3U9UB 2H3NA 2J1XA 2VDRL 5TQ2L 1TJHH 4DUVA 1XF1A 1ZTXE 4WI0B 3P9MA 3T65A 4YXKH 5KYNA 1CVRA 4JO4H 4L9LB 5EN2A 1CU4L 4NDMA 1B0GA 4NZFA 4H8QA 4Z7VF 3K1KC 2FATL 5I8EA 4Y5VB 3CG8A 3II3A 4ZUSA 4POZC 3RFRA 5I23A 1RJLA 3E2HB 4H8WH 1NGPL 4WK0B 3U1SH 1J88A 3R06A 1URLA 3LS4H 4JQIL 4ZZFA 2M26A 5DQDL 5IFJA 5ENWA 2WXLA 3C60D 5DK2B 3TYGL 4JG1H 1NIAA 4YGVB 2VQ1A 2GSIB 1R24A 1XEUA 4HWNA 4L8DB 1EZLA 3CLFH 1RZ8A 1FPTH 3GNMH 3Q2VA 3DMMC 4PLJD 1LQBC 4P2YA 2IAMD 1G7LB 1IARB 1V3KA 1E43A 5F6IC 3TJEL 1JF5A 2W95A 2ZOKA 3KBFA 4JPIA 2VXUH 1O5PA 5GS0C 1V55B 2X2IA 1S9VA 1U8OB 4NO3A 5E2WH 5D5MB 3NRQA 3F7PC 3QZWA 1OT4A 2VC2H 1S7XB 3FT9A 1TYRA 4ZW5A 1CF8H 1P1VA 3MROA 3FU9A 4IRJD 2WANA 4JUTA 1C5DB 3MUY1 4ODXB 1EXGA 3QJHA 4PJGA 4PVMA 3U2SB 3QNYA 2BP8A 4LOUC 1QKZL 2GB2A 3BD3A 3H4FA 4NQED 1PZDA 1RHHA 2HVJB 3F7YB 4X0NA 2ENPA 3IGKA 1XEDA 4HDIA 5IMLB 3GXNA 3PFUA 4IGBD 5J9PB 1MCPH 2ICWJ 2ZAGA 4NKDA 4OF3A 2WGNB 2OMVB 1Y7VA 4HW6A 3AG2B 1A1NB 1SJHA 3ATEA 4JFFB 4YQXH 2L7UA 3NABL 2R69H 1TOXA 3AT0A 2BY2A 5ALBL 3VWKB 3CC1A 1QNIA 3JWDL 1SEBB 2Z0UA 3I6KA 4NO0D 4E9LA 1JZ6A 2QQLH 3HMXH 2P45B 4E41E 4DP1X 4X5XA 1OEZW 1PCXA 4KMTL 2APBA 3FH8A 4HKZA 4BH8A 1A1MB 3O9WC 1IFHH 2XN1A 2IOMA 2VR5A 2YS4A 3CVIL 2X4UA 1OSEA 4UYPA 1V7NL 4M61A 5A2JH 4ZMXA 3ZKQD 2YQ2A 2QL1A 4M56A 5GSRA 4N0FB 5HGDB 2XNAA 4LPCA 2O30A 3LEYH 35C8L 4Y4HA 2VR4A 4F7CB 1FNAA 4OZGA 3VXMA 1Z3RA 1TZIB 3B9KB 2QLYA 3DLQR 3APMA 1O6SB 2CGYA 4R7DA 4V11A 4Y2OA 3ULUL 1WRFA 1JXFA 2ZAIA 4JANB 3CZJA 3V7MA 2B9BA 2VUOA 4XCYB 4WU7B 4D0DB 5E8OB 5DVLA 2QVTA 1BCIA 4BH7A 1JXDA 3DPBA 4G6MH 4QEGA 5I1HH 2YEQA 3MCG1 1ZSDA 4UMSA 3RGVA 3TN0A 2ZX8A 5GHWH 4N25A 3SHSA 5E8EB 3DVFA 3BP4A 4A6YH 2YAPA 3GBLA 1BZQK 1NAMH 1GGTA 3QT2A 5IHUL 5T3XD 5I1IH 1BZ9B 3CXFA 3MREA 4RFOH 2P26A 3HVNA 3OJMB 4KGJA 3KPSE 4OLUL 2FIKA 4WNQA 2NYZA 2W07A 5E1QA 1Q9WA 2VT0A 2ICES 5DUPL 4HLZH 2OMTA 3EFFA 1S7UA 3REWA 3MGTB 8PAZA 4QRPB 1NMBL 3TIDA 2R83A 5AKRA 3O3DA 4FQCL 3SDCD 4QRRA 1ZT1B 3WFCH 1TITA 3C60B 4J28A 3WJLA 5HYJA 3EFDL 4E9WA 3IJ9A 1FYTE 1GKOA 2QFPA 2JMRA 3BUTA 4E2OA 4QF1A 4L8SA 4TQEL 4P2CG 4CVUA 2BERA 2ODHA 3RL2A 2M83A 1UJTA 2W60A 1AQDA 2Y72A 1VFAB 5KN5A 1I1YB 2NW3A 5IHLB 2O6DA 1ADWA 2PCXA 3RUGA 2GW5A 3LZNA 4YHKH 3O6FB 1T6VN 5ANHA 5ALBH 1AS6A 4KO7A 4JM2C 4FQXC 4EQ3A 4RMRA 4GUQA 2Z65C 3FQUA 3VXTB 4R5XA 4F37F 1IQWH 5EUKB 3CFDB 4D0CA 1QSFA 3KGUA 2NQDA 5F3HA 2B59A 5JXEC 4HPOL 2WNKA 5CCGE 4IOIA 1UACL 2CRYA 4F5CA 3VDCA 3HS8A 1PF3A 3Q2LA 4NUGH 4UQAA 4WKZB 5IROC 1NDGB 5BRZA 4WAFA 2DQGL 3Q5YA 3S6CA 1YN7B 3QORB 2WXKA 3LKSA 5E8NB 4K9JA 4GP5B 4PJEA 4Y4HC 3TCXA 1FRGH 4AUYA 3HE7D 5T5NG 3RZCA 3A4EA 4JHWH 2W9DH 3DDGA 3MRBA 3N1PC 4JFPA 4PG9B 1D9KC 3VWKD 2GQHA 4MASA 4PCTA 4OAWA 4XPBL 3QJXA 4PJ7A 1I9IL 5ABAA 3AZUA 3U0WH 5JIQA 1IGIH 1BVOA 2ATAA 4FA6A 5BVJB 1FZKA 1WBYB 2K6YA 1I31A 3VACA 2CHXA 4I2XB 1WFIA 3DX3A 4YWGH 4LSQH 4N2KA 4QJ5B 4MB3A 1YYML 3CFTA 4WVRA 4G6ML 1HIMH 3NIGB 4QD2E 3VQMA 43CAA 2AV1A 4IHBA 2JQMA 3DTUB 3IS0X 3VRLE 2ODIA 3EUUA 4W6WB 3CNKA 4JO1L 4N90E 3HN8A 4MHHG 3RILA 1KEGH 4K7PH 1IM3D 1MI5B 3PIQA 4KI1A 3IRCA 3GXTA 5H94B 3MRGB 4PGEB 3L4XA 4NB7A 4D7BA 3BO8B 2WYHA 1H15B 3CHXA 4BHUI 4TYUA 4FE9A 2UX6A 5DUJA 4Y4FA 5D4HA 1Z5YD 3F12B 4P9HH 2PWDA 3D2UA 2YAEA 3FHQA 1OWWA 2VLJD 5DGQA 4MJIA 5DJ2A 1IM9A 4K8RC 4P07A 1QRKA 2H6OA 4K3EL 4D0BA 4NN5C 5FGSA 5MERB 1CT8A 4FQCH 5CINH 5IVXB 4Z7WF 4NQCE 4NM4L 1BXXA 2NDFA 2MQCA 3V0AC 5C71A 1E28A 1TQCB 1WWAX 2NDGA 1ZA3A 4ANVA 4YHLL 3IFNL 4TV3A 5HVWA 4AL8C 1P69B 1A4JB 5L8LB 1B3JA 1B88A 4L4TD 4M48L 1JVLA 5C0EB 4L3CA 3U7WL 3Q5TA 2Y22A 3FRUA 1D5BA 1PMYA 1NL0L 5DHMC 2VMCA 2YD9A 2F1EA 2EVHA 1NPUA 3DSNA 3UTTB 