1SXJB

Crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
316
structure length
316
Chain Sequence
b'LQLPWVEKYRPQVLSDIVGNKETIDRLQQIAKDGNMPHMIISGMPGIGKTTSVHCLAHELLGRSYADGVLELNASDDRGIDVVRNQIKHFAQKKLHLPPGKHKIVILDEADSMTAGAQQALRRTMELYSNSTRFAFACNQSNKIIEPLQSQCAILRYSKLSDEDVLKRLLQIIKLEDVKYTNDGLEAIIFTAEGDMRQAINNLQSTVAGHGLVNADNVFKIVDSPHPLIVKKMLLASNLEDSIQILRTDLWKKGYSSIDIVTTSFRVTKNLAQVKESVRLEMIKEIGLTHMRILEGVGTYLQLASMLAKIHKLNNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activator 1 95 kDa subunit
molecule tags Replication
source organism Saccharomyces cerevisiae
publication title Structural analysis of a eukaryotic sliding DNA clamp-clamp loader complex.
pubmed doi rcsb
total genus 110
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00004 AAA ATPase family associated with various cellular activities (AAA)
B PF08542 Rep_fac_C Replication factor C C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1sxjB02
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 1sxjB03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1sxjB01
1GFIA 2CE2X 1OXVA 2VHUA 2P6NA 4LHZA 1R0WA 4MKHA 1KO4A 1CJMA 1HA3A 1KZGB 2GJ8A 3GMTA 5EE9A 1XTKA 3I72A 1YZKA 3SN6A 4KFRA 1ZM4A 2CCGA 2BJVA 2WKPA 3SJAA 4B3GA 2JIZA 1NVWQ 1U8ZA 1DTSA 2GVZC 2QE7D 4FMCB 4G1UC 4Z54A 1F3OA 4URXR 2PH1A 3BBPA 4BFSA 3ZDQA 5EP4A 2JLQA 2OCBA 1HV8A 1SVMA 3FWYA 5BW8A 2EWVA 4JLKA 5C4GB 3TE6A 1Z63A 4JYCA 3OHMA 2CDNA 2AFHE 1R0ZA 2GJSA 2EVWX 3KXIA 1RYFA 4BFTA 1L4YA 1PVOA 2F1HA 4TLEA 3ECCA 4RZUA 821PA 1WMSA 3B85A 2PBRA 1LF0A 1KDTA 1NLYA 1GWNA 2BM0A 2FWRA 4M1TA 1KNQA 1QHIA 1ZUIA 5CITA 2YV5A 4QNMA 5K8LA 4PQYA 4URVR 3OEHA 1F2TA 1N6KA 1YZNA 2KWIA 1NIPA 3ZYCA 3SQXA 1VCOA 3PUWA 2WAYA 4NHOA 3GLGA 5SZJA 2GESA 1LF5A 2BC9A 3A1TA 1I4DD 5L3QA 