5IR1A 5K5YA 2EH8L 1A4KA 3P30L 4QTIL 4XPAH 3H1ZA 4HCRA 2YUWA 3QCVH 2EH7H 2ZF9A 3DYOA 1VPOL 4FNSA 2WBJD 1IGJA 1QNZH 1DQLH 1IFGA 2Y4SA 1V7MH 3WN5C 3U4AA 5IHWA 4G6AC 1L5GA 1RZGB 1OIOA 3SO3B 1TG8A 5HHOA 1QPXA 3D3VB 4AXWA 4AYBA 1A6AB 1NLBL 5DDHB 1BOYA 1FYTD 2CLRA 2AHIA 2FJHA 3H0TB 4JGMA 4Z77A 1T20A 1LVEA 2HT2C 3MV8D 1Z9PA 4TULH 4P49A 1KC5H 4H0IA 3Q1SL 1A7QL 2FWUA 4IRSA 4PJHF 2CLVB 2F53D 2QKIA 3FQWA 2W92A 3U0TA 1FRGL 2W5PA 3QPXH 1UB5A 1ZJBA 2JF1A 3VSQA 2FEDC 3PHOB 2HTLC 4WUKH 3QO1A 3VFWB 5AZUA 3IGLA 2VWEE 2YEZA 1X4ZA 2EEAA 1CGVA 2WTRB 2VE6B 2VLKE 3KH4A 3IJ7A 4L1HA 3LV3B 3TA3C 1NBYA 1RK1B 1VKXB 3E8VA 2FBOJ 3PJSA 3KVPA 2WQAA 4JFFD 3EHBD 1PYWB 3O41A 2K0RA 3FN9A 4ES8A 4UF7C 4IKNA 4K23L 5AW5B 1SXBA 4KMLB 1DANT 4RA3A 1S7SA 2WKLA 1SMAA 4QTHB 1EGJH 1IQWL 3F7VA 1NGXB 3NACH 4FNTA 2YSSA 2J12B 2BMKB 5IB2A 1KULA 1WT5C 1YO4A 2O5YH 5I15H 2Z1PA 3CN1A 1HNGA 3ZHLA 3FQ1A 2EDNA 2E9BA 2E7CA 4JM2A 3MJGX 4O02A 4HXAH 4JFEB 5K9JH 4I1NB 3FNKA 4Y4FC 1KLFB 2DWTA 3F05A 1GPOH 1U4FA 3AT9A 4YIQA 3S4SA 3WL9B 4FGMA 4OCSH 4Z7OB 4ZUWA 4KAQL 4UT9H 4N6QA 5CZRA 5IMOB 4CMMB 1KMGA 3CZSA 4S1QH 3C2SA 1MI5D 3H7BA 5ETUB 1BQLL 1G7IA 4G43B 4XTRC 3MMEB 5D1ZC 3BKMH 4EBQL 1T21A 5CBEB 1LO4H 1AHWB 2NTFA 3EG9B 3ARXA 1PBYA 3QWRA 2HRHA 3LNEA 3WTSA 3L3DA 3TO4A 4J3XA 4OJEH 2D2CC 1ZE3H 3HI6L 4GP4B 2VN3A 2PTTA 4C4UA 4K55A 4C55A 4DUWA 2R7EB 4CC4C 1IKFL 3BUPA 3NSXA 4UV4H 2FIRT 2EIZB 2R15A 1BD2A 5B3JE 1VFOA 4JKNA 2G60L 5BS0A 4GI6A 4OFVA 3LRGA 2VLJB 1U95A 2XV0A 3QCVL 3EAKA 1IUZA 2CNZA 3G5ZA 3VXRD 1F2XK 1QZ1A 1BYOA 4M8RA 2SODB 2NQ3A 3R1GH 4J6RH 3BGMA 2EDQA 1MLCB 3P2TA 3ML9A 3NIGE 2E9IA 2ZXBA 4DP9X 1I9RL 3D39A 3EGDB 4LBEA 4AJYV 5LAPA 3PXLA 5HHXL 3BKCH 3IDGB 2YN5A 4UQIM 1E50A 3RFZA 3ARWA 2XG5A 1KPRA 2X3CA 4C56A 4C57C 1G1YA 2R4RL 3DARA 3W0WB 5L2KD 4DO6A 4JQVC 4MQ7B 3BFQG 4ALAC 1F11A 4MX7A 4XN5A 4PJCF 3FRPB 4JPVL 4Z3TA 3WCYA 3V4VA 4OZ4A 4WTZG 2FX7H 2Q1EA 2BSRB 2E6QA 4K0OA 4A2GA 5KTEH 3WY1A 3DV4B 1QVOA 2R23B 1YCSA 5F0PB 5I1LA 1HHIA 2V8LA 2FUQA 3FN0L 4IS6A 4OCRH 3OZ9H 3QZWG 3MX0A 4LRNL 3L3OC 3UIYA 3FT0A 1D9KA 3WNJA 4LVNB 3QXDA 1MAMH 2C7UB 4TUOB 2AJZA 1PCSA 1E8XA 5T1KB 4LPUA 4AYDC 1BZEA 2LU7A 1IIIA 4BQCA 1U92B 5E0FA 2BFVL 3APCA 5A7EA 5I15L 4QXGL 4XB3A 1IJ9A 2IADA 4NZTH 4NO2A 4AV0A 1YHPA 2MPVA 4MAYB 1RD6A 2ZOOA 4K7FB 3H2PA 1GPOL 1EEZA 3CLWA 2O72A 3QG7L 1E42A 3PHQB 4IMLA 5A16B 4XP6H 3TCLA 4AH2A 3EDFA 2ZWLT 5I1EL 3UJJL 1U9KA 2O6PA 1KIPA 2X89D 1LGVA 3AB0C 3AM8A 3QIWC 4Y4KA 3SPIA 2K9FB 5HHVH 1YNKH 3FUDA 1HDMB 2NX5E 3D8MA 1N6VA 1DQKA 2JK5B 1E2ZA 5CZKA 5JQHC 3US0A 5KVDE 2GTWA 3X12B 1T1YA 1CBJA 3NRFA 4B0MM 4OCNC 4J2QA 3F7KA 1N2RA 3IXTB 5EIQA 5AZ2H 4M8UA 5TD4A 5HPMB 1OP4A 3ZW3A 2BOLA 3NACL 4UAHA 4GUCA 4YBLB 4DFHA 2EO7A 3IDXH 3MJ7A 2NX5D 4N68A 3KL0A 5GS2H 5IFHL 2NT0A 3A6OA 4H5SB 5AOJA 4MDIA 3MLRL 4KKLC 1L7IH 2NY2D 4FFYL 2X44D 1J5DA 1Q72H 1GMIA 2ORBL 1M7DB 5D1XC 1CLZL 4KO9A 4AQEA 4FTVE 1YPZF 3ZY7A 3I50H 3RWFA 4QOKA 4J1UA 2VN5A 5E4AA 4C83B 4Z76B 3UJTL 2FO4A 2PO6C 2WY3B 2VDOL 2WB1A 4XZUA 1GL4B 5DJXA 3MVSA 3VFPB 4MDRA 1FWXA 3QS3A 2UY7B 4CJ0A 1R33A 1URZA 1T1WA 2AXGA 4DPRA 1QYGL 4GRWF 5HHPA 3ARGD 4EMZA 3VG0H 3UEZA 3PFQA 1BYNA 3BVVA 1IKFH 1X4YA 3C12A 3QDMD 3OAZK 4L4TB 5F1SA 3VFOB 4BFIB 5BMFL 5I0VA 2YKLH 3WKYA 1J5HA 3HPLA 4UU9A 3UP6A 4EI0A 5FAAA 3FT3B 3VFNA 4KH9A 4P5TD 1LDPL 1JVKA 3L4VA 2NW2B 1OB1B 2VZ1A 2X70B 3QI9B 4QHPA 2GJJA 4YDKH 4DP2X 2HG5B 2H0FA 3VFRB 1S7VA 4JR9L 3A3YB 2QSVA 2CM5A 5DCCA 5DJ0B 3IF1B 1CXEA 2RQ8A 1RIUL 1TZOA 3LPFA 1JS4A 4FQ1H 4Q97A 1MFBH 3ESOA 4UM9B 3D3VD 4HF5L 1IIKA 5DJCA 5EU7C 2YJQA 3C8DA 1KJMA 3T8XB 2FGZA 1W0WB 4A2MA 3CLEH 5L2KE 3EOBB 5SWSA 3ROLB 