2WAXA 3PFIA 3EA5A 4LC0A 4UJ3A 1R5NA 3QKRB 3MWKA 1OV4A 4GFDA 1W4BA 1E9FA 3WMGA 2WVJA 3L8ZA 2CCKA 2C03A 1E2PA 2FH5B 4ESHA 3BGEA 2G9NA 2FG5A 3L0SA 2WMOB 4HAXA 5C18A 3C15C 1OIVA 4OHYA 3OFND 4JBXA 4RFSA 1IN7A 1U0LA 2IL1A 2JJ2A 1AZSC 3CNLA 3EW9A 4OHVA 4A4DA 4XIGS 3A37A 2F43A 5TARA 3GP8A 2IS6A 2QI9C 3UWOA 3LW7A 4CEIB 3WNBA 3P26A 3VR6A 4JBWA 5DHFA 4V0KA 2AXPA 4QBGB 3QEJA 4LYAA 3LH5A 4MITA 3VTKA 1FNMA 3N70A 4DJTA 3QKUA 4QC2A 4XD7D 4IDQA 2MMGA 3SR0A 4DRZA 3AUYA 3WHLA 4IOKA 4IOMA 1FP7A 1EXMA 4I1UA 3LY5A 1TUEA 3C16C 2BV3A 4MKGA 1UADA 3D3QA 4LRWA 4DXAA 4BFVA 1EG7A 5TDHA 5B2ZA 5DE3A 5DO9A 3C8UA 4QGGA 2OXRA 1G18A 5G41A 1P9NA 2OLKA 4LOAA 3O47A 1AKYA 1G17A 4PAOA 5FBQB 2QSYA 1T5LA 4PPFA 4BPBA 4LJ4A 1RW4A 1ANKA 3THXB 1VECA 1D9XA 1E69A 5CLLA 2O8FA 1NI3A 2WWFA 1Q1ZA 4TZ6A 1CP2A 2YOGA 1E1QA 3MWYW 4MRVA 3N2IA 1G8FA 2RH5A 3T15A 2VIIA 1Z29A 2RHMA 4CIDA 4AKGA 4ZKDA 4PQFA 4OQMA 3CX6A 1GG2A 1IXSB 4EPVA 2PEZA 1EFUA 2EFEB 2JASA 2XAUA 4HZIA 2YWHA 4DEYA 2OHFA 3PQCA 2ONJA 1JNYA 4RCYA 1PV4A 1LV7A 5JJKA 2IS2A 2FSHA 1Z22A 2GETA 4MKIA 2FGJA 2IYQA 3DL0A 1GM5A 2H18A 3NXSA 5BYJA 1G5TA 3RS7A 3UK6A 4Q5IA 4LHVA 3CTDA 5FOSA 4C0LA 4JN6A 1E32A 4XVQA 4Z8XA 5A5GA 5DSZA 3PVSA 2I4IA 2QP3A 4JLOA 1FMJA 1YVDA 1CU1A 2CLSA 3GLIA 1KMQA 3I73A 3K0FB 4M2LA 3EPKA 1Q3TA 3BWDD 2BKUA 3KJHA 3I8XA 4Q9LA 3DM9B 3DEFA 3GPLA 1N5LA 2JAQA 4N0DA 4BRUA 3GLFA 2GHIA 3QPUA 1Z0FA 2VTKA 1X8LA 4AYTA 2G1JA 4ARZA 3VKGA 3AUXA 3FMOB 1ZUHA 3D31A 4A6XA 2VSOA 3BIFA 3U44A 4FW9A 3GLFE 5GADl 3B2EA 3QVUA 1CRQA 3FMPB 2VSFA 3LRPA 1KI9A 3EPLA 3DOFA 3EZ2A 1M1YE 2EW1A 2QPOA 1Q44A 5D3MA 3RAPR 4ZKEA 3C5CA 1G7CA 1PJRA 3GCGA 3P32A 4KXFB 4WAUA 1Z5ZA 2YWGA 2H8KA 4ERNA 3PENA 1HY3A 1XTIA 2WHXA 4NCJA 1VG0B 1VCIA 1NL3A 1W4CA 1Z6XA 3F3YA 5H70A 3E2IA 2A2ZA 1YZUA 2V8OA 3CRRA 