3TEUA 4HXBH 4HLJA 1FZJB 5EO0A 1ZPLA 4JO5A 4N3UA 5GRWA 3DGGA 3TJPA 4DETA 3HI1B 3D0LB 3F85A 2ROXA 4IBWA 5HDOA 3FFCD 1A3RL 3RY6C 1RIHL 5JHMA 4MA1B 2N3JA 1IL1B 5F7EL 1BBJA 1IFRA 5JHDD 3MGAA 3EYUH 3T0XA 2AXFA 1P1ZA 4XPHL 5K9QG 3P3UA 4DNLA 2PCFA 4XVSH 3S5LB 1J1XL 5CEYA 1YMME 1KCUL 1WZ1H 3MBEC 3NOIA 1ACYL 4DHLA 5HGAB 3V4PH 2CO7B 5J6GA 4UV7H 1JZ7A 4Z9KB 1B0IA 4ODTL 5G5DB 4PJ5E 4OLZL 1J7VR 2J6WA 4PVBA 3SKOB 1IGML 2W9EL 3IGAB 3B3BA 3HC0B 1XZWA 2YAQA 3V4PB 1AMXA 4POZD 3MCLL 3QAQA 5ICXB 4WHTA 3UTQA 4W68A 1CFTB 4OFYA 3K8KA 1ET7A 3R8QA 3BP6B 2VR6A 3EIFA 1ED3A 3P4LA 4FC3E 4BFKA 2HMID 4R4BB 3WGUB 1QSEB 3MNVB 1L6PA 4FFYH 2ZUQB 3QEQD 3J07A 1EHLH 2F54D 5KVEL 2YD7A 2NX5B 3ZYZA 3QWNA 1G9MC 3CHRA 5I8KL 1CQYA 2DIBA 4G8EB 3ARDB 3FCSA 1QO3A 1LNUB 4TNWF 3ETTA 4KU1A 4NSKB 1YECL 4AVHA 1PZ5A 3Q48A 4R4FH 4DGYH 1FVEB 1WUNT 4UOW1 4K9EL 4I48A 3IB4A 4Z95H 4J5VA 2XTSA 2BM3A 2CU9A 3V0DA 5IHBA 5AZEL 3EFOB 1NJ9B 2PPEA 5H35A 2B39A 4LMQI 2C9XA 1DQJA 4FMKA 3GLAA 1SYSA 1YQ2A 2JJSC 1ZHNA 4P2RE 4UIMA 4HFWA 4ZI8A 3OKEB 3ZKXC 1HOCA 3S3BB 2P9RA 1CE1H 2DS4A 2NSQA 1W8NA 1DCEA 4JY4A 1X7QA 2XVKA 4IBLT 4LLYA 5D2LF 1IAOA 3RQ3A 2WXJA 2VGLM 1FDLL 2TRHA 4HUNB 5C0CD 3HNTH 2ERJB 4XN2A 2Z7UA 3KJ6L 3KHOA 1JN6A 3QP3A 3GRGA 4UB0L 2QDWA 4GLRI 2XJKA 4NERA 1SBBA 1RIUH 3MJ9L 5D7EA 4Y5VC 1SY6A 3LXCA 3I02B 4HWZA 1W72L 2I60H 2R2BA 4X4KA 4CADA 5CZVH 2VDOH 2BVOB 2BCKB 3C5JB 1YAIA 5DVPA 4G2AA 4XVUC 1C08B 1S2EA 2FQDA 2UXVA 2X10A 1VDGA 4L4TE 2RB8A 4H0GA 2MEJB 4Y5XC 3R4RA 4Z7UA 3GEFA 4KHXL 5D2NE 4FOMA 1RIHH 4NJAH 1Q9OA 1UWXH 3N42F 3UL4A 3VG0L 4IHOA 3UC2A 3N3EA 2XBDA 4M8VA 3QQDA 4UAOC 1YEFL 5EZPA 3ULUE 1OD7A 5F6IB 1P9MA 4YFLI 3WE6B 2X05A 1JJUA 4KVNL 4PJXF 4PBVC 5ADOH 3WKML 3BAEH 3FTYA 1JGUH 1KJ2H 3O8XB 4YDIL 1ZANH 2XKNA 3FOMB 4FJYA 4KRPC 4I0PA 4N9GB 5EA0H 3QUXB 4WWNA 2IOOA 4K3HA 5CEXA 4HJJH 2A38A 1GA2A 1AO7A 2A83B 4KRLB 2RMNA 2Y2WA 2OMYB 1I8KA 3SE6A 4OLZH 3RZWA 3MBWA 4H1LB 3NJNA 4K94H 3L3KB 1CMOA 4HF5H 2HTLD 1ZLVH 3WFHA 4YHZL 3VRIA 5CM1A 3OM3B 1E4JA 4BKSC 5GRXG 1WTLA 2DYSB 4RCAA 3MRFA 3ZN6A 5IB4B 1NCIA 5IB3B 3BDXA 5FDYA 3AXHA 2C9VA 1EHLL 1INEL 3STLB 3EGSA 4QRQA 4GI8A 2J44A 4Y1AE 3TIEA 1XCXA 1OK0A 3QUML 4QRSB 2CGRH 4UQEA 1PJ9A 2XXFA 4M03A 3MZGB 1AIFA 3O3EB 2B1AH 3V4VL 2V37A 2WQUA 3P3SA 1CFBA 4R6UA 4CSSA 2HRLA 5LQBH 4X6FB 1DQQA 1AQ8A 3GMLB 5E7FA 4JFYB 4UDUB 3QYNA 1F41A 1XGUA 1KY7A 2W8CA 3BIAX 1IEAB 3QC6X 5T3ZH 3PWVB 2Q6WB 5KVMC 3AY2A 4AT6A 4QJ3B 5I6OA 1MW3A 4ZFGH 1UM4L 5ESAA 4RWYL 3QXAA 1UKSA 1E5CA 2BX5A 3PU7A 5ACZB 3MRNB 4QY8B 1GYVA 1CLYL 1DBAL 5AVSB 4BZ2A 2ZYIA 4G9FB 4G6JL 5FHBL 3T2NH 2QADB 1SBSH 4FL4C 2D4DA 1VGKA 3RWDA 3X1NA 3MOBL 5CJQH 1S7QB 4KK8D 2BZCA 4L3EB 2H6PA 4PTUA 3GI9L 3PQYE 4XGZB 5C0IB 3JVFC 2W59A 1EZUA 1BFVH 1KFGA 4ZQTA 4OVVA 5DO2D 1PG7W 3KM1A 4WUUE 3ZX1A 4S1RH 4TXVB 1D5RA 5F7FA 3VG9C 4TLKA 1OAZL 1KB5B 1T0NA 3GTVA 2XBTA 1WE5A 3GTNA 2WQRA 5CGTA 1UWGH 5I1AA 3PUUA 5HDLA 1J0JA 2XX1A 1FLRH 3BZ4A 3VQ1C 4P2RB 3EYQD 1MNUL 2XVBA 3HR6A 4P4KA 1Q0YL 1MCCA 5D7JA 5DJDB 3NJGA 5DRNA 3HB3B 1KTDA 4AQ1A 5B38B 1YEFH 2PYFA 2YRBA 3H9HA 4C59B 3SDAA 4EIBA 3IS1X 4OM1H 3PGDB 5D1QC 4NQCA 5C0AD 3C6LB 1F4AA 1FNSL 1JERA 2XWCA 4KVCL 3ARYA 3DI3B 1CXLA 1ONQB 2V17L 5CJBA 4FFVD 2FJGA 1IV8A 2ARJA 3KDPB 3C5SA 3RIAK 1BVNP 2E56A 3FUMA 3KPSB 1WTGT 4KX9A 5DJZA 5AOIA 2ZCHH 4JVUA 2Q7YB 2PYEA 3MJ9H 3O8XD 4JO3H 1ZE3C 3CVHH 3BUDA 3O0RH 1G6RH 4CSPA 2EC9T 3VI4B 4JRXD 4OLXL 4OLWH 1CDCA 2FZ3A 3NJMA 3ES6B 2VERN 3D4YA 2R0ZH 4R2GC 1JRHL 1MG2C 1GSKA 4DVBB 3L4UA 4U0RB 4GSQA 3ULUF 4JNXA 1FBIL 4PRHE 4B9ZA 4Y5VA 5IY5B 3LH2L 4IU2B 3KGSA 1NANH 3FB8B 3TT3H 2ZP8A 1QEWA 2W80C 3UG3A 4IBTA 5D9SA 1KEML 