4J0QA 1JJVA 4AY2A 2R6GA 1FFHA 1N25A 2JJ1A 4Q21A 2L0XA 4ZO4A 2GJKA 4R7ZA 2WSMA 4ILEA 1R0YA 5AUNB 1VHTA 2PT5A 3G0HA 1EESA 4UQOA 3I1FA 5HE8A 2AK3A 5HTKA 1QHHB 3WYAA 3NBXX 1KO1A 4EJSA 2GXSA 4GP6A 1R6BX 4PO1A 4IOLA 2O8DB 1GAJA 1BOFA 4M1OA 5DNYB 1WDTA 2GK6A 5DHAA 4DLZA 1CTQA 3ZIAD 5JFGA 1GITA 3IHLA 2ZU6A 2FSGA 4V0NA 3BH6A 4B74A 1UEIA 2F9LA 1UAAA 3LNCA 4LRSA 1JEDA 1W4AA 4HAWA 1ETUA 1MO6A 2H16A 1VTKA 2K5UA 3ETLA 2IXGA 1ESNA 4FIDA 5CM8B 1US8A 4F91B 2X77A 2BMFA 2FU5C 1P75A 1PUJA 1MOZA 2G1KA 3D7MA 4DT1A 5FTKA 4Q1FA 3GJ8A 2H92A 4A9AA 1VG1A 2OEPA 5LB2A 2IXEA 2ZJZA 2EFHB 3T34A 4B75A 3M6AA 3FTQA 4DB4A 2DR3A 2IYTA 4NMMA 3ZZTA 2ZS8A 3B7GA 2R65A 4A82A 5FOWA 4D26A 2CJWB 3BB3A 1G9XA 4URWR 4GOXA 1F60A 2GCOB 3B1WA 4UNNA 1T8TA 1U99A 2YVUA 4QGHA 1NKSA 3CF0A 2IBMA 1TADA 1KSFX 2XTZA 4JL6A 4RD1A 1X8KA 3EX7C 2DY1A 1OYYA 2NTYC 4A0FA 2PMKA 4ZI2A 4B2PA 1N6HA 2OE2A 3EWAA 4RKFA 2WICA 3BFVA 2H17A 2C04A 2OBMA 3EIEA 3PXGA 4IDNA 1JAIA 5FBVB 2ZROA 1W2GA 4X8HA 4XWKA 4TWZA 4LBWA 1P2VA 2ZREA 4E5UA 5J4KA 3LWNA 2KBFA 4GNKA 3WNDA 4KFUA 1ZYUA 5JWOA 4L9SA 1P73A 2P2LA 3JZMA 2J45A 3GJXC 1E0JA 2IXFA 3NTUA 3PITA 4G5GA 1W48A 1X6VA 4YLGA 2JDID 2HXSA 2QPTA 4HYYA 5EE5B 1KK3A 1ZCAA 1OB2A 4AYXA 1XMJA 1E2QA 4JKYA 2YINC 3T5DA 3KQKA 4DLTA 1E1QD 4LRTA 1R7RA 4OQFA 4ACAA 3AP1A 1AN0A 1S3GA 2Z5FA 3H86A 2J41A 4NCIA 4B32A 1GZSA 1ZD9A 1J2JA 3RRMA 3BFXA 4G5RA 4JLPA 1FL9A 5LB4A 1S3SA 1CS4C 1S0UA 4TYQA 2NG1A 2Q6TA 2ZEJA 4Q1BA 2IYSA 2W00A 2ZQ5A 3RWOA 3P4XA 2JLYA 1XMVA 1YHNA 1Y63A 4YQFA 1KKLA 4ZCMA 1E3MA 1EK0A 3JVVA 4DSNA 5JSZB 3Q85A 5CLQA 2BM1A 4TLBA 4B44A 2O0HA 5KSYA 4DLRA 2ZSAA 3SYNA 1IN4A 4A2PA 1M6NA 4KODA 1PLJA 1GRQA 1S4QA 4JT2A 1NMXA 5K8IA 1RRCA 4NYIR 3M4YA 4MRPA 2RKOA 1VDZA 2KB0A 5JI2E 621PA 3AKCA 4GOKA 3U7EB 2V7QA 4F7WA 2NQ2C 1RFLA 3NC1C 2ZRGA 1LS6A 1QDEA 2VHQA 4Q7MB 4MDEA 3ND9A 5CK5A 1MKYA 1UKEA 4TT3D 1VHLA 3T61A 1S8FA 2G0NA 3IQXA 4QHTA 1XBTA 3AVQA 5HKKA 1NF3A 2IHBA 4HAYA 5P21A 2QAGA 3BJIC 2X2FA 3GJ0A 2RGEA 2XSZA 2W6JA 1Z0KA 4DLXA 1E2LA 1NVUQ 4XVUA 2GEVA 1GSIA 4HB4A 3RANA 1AZTA 4ZCLA 4ZV4A 1LS1A 4LI0A 1DEKA 5GVSA 4FWDA 3BORA 3HR7A 4NONA 1W0JA 1MO3A 1CLUA 1ZIOA 2R62A 1KDRA 3QE0A 3E1SA 5LD2B 2O8BA 1D5CA 1MRSA 1EX7A 1KI2A 2F1RA 4OL0A 4TMXA 1CRPA 3QEOA 4BASA 1X1SA 1QHGA 1E2EA 4WXRA 2O8EA 5EUMA 8OHMA 2GF9A 3R9IA 3FDIA 4D0LB 5DI9A 4EAQA 1LY1A 2IYLD 4HAVA 4HLQB 2FSFA 5IK2A 1Z0IA 3RRZA 1M8PA 2PJRA 1W0KD 4RD2A 3VLFB 2IWRA 3TAHA 4HUTA 3SYLA 5H8WA 3SFVA 5FBRB 3TSWA 2MSDB 3KB2A 5FBLB 3A4LA 1KJZA 1N6NA 2GF0A 2GXUA 2KE5A 4DDTA 4R2HA 3Q72A 5SZKB 3EA0A 2HJGA 2Z43A 1II8B 5FOXA 4D4LA 2F7SA 1EWRA 3VNVA 2CCJA 5FR1A 1FUKA 5CIQA 1G7RA 5TV2A 4V0MA 3THYA 2D4HA 2QMUA 1OSNA 1XFAA 1AK2A 5AJVB 2OCYC 3V4RA 2ZJ8A 3PUVA 1G3IA 2ZE7A 1IBRA 1G8HA 1G6OA 2PCLA 4JLDA 4DSTA 2CEAA 5EQTA 1KIMA 1I2MA 2FZ4A 3HR8A 3RRYA 1KSHA 2Z4SA 2VYFA 4NYJR 1E6CA 1KK1A 3DO6A 3NDPA 3AKEA 2ZJ5A 4EDHA 1VCMA 1ZM2A 2BCJQ 5KO2A 3R9XA 2PL3A 3CX7A 3IKJA 3TR0A 2WJJA 4GZMA 2ZI7A 5JRZA 3TR5A 2IHYA 1XDBA 4KLNA 3KX2A 4ZIRB 3B13B 3K8YA 3FHOA 1E2JA 2OLJA 5KPDA 2R44A 3HU3A 4JSTA 2ZI5A 1C1YA 3CH4B 4RVCA 4B47A 3KKOA 4CZ2A 1P2TA 1Z2AA 2GZAA 1KDPA 4KHZA 4P4SA 4MUBA 4TT3A 1KDOA 1KYIA 4AKEA 5FL3A 2GWHA 5JCZA 3TVDA 1NVVR 2EYQA 3VX4A 3EPJA 4P0TA 221PA 5JMTA 5LBIA 5HR5A 3TJZA 4XVRA 1E9AA 3B60A 1J70A 1KMHB 3BK7A 1OXXK 3FFBA 4LK2A 4Y0VA 1ZNWA 2P0EA 2EFGA 3W3ZB 2MSEB 3KB1A 1P7CA 3IILA 2OFWA 3PEUA 3QKTA 2QENA 1WP9A 5BWMA 4RZ2A 1CJTC 3CRW1 3QNUA 4LHYA 1AJEA 4PR0A 3WRYC 5TXGA 2DWQA 3A1WA 4CYMA 4DUGA 1VYUA 2ODNA 5E7IA 1I2DA 2IYRA 3B82A 2F6RA 5BN4A 2DWOA 5CB8A 4M9ZA 4OQNA 4IEEA 2C98A 