3WMSA 4FLHA 1EPFA 4QLRA 4XAKD 1BBDH 3MUGA 5K39B 3C6EA 3V4UH 4DK6A 4U1IB 2WZ5A 4QXTB 1W9XA 3IPFA 4GRLB 4B9JA 4GKZB 4JRYD 3V6ZB 1MF2L 3HG1B 3VGEA 3ZDZE 3P77B 4UOW0 4B9PA 1EX0A 4H8WC 1B4TA 1TJGL 4EUPG 3LHPL 1WD8A 2FR4B 4U1SB 4EDXA 2P5PA 4HJIA 4K3JH 3NA9H 5E2UH 4KITB 5E6IA 4NCC1 4YOKA 3KBEA 1Q94A 3SDCC 2GITA 3VGGA 5EZIH 1ZHBB 2YD5A 3ECUA 4FTDA 1A6WL 3KWXA 4RGOL 4R9HA 3NK3A 2D9CA 3IFLL 2XT1B 5C0RL 2H9GB 4UTAH 2A9MH 3QJFA 3WFBH 1E5AA 5L8KB 3FB6A 4WNSA 4P23A 1WAAF 4WGVB 4WTWA 4YUEL 2BH0A 4E68A 3SGEI 4P2QB 1N9PA 4S1RL 4TM9A 4F33B 4G8FB 4C58B 2JFCA 3SKJL 3NTCL 2WO3B 4FHBD 1TMQA 2YR3A 1I4FB 3ZE1F 1KYOK 1TR7A 1U2YA 3T4AB 2SEBB 1E7UA 3C8HA 5CSGA 3SODB 2B2XL 4F7PB 5JORB 2YMOA 4PJ8A 1R3JB 4NWTH 3QJUB 4AVIA 5D5ME 5IGXH 1MWAB 3SCMB 2AJ3A 1CK0L 1JRHI 5CD5D 3QK0A 1UM4H 4KMTH 5D1XD 5FW7A 4LSSL 5GRJL 1HKLH 2N59A 1YMMA 1JHTA 3QXWA 1KBKA 1K5NA 3ZE2E 2BJML 2OTWB 1M71A 5D70H 2BZDA 5F7DA 4BK4A 3SE4C 1MJUH 3JTTA 4UIKL 1ZVHA 2J8UF 1OPOA 3LIUA 1AXSB 2AZAA 3T08A 2CDFA 2YO3A 3OLGA 4KTDL 1OAUH 3GPEA 3P4NB 3OX8B 1BXUA 4LDOB 3L45A 5BS0E 3D18B 4OZHE 1FGNL 1SEQH 2IPUG 3WJMA 4J3VA 1X5MA 3O0RL 2IBGA 4Q52A 4G7YH 4HUWA 1Z3GH 3DIFA 5CZXC 3SPVB 1TJHL 1OT1A 2X5PA 4PI2A 3GUTB 1LP9E 1BVLB 1BQHB 5C07D 1QBBA 5J1AA 1JE6A 2KDGA 4I85A 3TN0C 3QIUB 4ODWB 3MLZH 3RP1A 1K8DA 5CFAA 5ICYB 3FUFA 1SJMA 2AQ3A 3IAPA 3KPOB 2G9KA 1N5AB 1TTBA 4YK4B 3QIBB 1NGPH 1E4WH 4ZMVA 4M7ZB 1K4DB 3B7TA 3GFUA 3S36X 3UBXG 1Y6NR 4PR5B 1JGLH 3N1QC 1BMWA 4OM1L 4WEEA 4JG1L 3FHAA 4ENEC 4L4VA 1FNGB 1PNCA 4XX1G 2R0LH 4BRVA 5BV7L 2NNXA 1HL5A 3PAYA 4BDVA 1OE1A 3MLUH 2FHFA 4YO0A 3T2LA 3FAXA 2DTSA 2TAAA 4YL4A 1PEZA 1ZHLA 3L7FA 2EIEA 3QUXD 2J20A 2PLTA 4PJ5A 3EDKA 2KMWA 4GNKB 2XQBH 2X4RA 4WSKA 1X9RA 3QDMA 5DZNA 5SWZB 2A99A 5BZXA 1HSBA 1P5UB 2OMXA 3L6FB 1DUYB 5E2UL 1T22A 1E2WA 5E2WL 5FGBA 5F6HJ 2W9DL 4FMFA 4TNVF 2YHGA 2V5MA 3TBWB 3S96A 1D6EA 1E4KA 4OF8A 3LPWA 1NIFA 3K1DA 1BG9A 4XMLH 3L9BA 4Y2DC 4BCYA 1CF8L 1I75A 5C0RH 5HYEA 1DYZA 5JHLA 3ARBA 4FTVA 2CG9X 4N6RB 1OCCB 2I32A 4P3WA 5LUMA 1KNOA 1A6TA 1NBQA 4FQPA 4R0LA 5BW7C 4G42A 4L8SB 4AGMA 1CGYA 3PAZA 4IIQA 5C0JA 4PJDA 2FWSA 5K93A 3CH1A 1MFAH 4YE4H 1HHJB 2YXWA 3OKNB 1LO5A 1MHEA 2MWCA 1HSAB 1XIWD 1FGVL 5LBSA 1AQDB 2AEIT 1QUNA 3NJFA 2VDLB 1I1YA 3H53A 3MJ9A 2BCMA 2VDLH 4AG4H 4F58L 3QXUA 4FQIH 4WJ5B 4Y19D 3RE0A 1OVZA 5GGQL 1AXIB 2R69L 2X6UA 4S1DD 3ZHDA 5ADPH 1RUMH 1CL7I 5INCB 4F3FB 1IGYA 4ZW8A 2FB4H 3KPLB 1OGTB 3KPQA 3ZRFC 1LLAA 1NCGA 4OGYH 4LSSH 4HOWA 3WNPA 3KPMB 5I17B 1IC1A 4YDVA 2NZ1A 4FQHB 4HFUH 2BP0B 2G2PA 4P3CH 1JWSA 1FFPA 1BLNA 4NKQB 3L17A 2CO6A 5EIIA 4AW4A 4OBSA 2KBGA 5DHVH 4BJLA 3NZ8A 4KK9C 2HB0A 2ZCZA 5AVVB 3HZKB 2DLFL 4NFCA 4OVUA 3RTQD 3Q1EA 3BH9B 3PRZA 4XPBH 3VXSE 2G4GA 4MA3A 1TKWA 1WCQA 3UTSD 4OAWB 4FL4B 1NOAA 4XNXH 1A6VH 1JGEB 1B6UA 3NMEA 4XMZA 2CK0L 2UZPA 1U3HC 3CXDH 1N3NB 2MTAA 2BHFA 2Q76B 3HZMB 3QRGH 1P5VB 4GSXA 4N2HA 3ZE1E 1MCWM 4PJBE 5IQ9B 1JHKH 3UG5A 2MKLC 3LIZH 3MODL 4M9PA 5EBWA 4AEIH 4YBQC 1LO0L 5GJTL 3CUPA 4R2GB 5CR1A 5I1DA 1JZ5A 4P8QA 1YEHL 3WNLA 1BXAA 1OSZA 5FWQA 4NYLA 2IV8A 4A2FA 2CE6A 3MRGA 3FUEA 4UMGA 4PGEA 1HH9A 3AITA 2RHEA 1K8IB 2WXFA 3CC5B 4N86A 4XNYH 3RIFF 5J1SC 3BZEB 5HPOA 2J2ZA 2Q87A 1MCLA 3VQ2C 3F12A 4ZUVB 1KIUB 5TF0A 4GRMA 4CC1A 4WI5A 1BJ1J 1XSOA 2Y1ZA 2H2SD 5LBGA 1FGNH 1IAMA 1SEQL 2W0PA 1GOFA 2OMBA 1UVQA 3DC0A 1XCWA 3O6KH 2R1YA 4GFTB 2UWEA 4U6VH 2GJRA 3W0WE 5I6XB 4NPJA 1QLEB 3KPRA 4WEUD 1RZIA 2XZZA 4Q9RL 5IB1A 5D1QB 5C0ND 2EILB 2GVYA 4LE8A 3ZE2B 4DKFL 1IE4A 1YC7A 1NUDA 5EOQL 3AWEA 4PTTB 5C0BA 3RWJA 1EHKB 3V6FA 5CHNA 3AREB 3SGJC 5C8JB 1CTMA 1SHXA 1I82A 2CHNA 2UV3A 1YUHA 2WZ6A 4YHMH 