1G6HA 4Q1CA 2DZNB 4PC3A 1JB1A 1NMZA 5EP3A 3Q9LA 3WHKA 2VH5R 3SS8A 3U4QB 1L4UA 3TUIC 2B7CA 3J81k 1KO5A 5GJBA 4L8GA 4E03A 4DDWA 3O8RA 1XD9A 2RGAA 1RZ3A 2ZRDA 3QXCA 4TL8A 4G3XA 1S9HA 3NBZC 4IVPA 1MO5A 3CF2A 4D82A 4E09A 2REXB 1F2UB 4NE2A 4DCSA 3K70D 4BLSA 2IYYA 1XF9A 4WXPA 2DWZB 2OT3B 1T0HB 3U3JA 1OIWA 2XX3A 4NKRA 5J4VA 4G5OA 5HCNA 3AVYA 2EFDB 4JVMA 4H1VA 4BZXA 1M74A 3K0CC 4F4JA 3SEAA 4Y0AA 3AQ4A 2UZ3A 2CBZA 2V1XA 2O5VA 1MH1A 2ZRBA 4M1SA 4BLTA 2I1QA 2Q21A 2AWOA 1COWA 1UBGA 2XNDA 3K1JA 3GLIE 1LB1B 3FHCB 2HCBA 1M7HA 5FOTA 2GZHA 3KQLA 3GFOA 1T5IA 3RS4A 3IIKA 4PPNA 1KJWA 2OILA 1NJGA 4BLRA 1E9BA 1W0KA 2QAGC 3VKHA 2JIZD 4RY2A 2FDCA 3MRSA 4OHXA 4IDPA 4U7DA 2FMXA 2XB4A 2CLDX 1JR6A 3K70C 5EP1A 3C5HA 2P5TB 3HU2A 1DAFA 2ZUCA 1A1VA 2IYUA 2R8RA 5JI3E 4JLBA 5FTNA 1UBCA 2NIPA 4BFWA 3LX8A 3ZVLA 5DYGA 3RDPA 2PJZA 2Q9BA 2NPFA 5EP2A 4V0OA 2QU8A 1WB9A 2YC2C 3S1AA 4AKIA 5AK0A 4A3VB 1T91A 3RWMB 3FKSD 3AVUA 4DCVA 2D2EA 2XJ9A 1LW7A 2JCSA 4F92B 2ZJAA 3FPAA 3UPUA 2VF7A 2ZR0A 5DN6A 1RIFA 1SKYB 2R9VA 3QVVA 3REGA 1G4AE 2JGNA 2ZRKA 1M2OB 4TMWA 4XOIA 5CJ2A 3Q7PA 1COWD 5TMPA 4MYUA 1TNDA 1IONA 1E4VA 4URUR 3FMFA 3P27A 3U7HB 1R8SA 3DKPA 5KYKA 4EJSC 2CE7A 2CMKA 3TUJC 2BDTA 1AA9A 1XTJA 2AK2A 1ZRHA 4DBLC 4PSKA 4A8JC 3ZD7A 2RGXA 3BS4A 4A36A 1U9IA 3B9QA 4OKSA 1KMHA 1W5TA 1R5BA 4YMSA 1XEWY 4JVLA 1C4OA 4YMTA 1ELOA 3SFZA 1SVKA 4IXMA 2CVHA 2VHJA 3LQQA 5IF9A 4R9UC 2IW3A 1NBMD 3ADKA 2HYIC 1IN8A 1IJFA 1JXOA 1IY0A 3WRXC 5KUTA 3CPEA 1NG9A 4QHSA 3TKLA 2FFQA 3EIHA 1UF9A 1NG1A 4E07A 2QRZA 1N5JA 4ACBA 2ZI6A 4EQ6A 1DAEA 1W5SA 3RNLA 2VP0A 1OH7A 1F48A 1B0UA 3U2QA 4R71A 4D25A 2ZSDA 3AVOA 3T1VA 1QZXA 2WJIA 4NCKA 2W83A 2KJQA 4L16A 3KFXA 3CNNA 4LJ6A 4BZQA 4P4TA 1UPTA 2AN9A 3EARA 1E9RA 1E0KA 1JPNA 4O2RA 2GVDC 3A58B 1FPMA 4HSEA 1GILA 4HI0E 4TZ0A 2WJGA 4AG6A 2DZOB 4RCZA 2DBYA 3NIBA 3SOPA 3BXZA 1II0A 1U0JA 1Z2CA 3U3KA 4US0R 2W0MA 2GXQA 3AKYA 4P3YA 1OJLA 4C0SA 4Q66C 4WIAA 4O3MA 4OYHA 2P67A 5H68A 1II8A 2JA1A 1DAHA 2CNWD 3AVVA 3VFDA 1C1KA 4GSYA 1DAKA 4RJLA 4MYCA 1G3MA 5B64A 4XJXA 4P32A 2CHVA 1US8B 4N0EA 5A4JA 4HLUC 1MT0A 3KFVA 4QKQA 2JJ1D 3O8DA 2AXNA 2ZS7A 3NBYC 3BE4A 3T35A 2YWFA 2N46A 1N5KA 4Q7JB 3MCAA 1QRAA 4G5SA 2F3TA 3HP1A 3P20A 2PMDA 2UVQA 1YU9A 4TMVA 2W0SA 1XEWX 1UDWA 2QT0A 4FXPA 4JKIA 1ZNXA 4KVGA 2O8DA 1TPZA 4NDZA 1Z6AA 3AEZA 4NYMR 3K9GA 5FUVA 1SXJD 3PV0A 4G5QA 3CB4A 3ZZUA 2D74A 4D6PA 1OYWA 3VR4A 2OFOA 3L0IB 4Q9JA 2QTHA 5J47A 1JALA 2W2TA 4BEBA 4A0HA 4AC9A 2O52A 1QVRA 2ZITA 4HATA 4EPTA 3VNUA 2Z0MA 3U7GA 5HE9A 4DC9A 3K9LA 4ABYA 4PC6A 4C7OA 1R8QA 1KI3A 4GMXA 5SZHB 3SHFA 1OPXA 5HZKA 2IT1A 3CWZA 4PPQA 3GLHA 2ZRMA 2HV8A 1PLLA 5KHOC 3HYRA 1FOEB 2XB2A 3WYGA 4RD4A 4QM7A 1MV5A 1HURA 2ZRJA 3ZH9B 3MSXA 3ADDA 2ZRNA 1XPUA 3W8RA 1O87A 1UEJA 4NYIQ 3AGQA 3VHLB 5J4YA 2IEYA 3GLFB 4MDFA 1Z06A 3KKQA 4LPKA 1F6BA 1R0XA 1ZP6A 2FPLA 3HPRA 4XWAA 3DDCA 4YMWA 3Q3JB 2A5GA 2P5SA 4US1R 1E1RD 1ZC4A 4FD2A 1IY2A 4WBSA 4DZZA 1L7VC 1OFUX 4Q03A 3K0FA 2D62A 3KUDA 4D4MA 3VMFA 2ZM5A 1TF2A 3IBGA 2QORA 4M8NE 2HT1A 1QHNA 4HB0A 2WJVA 1GP2A 2DYKA 3K09C 4RKEA 1TTTA 3AM1A 2C9YA 4FINA 1UFQA 4LHXA 3LVRE 4ON9A 3SE0A 2FF7A 1FP6A 1CR1A 1OXSC 3SI7A 5K8TA 1XPOA 1L2TA 1KAOA 2OAQ1 2GEDA 4OQXA 5CDFE 3W34A 3CZQA 1OFTA 3QBTA 2FNAA 4FMDB 2ONKA 5FPSA 1JJ7A 2DWPA 5JEEA 4PQRA 2CK3D 3CUEF 2J5XA 4Z8YA 4PO8A 1J90A 2AD1A 3PIRA 3GJ4A 2HT6A 3KKNA 3LVQE 2R6DA 2DFTA 4WZAE 5G3YA 4YMVA 2PZGA 2QSZA 2ZRPA 1G5RA 2R6CA 2QN6A 3NKVA 1W49A 5AUQA 3WYFA 2J7KA 1JEEA 2CHQA 5J5CA 2V7QD 3BOSA 4RSGA 4DCTA 4U00A 1XMIA 2NZJA 2V55B 4QOSA 4U02A 3S1AB 2Z6VA 4RFVA 1N3BA 2WIAA 1E2NA 2H57A 