4AEHL 1VERA 1UEYA 5JR1L 1N67A 3OHXB 1VIWA 4OZIF 3GK8L 2UY6A 3MFGB 3EO1A 1UKQA 3S8FB 4YE4L 4OLYL 4K8RH 1YNTB 3TZVC 4NRYA 4D9QE 5DRXA 4PP1C 5EU7E 1ZRUA 4OLVH 3UTTA 1FJ1B 4BFGA 4MNGA 3TH3T 1LJMA 4P23C 4Q7DA 2MCPL 2PXYA 4XP5L 3PV6A 4JJHA 2QHRL 2WLIA 5EZOH 4GRLD 2VLKA 2DBLH 1VADA 1HZKA 2MCAA 3BE1H 4PJAA 2LHAA 4K5MA 4KNQA 4CSTA 4Q4EA 1KYDA 2XYBA 3FTGB 3E9TA 5ANMA 1NCDH 5B1AB 2IQAA 2Q9OA 3NIDE 1KV7A 1KLGB 4CKQA 4ELMA 3Q1SH 3QWRD 1J9CT 4M5YL 4J4PC 3MNZA 4MSWA 1RJYA 1HEJC 4AIZB 4WIQA 4HT1H 1Z6JT 5I5RA 4ZMNA 5JDJA 2DL2A 1TDQA 3FUNA 2N0KA 1SFHA 1R5WB 2FJFB 5KAQF 3ZGHA 2AAAA 2DQTL 2CH8A 4OIAA 1PKQE 4R84A 5LDSA 2C4FU 4Y9GA 5BO1L 3DRTA 2DQDL 3VNZA 1AQKL 4JO2H 4HCFA 3OR7A 2ERJC 3ARBC 4O2EB 1TPXC 3BWAB 5D1XE 3O6MH 1YVLA 2JQZA 1E9QB 4WFHD 4R97C 3MJ8B 5CS7A 4YWGL 2ETWA 2QTEA 4RMTA 1DBKL 1NFAA 3MRCA 4YR6B 4BSWB 3VD1A 1QQDB 2A2QT 1RUPH 3J2PA 3OMAB 4Y5XB 3Q6FB 5FOJA 4ZMOA 1EHXA 1S7SB 3CQPA 1NGXA 3F7LA 4XN7A 5FKAA 2PYED 1GW6A 2VLMD 3RX9A 1PAZA 5HD8D 5BO0D 1J0HA 3M6DA 3TF7C 1RZJL 3B2PA 4MMZB 2C4XA 2VRKA 3K6DA 1F3JB 2VAAB 3T0ED 3QNXB 8FABA 3QZLA 2H2PD 3ZXAC 1XB6A 1SNRA 3CCHA 3I2CL 3HG4A 4KROC 2FHBA 1J18A 4PRIB 1IAKB 1X3DA 2DMCA 2KLTA 4AV5A 3UH8A 1BM3L 3E8UL 5LG6A 4QNPF 3EHBB 4JN1H 3CWGA 4GFXA 1FYHB 1YMHB 4LHQB 4J8QA 2VCOA 4KKNA 3ZE1B 1R5IB 3SGDI 4LNRA 2HKFH 2LOEA 2NUTB 1A4AA 1CDYA 4JFXA 1T5WB 5A2AA 4XX1E 1LMIA 2V9UA 2IQ9L 4JY5H 4YHML 5HHOE 3MO1A 3TNMB 2WSPA 1JZ8A 3QZNA 2JCCB 1A9BB 1QFWH 1JGDB 2MJWA 1PX8A 3QIBD 3CDCA 4PCYA 1GH7A 1NCCH 1G4MA 2EICA 3HCVA 4EVNA 3MKKA 4I3SH 1M1XA 5C9JA 2XN9A 1F4YL 3ARED 3QHFH 2XFXA 4AYMC 5BUPA 1MHCB 1RJCA 3IDJB 1EXUB 4QXGH 4YE0A 4X5LA 4AX3A 3MBEB 3PE9A 2BOCA 3D9AH 3K4DA 5TDNB 1CGWA 1WFTA 5BZDA 1V7ML 2A9CA 5CD3B 1HHKA 4LL1A 3CDFA 2CIIB 1UADC 1HQRA 1JPGB 3EJJX 3N1MC 5CLWA 4LDLB 3S9DB 1B0RB 4NOBA 5EU5B 4WZ9A 5IMKA 5SWZD 1ZGLB 3OL2A 3W37A 2A6IA 1EAPB 3TWCL 3W9EB 1JG9A 3ILPA 3MXVH 4FNQA 5EF1A 1OPGL 1BPLB 1WBZA 3B2DC 2LVEA 4KPHL 2VLLA 1G94A 3IWUA 4J8RB 4U1HA 2Y3AA 2EYTA 3ESVF 2ADYA 1YEJH 1U4EA 3NQKA 4YHPA 5I26A 1IBDA 5FIEA 3REVB 3CBJB 2QHLA 1NC2D 1YAZA 3IKCB 4LARL 1MFUA 3L3OA 4AEHH 5JR1H 3GHPA 5LBSL 3WLWD 3TX4A 1AC6A 1BMZA 5E00B 1TSHA 3IDYB 4I9WD 5CEZD 1GC1H 1VFBB 4GBXA 3EDJA 5EORH 2W1NA 4P2OD 3V5DA 3QR1A 3POCA 4BFBD 4KO6A 4EDWH 2WMPA 4LCYB 4YDNA 1JZDC 1S7RA 4TNWK 4E41B 3KDMA 2MMXA 1XDTT 1UD8A 1AP2A 3BFOA 3K72A 1KB5L 2WINB 5JA8B 1P4IH 1R3LA 4FQXD 1A47A 2H26B 4YXKL 1RPKA 3DUHA 4NBYB 1H19A 2R27A 4WHYG 2K4AA 3MRIA 2BSED 4KKCD 1JWUA 4Z3HA 3ROOA 5GRYA 2EYSA 4KQ3H 3EYVA 1XGTA 4X6DA 4HS6B 4R7XA 1NFIA 4N87A 3BPOC 4M7KL 5DQDH 3B5TA 1T0MA 4LP8A 2AVGA 3WS6C 5FFOA 1OARH 4BZYA 1ZT4A 3C08H 3NT0A 1J1PH 1NGYA 1E6JH 3CHPA 3AG4B 4XO3A 2HJFA 4XE0A 4QHKJ 3OAYH 1UASA 1H8NA 2A9DA 4MNHB 2ICEC 5FGCB 5C09E 1PG7X 3MCKB 5FLUA 2Q86B 5AYUL 4X5WA 1YDPA 2COQA 5EUOB 5AKVA 5DSCA 2C9RA 4OR1A 2IH1B 4FI7A 4RFEB 4BQBA 2YEVB 5HI4D 4V1DD 4H20H 3UZVA 5JOFA 3T8MA 5DVNA 5E5LA 5JO5B 4R3SA 2I9LA 4U2ZA 2Y7MA 5FGBC 2ZSVA 3MLVL 4HKXA 2VDOB 1AI1H 3CSYB 3EYFB 4HIHA 4LKCB 4U2YA 3LQZB 6TAAA 4FLQA 4WHCA 4APQB 1GYWA 1CR9H 5IIEB 3DWTA 5FDWB 5I24A 2O5XH 3FONB 3TO2B 4HG4K 5ISZE 3CDZA 1F4WL 2N7BA 3DVNA 1MZYA 3EBHA 4WI3A 5D93B 5GSVB 3M1OA 5ERWB 3QUKA 4RMUA 4JN1L 5IROA 4Y1TA 3BYYA 3CIQA 5DJAA 5A3IC 3BD4A 4QRTB 1J1OL 2A74A 2LV4A 1KCUH 1NINA 4OCXL 5CGYC 4R26H 5DA0B 3LN5B 3CGTA 3K80A 4ODVL 3VFTA 4ZOBA 2OA9A 1NMAL 5B4MC 3L5JA 1K2DB 1XF2A 5EOTB 1H0DA 1TQBB 4JHAH 1GC1L 3VSUA 1HZHH 2NY2B 3GZPA 5EU3A 4RGMC 3JQOB 1CGSL 2BOBB 3QNZB 3KWUA 3OZ9L 5JIMA 3S3SA 5I6LA 1AJ7L 1HH6A 2X4TA 5DURD 5JW5B 3VXQB 4IRJA 4NQDA 1J9SA 5I0YA 4HOZA 1VGEH 1MAML 2RCSH 