2DHRA 1P2SA 2Y8EA 1M7BA 2ZRHA 1CXZA 1ZU4A 3OAAD 2ZRCA 2DFNA 3UIEA 4AD8A 5TY0A 4DLWA 1FZQA 3RHFA 2QTFA 4OBEA 3UATA 1CJUC 2QROA 4IDOA 3REFA 5AR1A 2WWHA 5KTYA 3BERA 5JZVA 1QBKC 2Q3FA 4UXHA 2ERYA 4M9QA 1H8HD 4JT4A 2OCPA 3X2SA 4YXWD 4GMDA 4DHEA 2CJWA 1CEEA 1KKMA 4DB2A 2YOHA 3GLHB 4Q47A 1X37A 2DCUA 1ZM9A 1G21E 1G3QA 2Q3MA 2GTPA 1DAGA 5FOVA 4N3NA 4C7OB 2D3WA 1Q1EA 2NO7A 1Z8FA 2PLFA 1U0HC 1NRJB 4C0AC 1Z6TA 4XTCS 4BLPA 4HB3A 3EC2A 5JS8A 4NH0A 2WWYA 4DIDA 3DMDA 3QJYA 5M04A 5IK2D 3AVXA 4O0MA 2ZE5A 5AJZA 1H8HA 3B6EA 1F2UA 5KU1A 3NBFA 3AJIB 2QGNA 4F4CA 2ZSFA 2H5EA 4TQAA 1IXZA 1JR3A 5L3QB 2IYWA 3AF2A 4ZDIA 2A78A 1R5OA 2ZRLA 1HT1E 5BYKA 4C2UA 4NYMQ 1HTWA 3RLFA 3CPJB 4P4UA 3ZD6A 1NN0A 5HPYB 3A1UA 4LC1A 4D80A 1QHHA 3EG5A 1RRGA 2RGNA 4NZYA 3I3SR 1NY6A 4WOPA 5GJVC 1RVDA 1PUIA 3U4QA 4TSFD 1N0WA 4A0RA 4NBSA 3KQHA 3AKDA 1QF9A 2A5DA 2KRKA 3MJRA 3LBIA 4LYHA 4CGZA 4F93B 3R9WA 2R9GA 3EZ9A 3WMFA 4X8LA 1YZLA 2N1BA 1H8EA 4GITA 1KI4A 5CYPA 2P6UA 4D81A 2WPDD 3AF1A 5DH9A 2J7PD 4P33A 4EFNA 3L0PA 3IPXA 5E7MA 2XOKA 3TQFA 2JJ2D 2JATA 5JJLA 1ODFA 4M1WA 5D3MB 1W36B 4OK6A 2HEIA 4OI0A 2CL7X 1Q0UA 3UMRA 3QQ5A 3HWSA 2CK3A 1LTQA 3UWKA 3LV8A 1GKIA 1SKQA 1W0JD 1ESMA 2HLDD 4XH9B 2GNOA 1PZNA 3U44B 2HXYA 1K8RA 2P3SA 3ND8A 1QZMA 4LDJA 4IJMA 4QBHA 1WBBA 4ARZB 4JIMA 2ZSEA 3OE7A 5FTJA 4YDHB 1XCMA 4KYUA 3CRQA 5C4MA 3M1IA 2VEDA 4EQ6B 2C78A 1XZQA 2WZQA 3GLGE 3EWSA 3O8BA 2GZDA 5BQ5A 3BRWD 4WVFA 2NGRA 1AQYA 3MGCA 4M9XA 3GLIB 3R8FA 1EX6A 3RVBA 1W36C 1YRAA 2V6IA 2BHRA 3K53A 1IHUA 5FI1B 5KDLA 4BUJA 1G5PA 2F1JA 2YZ2A 4Q00A 3WBKA 5KSPA 2HJVA 4DLUA 4UNPA 3QI2A 3RS0A 1CBUA 4YC7A 3X1XA 2B21A 4ZIRA 5C2JB 3AVPA 2WBLC 2XTMA 2J1LA 2ZRFA 1A2KC 4A2WA 3QXJA 4M1YA 3AVWA 2GAOA 3TNFA 3IUYA 1XCGB 1IJEA 1J8YF 5E95A 1GKUB 3V4FA 2C8VA 4KAXA 3T1OA 