1UA6H 4X99B 2OJZL 1TENA 2UXTA 1RZKL 1FHGA 3A6CH 1F13A 2DY2A 5I5JA 4BM7A 5DQ9A 2JCCE 3K2UH 1XR8A 4LL4A 4U1GC 4ZAKB 5M7QA 2NLJA 3DGCR 1G1OA 4Q9CA 3C6SB 3HKFA 5DJCB 5HYSG 4J3TA 2P80D 1IBBA 3O2WL 4Q6IC 4NUMA 4X6BB 1QSFD 3UTSA 4KZ0A 3SDCB 2DQEH 2YAMA 5TF1H 1QTPA 2WVUA 4L8BA 4UT6H 1U91B 2J7LA 4XBMA 2F7QA 3U4BH 3SBQA 4W4NA 1PJWA 3OKDA 3V0VA 3PL6A 1KENL 3BRDA 2BNQB 5L0QB 4XO9A 3UACA 1IC4H 4WJG3 3GSRB 4F1ZA 2ZYSA 1ZGLP 4JVPA 1EK3A 3ALWA 2ZKWA 1S78C 5D5MF 5KOMC 1UXSA 3K81A 3V4PL 4CL7A 4M5ZL 1E2VA 2JKSA 3AB0B 3QIWB 1JK9B 4B9GA 1VZHA 1SVCP 1U8MA 5L2KA 2WLHA 2IFFH 3C5ZC 4NC1C 4XVOA 1YYMH 4OI7A 4B9KC 2AK4B 3V0IA 5LCVH 2VW4A 1MCFA 4WGWB 1P4BL 4AW7A 2VRQA 5C6TH 4ABUA 4OZIE 1VACA 2KUTA 3FFCB 4YXHH 3K6NA 5IESH 1IILE 3ARPA 3N40F 5JHDB 1WFUA 1KTLA 3ZRCC 1MJ7H 5HI5C 5IWLC 4ZOCA 2F15A 5LGHH 1EJOL 2AMUA 1DLHB 1GGUA 1OF2A 4X9BA 2WVVA 2WC7A 3QFDA 4GAGL 5IVXE 1RUAL 3I9AA 5IW6B 1F97A 4KHXH 3QEQE 3OXRB 1F4WH 4P5TA 4ELMF 5B8CA 5DEZA 5KSBF 1GC1C 4PIRF 3P0VL 2HG0A 1LNUA 5IVZB 1I7TB 3HE7A 3RZCD 2HLFD 4N20A 1YEIL 4ETYA 2C3VB 4PJAF 5DJ6B 1CYGA 5JYMA 1VEMA 5HJ3B 3WKMH 4MJ4A 3TBSA 4PJIF 5FA4A 3MLPA 4ESKA 1AY1H 4MA8H 3HG5A 5EA0L 3TYFA 4FA8A 4M93C 4CDHA 1BECA 1VESA 2BW5A 1ASPA 4QOKE 3QEHA 3O2DH 1Y1DA 2B14A 5D7IF 5FYKL 5T1DL 3HS0B 3JUYA 1WLHA 3P3YA 4JZNB 4XP4H 1KGWA 1AZVA 4FQLH 4LU5H 1UCBH 3FHEA 3OKEA 3QG6A 4HGWA 1JPFB 2RAMA 2NNRA 4KY1H 4YHZH 5FHAL 1I8MB 4KTYA 4OD2A 4ZSOA 3D0VA 2UXFA 1OAKH 3MBXH 4Y16C 2Y36L 3MACH 3TTSA 5IQ7L 2IPTH 1JCKA 4E5XB 5EUOE 1RZ8B 4LP4A 1ZTMA 5KUMA 2WWOA 2UWEF 3ZK0A 1W72B 1IBGL 3E0GA 4HWZB 1WCBA 4MGXA 4XNBA 2QLVB 4FQQA 4F2FA 4XBGB 5HGGS 4XHJC 4IOSA 3IAGC 3V0HA 3C5JA 2IPKB 2CDEB 5GXBB 5J12B 4JRFA 1VAHA 5HYJD 4Y2NA 1GGBH 3A5VA 3BAJA 3TP4A 3U4BL 1JPSL 3DHJA 5D6DC 3WS3B 5TGBB 1X5AA 4ZPVA 4K7PL 2Q7NA 1EEUA 1OKEA 2E9JA 2YPLE 3Q8AA 3FH5A 4FFZA 5TPWL 5EULV 1RURH 1AIZA 1HCFX 4UUJB 5B1KA 1M05B 2LW3A 3GRWA 1AHWC 3RWCB 4AC2A 2XXMB 2VISA 4URTB 2YKKA 3FZUD 4KZEH 4NNYA 4RA0C 3MTXA 4V1DA 1CFNB 2CQVA 2HWZH 1ZXKA 1HXMA 2IFFL 4ZUUB 5FA3B 3BVDB 3MRKA 4HPYL 2JI2A 4YFDB 4E41D 7FABH 3P40A 1I8KB 3KLAB 2YPVA 5CU9A 1CC3A 3MOBH 4XCEB 4N3TA 1OK8A 2HLFC 4DP8X 4ZX6A 1TVHB 3ISRA 4TKWA 3DYPA 4L29B 2OYLA 1GY2A 2FBRA 4WRLA 3VCLA 4R83A 1UCTA 1DUZA 2DWDA 4L0YA 1KTBA 2BNQD 1OAZH 3MCLH 1NH6A 3LZLA 5K9JL 4M48H 1N0LB 3FO0H 4AGQA 5LXVA 2I07A 3U2JA 5CJ8A 5GZND 1INQB 1TZGL 1MIMH 4GXVL 2OMZA 3PJLA 4WK4B 2QVMA 3G7TA 3UYRH 1QLRA 4NQCD 5C0AA 1MNUH 2P44B 1HILA 1CDHA 3PP4L 1EFXA 1BEYH 1JYVA 2XXGA 1OSPL 2XVLA 3ZL4H 1XGPA 3JSSA 3BO8A 5JPNC 1SLWA 5SWQB 1U8NB 3HE7C 3VYNA 1J05B 5FM5M 4G1MB 4YX2H 3PHAA 1H3GA 4MMXC 4P4KD 1A5FL 3FS9A 3FN3A 4KFZC 4EKXA 4HK0B 4ZFFA 3L1GA 2G4EA 4PFEA 4Q2ZA 4FFYA 3T0AA 3C09B 2F1AA 4FG2A 3CE1A 1T4KA 1IT9L 3M1BA 15C8H 1DE4A 2WNWA 3ARFB 4JDEA 4NRZB 4EAEA 5EPMA 4TPRH 1OCOB 4AM0B 1AG6A 2WXGA 3VYOA 2WLZA 1P7KA 5AQ0A 4BZ2H 3NQIA 1NM4A 2VLME 1X6LA 2Y7QA 5DK3A 3WNMA 4GUPB 5DEGA 1EEYB 3FMGL 4YHIA 5C2BH 1A9EB 2ZUVA 1FDLH 1ES0A 2VJ8A 1T7YA 2IPTL 2XCMC 2NY0C 4W93A 3U79A 4JZJB 4R7NB 2Y06L 4GKLA 1FF5A 4WWPA 1WVZA 2CKBH 2ICWI 2J6EL 4ZBJA 4HSCX 4ZNCD 1JVOA 3W2DH 2XWBA 3BH8A 4LCWB 4DH2A 3FSWA 3GSNH 4YAQA 3U46A 2OSLA 4DP0X 4W9IC 2JKLA 2NCEA 1DQDL 4BRJA 5JW3H 4F8NA 1DJSA 1T7XA 4PJIA 43C9A 5I1AB 4AQ1C 1BIHA 1A14H 2HLAB 5IV2A 2VMFA 1PX3A 2D03H 1XXFC 4HJSA 3MCYA 3T3PB 1HVXA 3K4AA 5KSBA 1L3NA 1MXGA 5DHXB 4MD5B 5KTEL 3ARGC 2XTJB 3VRJB 5EWIH 1P7QD 1IEHA 2CLZB 4TUJA 1CD1A 2DTML 3EXJA 5DJ8B 3HA0A 4HUVA 2V17H 3DA0A 4L5FL 1WAEA 2HRPL 2C5DC 2A1WL 2OZNA 3ABGA 4HQQL 4F24A 4PJHE 2XU9A 5DURB 3A21A 3T77A 5E8DL 3WUZA 2Q2LA 5DJYA 3U6XS 3FQXB 3QQ3B 4MNQE 2TSBA 2J43A 3FT4B 1CYWA 5AUMB 3U4KA 1QR1A 4JLRA 3T2PA 4BFEA 3PWPA 4TTDD 4FXKB 1AGEA 5EEVA 5EO1A 4KUCD 1A3LL 1S7WA 2XPGA 3PWNA 4TUKL 4R8WL 1AZRA 3DXAE 4YEEA 5IK3B 3MV9B 1TJXA 1C5CH 1CFQB 1UC6A 2CM6A 2BY0A 1QSFB 5F3HB 3W0WD 5T5FH 4MXQC 5JZ7C 3GI8L 1G7PB 1WS7A 2XSKA 2WXQA 2ICEA 4OF5A 2WKGA 4X6EA 4CC0A 4GYBA 2R0KH 3IJHB 1INEH 4PGBA 5D7IB 1MVFA 1ZOXA 2OV0A 1P2CB 3O45B 3Q2NA 5FUCC 3VFGH 3U6XA 3ZIYA 4JRXB 3WDIA 1P7HL 2FLMA 5E8NA 4AQAB 2P5EA 2EZ0D 3HUJE 4N8PA 3W11D 3UG4A 4WQOA 4PJCB 2MRYA 3LD8B 1QFUH 4X5PA 4PG2C 3D4ZA 1A3ZA 3ULSB 1TNMA 3MRDA 4EI6A 1I7ZA 3WYRA 4WY7H 2NXYD 2C1OB 3QIWD 5I82A 3ULVL 1IKNC 1QFPA 2OZ4A 5IHHA 3LQAH 3WTWA 1KCRL 2XY2A 4KJYA 2I25N 2R4RH 1E8ZA 4FERA 3VI3B 2R29H 1M3JA 1JUFA 4DP6X 2YPKB 5LGYA 3PAUA 4GT7A 3GHEH 5EBGA 3MNWA 2XDHA 2XZQH 4MD0B 4QMEA 3Q06A 1LK3L 4R97B 2P5ED 4RGOH 5J11B 1NCBH 3I6LE 3L1OL 3WNIA 1WAAA 3I74A 3DMMD 3WFZA 1I1FA 2QPEB 5A40E 3MRLB 1PDKB 4IOSD 4M1CD 1J9RA 1WAAE 3KH3A 4MAYD 1ZS2A 2H9GA 4XODA 3VXSD 2EXTA 4YUEH 2A9AA 3RHWF 2QR0A 2A4ZA 1JGVL 1Z9SA 2B0SL 2BNUB 2GK0B 2LLGA 2NRDA 2UZYB 1CXFA 5EFIB 3RKDD 1CLOL 5MEPB 2ADIB 4W9EC 3MHZA 3LNIA 1ZCRA 3GMPB 3TPUB 1FVDA 4Z0XB 1L9OA 2VOTA 4ZZKA 1DBBH 1U8QB 5KSBE 1P6AB 2R0LL 4LCIH 1BD2E 1IQDB 5AAPA 2K6ZA 4QHMA 4S1DC 1MELA 3RY6A 4YSRA 2MHAB 4XNMA 3S35H 4YNYB 3IMWA 4L4VD 5LAXB 4O02L 3U4EB 3M8OL 1N8OE 4JREC 1THCA 5IQOA 5EO9A 4PP2A 4XXDA 5C92A 5GRJH 3OZLA 4HX1B 2C4FT 4P9HC 3D4CA 3ZT7A 3VWKC 4BZ2L 3T4YB 3SQOL 2IGFL 3P1VA 2WOBA 3K7UA 2E9WA 5CP3H 4AMKL 2E7MA 1A3QA 4ERSL 3GMNA 2HVKB 4ZW3A 5FFLA 2C7FA 1KPVA 2EEFA 4Y4KC 1HHHA 3WTVA 3GMRB 4ONGL 3T0EC 3CD4A 2EIMB 4RAVB 5GGTA 4HH8A 1P4UA 1IGJB 4G7YL 4HETA 3W2DL 4E9TA 3GSNA 2E4FA 3ECBB 3ISYA 3GDBA 3E2HC 4LKXB 5MHSE 3DMMA 5F88B 2PR4H 4G9FE 2NZ9C 1L5GB 4GAYA 4ICXA 1VA9A 3NEEA 4HS8L 4XC3L 5T1LA 4Z3JA 3FO1A 1PIFA 4UT7L 3GJEB 1I1AA 4M7LL 3GXFA 5EOCL 1VLXA 1ZIAA 1K8DB 4OIIH 1L6XA 1FFNA 2VNCA 2C1PB 4MDJA 3KPPB 1R5VA 4DKTA 2XWTA 1UH4A 1PPIA 1T7WA 3FSVA 3RRQA 4LEOA 5F9WB 3ARFC 5D96B 1OAQH 3UMNA 1DDHA 1M2VB 2M8XA 1IC7H 3MLUL 4KK5D 4NZUL 1ODUA 2QDVA 3BXNA 3AS0A 3LEXA 4MRBA 4N4YB 3ULVH 3BT0A 4GW1A 3VFUB 4J27A 1MF2H 1NCAL 2XWJB 1S8DA 1NBYB 2MCMA 1EERB 3LHPH 3MRRB 2OQJB 1DVFB 2GAZA 3L95A 1RLWA 1BIIB 2ZIDA 2F08A 3GS7A 2VABA 4HSAC 4Z7NB 2G75A 3IM1A 4ES9A 5CGMA 2GTWB 4GOSA 4IKKA 5EZJB 3ZT5A 3SDAD 2OXGB 4BE6A 2IXQA 2XBZA 2DICA 2WXMA 3UBHA 2J8UB 4HIIA 1H3VA 3M07A 1LP9F 4DK5A 1DJXA 2EIDA 4AQOA 5DO2C 1TMCB 3JZ7A 1HXYA 4PLKD 3S88L 4AVKA 3ZZ1A 2EUXA 3FF7A 1F00I 4OZFH 2Q8AL 4BGDA 5BZZA 1GGIH 2G2RA 4Y16B 3BAWA 1AMYA 2C3XA 3P54A 3TJHD 5I1KH 1MWOA 5JPNB 3PDOB 4HHAA 4DN4L 4P2OC 1RIVL 4FFTA 3BKJL 4YPGA 1MDAA 2GEQA 4P5MB 2YK1L 3H56A 5I30H 3CLEL 4WEBH 4NC2B 4XZUB 3TBTA 5SX4I 1SPDA 5TDOB 3PABB 3EO9L 3KXFB 5I71B 5H8DA 3TOPA 2EACA 1FLTX 3NEOA 4NAJA 3RBGA 2IGFH 4P3DA 2VC2L 4ZNEA 4M1DH 4OCWL 4FQXA 5D70L 1RKRA 5H37A 1FAKT 1FSKB 3H3PL 5L2JB 1CU4H 3INUH 4XPHH 2L04A 4A7UA 1YN6B 4XCNA 3C09C 4R7LA 4YDZA 1HXKA 3VD0A 1U33A 5TQ2H 4HEMA 2R2EA 3RIFK 1A6VL 1ACYH 3HLAA 1CBVH 3H9YA 1ZVYA 3ILEA 4JAMA 5FYKE 2FH8A 4G72B 3SKMB 4OLVL 1UZ8A 3V9EA 2RBLA 3MRQB 5ITFB 3W5MA 5E6ZA 1JIBA 3L3GA 3R0MA 4X7FC 3W0WA 4ONHA 1GZHC 2BS71 2BSSB 4WWKD 3HZMA 2F1BA 1JD9A 5DWPA 5KZCD 5KS9B 4OUUA 3ZUNC 3LRSA 4B97A 1MRDL 1WK0A 3QULA 4XN8A 5HHQB 4PJXA 2YGPA 3CSBA 4HP5A 1UM5L 3LB6D 4KC3B 4KDTA 4JFDD 5F7NC 3RAJH 1JI2A 5FYJD 3HR5A 1SYVB 1KFAH 2DW5A 3O4LA 4JFHE 4P4RB 4U6XB 5H4YA 3BKYL 4AGNA 3Q44A 1NOFA 1A6PA 3O6LH 2X4SB 2ZJSH 1S9YA 1M9WA 5F1OB 4IGBB 3ZO0A 3T0WA 4UQ2A 5CO1A 5CN2A 3IDNA 4HH9A 3FB7B 4ANUA 3LEYL 3PYCA 4PJBA 4IRZA 1RK7A 4CVXB 1S7XA 4WU5B 3PGCA 4UINH 4HJGA 3MV9D 4G11A 1ZLUH 1G7MB 1QWHA 2LAGB 2QKIC 4R2GD 4KOBA 3SDDA 2Q2EB 3HZYB 5AVTB 4RNRB 2YUXA 4U1LB 1C12B 3NDZE 1RPUA 4NAMA 5G2NA 1U8CA 1XGQB 4K3DL 5EC2B 2BVYA 3HPJB 4PW4A 2D3NA 2EYRB 2VXQL 2X0VA 5C3LD 4F91B 3HNTL 4X4ZA 1U8IA 4F7KA 2PABA 3NABH 2GJ6B 2D7PA 2DBLL 4KI5E 1JD7A 3VYPA 1NAML 3B9KD 3F8UB 1TCMA 5DC0A 4UNIA 3WFDH 5KYUB 1W72H 2DH2A 3KYKH 4GXUN 4GBXC 3LSOA 4LNVA 3RNQA 2FQEA 2YWYA 1S5IH 3SBWA 3EO9H 2JSFA 1BFOA 1OAXL 2DWXA 4F7MA 1J9TA 2Y6SC 2G3ZA 3QJOA 4OQTA 1PFCA 1NC2A 2RFXB 4X5XB 1A8JH 4CN6A 4ENZA 2BS8A 2RACA 1NM9A 5IEKA 4A55A 1A1MA 3QFGA 4U1NB 4HFUL 1AR1C 5FCSH 4TNVK 2AJVL 3BVTA 4OTXH 3L4TA 3LB6C 4J23A 2FLRT 2WBKA 4OZIA 1I1CA 1AKJD 1N19A 2BVPA 2IQ9H 4PVNA 5F1IB 5C07E 5C3IA 4LLYB 3QDAA 3L4YA 5ESQB 1ZWIA 2K7PA 2CA4A 4QIRA 2EE9A 4XNQB 4AQEB 3ZZQA 4DKEH 1RH8A 5J06A 4FMVA 5CSBA 1HYSD 1F4YH 1FLRL 1XMWA 4FG0A 4J1UB 4XCYA 3MRJA 4B9CA 3BGFB 1NGZB 2XPZA 1GJUA 2DDQH 3KPNA 4NQDD 3VXSA 1O7DC 2LVCA 3BDYL 5L7XH 3O3UN 5E99L 2DQFA 4G8GA 2XTLA 1MLBA 3D85A 1OLZA 3QZWB 4ZOEA 2W65A 3PUCA 3TN0B 5I75C 2YD4A 5GJTH 2EUZA 5HGHB 1UUSA 4FKEA 1I3RA 2HPTA 1EWHA 4Z7UB 1KPUA 1PZCA 3VXUA 4JY6B 1UACH 2QMJA 1ZJAA 2JIXA 4GRLC 5CMAB 2ZXAA 1XR9B 3T09A 1ZSHA 2ZJSL 3QQDB 2YXVA 5CN1A 5MEOB 3VI4E 4NQVA 2ZCKH 5IEHB 4UI2A 4YLQT 3QJQB 1SJVA 1MHHA 5AB0A 3NPZB 3BPOB 4V2BA 4E0RB 3P2BA 5FUZL 1S7UB 5IMLA 1CB4A 1M4KA 2QQNH 2YAFA 1ZS8B 1QP1A 3CFNA 4NQSA 2VL5A 3OKOA 4F9LA 1QLEH 1MVUA 2JKTM 1SJHB 1CDIA 1JRHH 4FCHA 1ZEAH 3BRGC 4ZRGA 3SZKC 5SWSB 4TQEH 3ROLA 4XWGH 2APVA 3WTXA 4QYOB 5B39B 1JPTL 3DGGB 3TT3L 2WZAA 1GMEA 4DGIH 3CDGA 3QUMB 4WI6A 3UO8B 4BSVB 1U41A 2H4EA 5KVGE 1O5DT 2FT6A 4J3OD 4OGQC 3QHFL 4Z7OE 1KJ3H 3OXSB 1BBDL 3DX6A 2F5BL 1A6UH 3BVNB 1HL9A 2YQGA 2AJUH 3D9AL 1BVKA 2IIJA 1L9RA 2CCVA 3C5ZA 3BT2L 2DQCL 4TNEA 4YDLC 4CA4A 3N2JA 1UYWH 3L5IA 4Z8FL 1T1XA 3WN5B 1XCQA 2UYLB 3OJ2C 4O4YH 5CEYB 1DVXA 4MXQD 3ZBMA 3SE3C 5JZ7D 4E36A 4KWUA 2X2UA 1VHPA 4Y4HB 2WIIB 1H3UA 1U2HA 3Q3GB 4IRZH 4F27A 3IJSB 3UAJC 2FEEL 5HDQL 1YEJL 4PREB 1NDGA 3WTYA 4X0KA 2GTZA 3IU4H 4BH7B 4AT6B 4LARH 1MQKL 4AKQA 5JA9A 1U2CA 5JNYB 4YHLH 4PJDF 2KI6A 1QRNB 4XPTH 4E9QA 5HYJE 4JDZA 1S9WB 5BRZD 5D8JH 2OLDA 3MRBB 4JFPB 4H88L 1QSEA 1A6ZA 3ECVA 1MFCL 3G6AA 2JKWA 4AV4A 3S34L 5CEZE 1P84K 3ORJA 3QEUA 2QADC 4EDWL 1RVFH 1XIWC 2OMNA 3OPZL 3ZLQC 4F92B 3D87B 3N44B 3UZQA 3GSOB 3PL6C 1S3RA 4PI0A 2M1KA 3MUJA 4PGDB 4RX4A 4JKMA 2OFQA 4RVBA 4Z3FA 2FIKB 3KDMB 4KXDA 1XQ4A 2V2WA 3G6DL 4DSYA 4Z7NF 4KJWC 4BD4A 4OLWL 5I9QB 2WINA 1T89C 1KBPA 3EJQA 2GSGA 3PXHA 4XMWA 2O5XL 3REWB 4X8JA 1FZMA 4I9XA 3ETSA 4DPAX 2V2TB 2GJPA 5JUEL 2WCGA 5FCUL 4GKSB 1AKJB 2PP7A 2OYPA 4BKTC 2BJMH 5DI8A 5D4IA 1TCRA 4TULL 3RPIB 3GSWA 3EDDA 2IG2H 4ZFZA 3F83A 3D2UB 1UFGA 2V2XA 3V79C 2VO5A 5GJSH 3MLXL 4KZDH 5D7KE 3WFEL 1NGWB 1JZIA 4K8RD 3EKCA 1FYTA 1KJVA 2VMDA 3IFNH 4X7TB 4BFNA 5KSAC 3I6LD 4EZKA 3P30H 4XPAL 1ZVNA 3MQIA 1U3HD 1HKFA 5FF6B 3UMTA 3AXLB 5CZXD 4LSRL 5DSCB 1W16A 4LF3A 4P9MH 2AQNA 4AIXA 1HU8A 4IM8A 1ZV5A 4JHZA 1R47A 1T3FA 3GB7B 4XH2A 1JOIA 4N2OA 4ELME 1A6WH 2X53A 1FV1A 1L0QA 3K2UL 4QO1A 2CJTA 1A22B 3RGVD 4NWUH 1T4WA 4AUJA 3VH8B 5DQJB 5B39G 1QNZL 4G6KL 1CI5A 4PN6A 2ZKYA 3BQUB 1QACA 4PJDE 1J8HD 4HIHB 4L1LA 4UT9A 4PJ5D 3HOGA 2EDFA 2Q3ZA 3O0LA 1CIUA 2CCLA 4MS8C 4XWOD 3VFSB 1A7QH 5DHVA 2WKOF 4U1MA 1RXLA 5J4MA 1HJBC 3LMJL 3TFKD 3LRHA 5IJCC 1BQKA 5GIRA 4NQXB 2KDYA 1S4IA 4PS7A 4KROB 5ESVB 4GRLA 1F58H 1G7QB 3ZQ9A 3U2IA 1IX2A 1BQLH 5KYYA 5BVJA 3H0TA 1EZSA 4Z7QF 3JV4B 4J7RA 4L8CB 3IU4L 2WGXA 4OUOA 4PB0L 2BIMA 3KEDA 5KVGH 3WI9A 4I5BB 3U6RA 5FM8A 1QTYT 2OMWB 5AAWA 1UB5B 3VTAA 5LLIC 4OT1L 3JTBA 5C0DB 5IROD 1BXVA