1UKYA 3TQCA 3O8CA 5JHGB 1EGAA 1TEVA 2CVFA 2ZE6A 3EAQA 4JL8A 2XZPA 2B92A 3BAFA 2AFIE 2F3RA 4W5HA 4B3XA 1NIJA 5EZ5A 3KZ1E 4QM6A 1E2MA 2G83A 5DLQC 1WE2A 2N42A 3BH0A 2BOVA 3LLMA 1SHZA 4OK5A 1N6OA 4BEJA 4IKEA 3K9NA 3SJZA 3CRVA 3WNCA 1U98A 4TQUS 3SC3A 2RGGA 2CXXA 2R2AA 2A7QA 3IHWA 1E2KA 4KVAA 1WBDA 4XWOA 2PX3A 4XSHA 2Z83A 4Z51A 2G88A 3DM5A 1HT2E 5EXPA 1NN3A 5CYOA 1NVVQ 1CKEA 2DFLA 1K5GA 3CO5A 4II7A 4DLSA 3LXRA 1DG1G 1G8PA 3X1WA 1OB5A 4UXIA 3W8NA 2O8EB 3BGWA 5E7JA 3U3OA 2W6JD 3MAAC 2JLXA 2X8AA 1E2FA 1M34E 1ZM7A 4WW0A 4WA7A 5CJPA 1YE8A 1X1RA 4LJ8A 1U9IC 3PUYA 1DBSA 3RS2A 1Y3AA 1NLZA 3ASZA 4UNRA 1SKYE 4YMUA 5A0FA 2CHGA 2A3RA 1Z83A 4TL6A 3OEED 2WM9B 5L3VA 4IDHA 4AURA 4M53A 3SZRA 2QAGB 3EC1A 2PZFA 4TTRA 4C0HA 3HYTA 2F43B 1G291 1XX6A 4PC1A 1Q3HA 2FFAA 2FSIA 4QJ4A 2VA8A 1UKZA 5KNBA 2BWJA 2C9CA 1NBME 4LYFA 5JHHB 2WKRA 2TMKA 4JSYA 4QHYA 3RSOA 4C0KA 4MGYR 1S1MA 1ZBDA 4TSFA 2BBWA 1KAGA 1X8JA 3UG7A 2Q0HA 2VLIA 1J7KA 4M9SA 4DLYA 3A6PC 1GDDA 3BD9A 5FL7D 4A15A 1GL7A 3GFPA 1DPFA 5JJIA 3AF4A 4WZ6A 1Z3IX 4ZPXA 4HDCA 3MWLA 1AS3A 4IVRA 2GJAA 2BIFA 1OHHD 3ZVRA 3T1QA 1SGWA 4FMCF 2IUUA 3AP3A 4ASUD 4B34A 1F2TB 2QZ4A 2G3YA 3KKMA 2A5YB 5FFMA 2WWWA 4LCBA 1XXHE 1TAGA 1V5WA 4EUNA 4V02A 3OIYA 4NYJQ 1NKTA 3CZPA 5JWHA 5JSZA 4QRHA 2QMHA 3PG5A 4MGKR 1TL7C 4MA4A 4LJ9A 3B1ZA 3LQRA 1T3HA 5JLJA 2QM7A 2NZ8A 2ATVA 5FPHA 1UDXA 2FOLA 3CW2A 5DI3A 2EWWA 1OH6A 1GKYA 4ZDWA 4IFEA 2HUPA 4Q19A 2JJ8A 4R98A 1ZC3A 3C41J 3KTAA 3CNOA 3IEUA 3LAWA 4YONB 2J87A 1WF3A 4B35A 4UNSA 5E3HA 2VBCA 3ZQJA 1Z6GA 3DOEA 2IYVA 5FL7A 1HH4A 1H8ED 3MMPA 1G3RA 1OE0A 1IXRC 4FWGA 2BEKA 2NO9A 3TIFA 2D06A 4DUGD 1BH2A 3RC3A 5G3ZA 2PEYA 2GJ9A 4FCWA 4IOJA 4Q9IA 1ZMXA 1JPJA 2X19A 4FI3C 4B2IA 4BFZA 2X2EA 1SXJE 3GJ3A 5TVKA 3K0CA 5KNCA 3R7WB 4P4SB 2J9RA 6Q21A 3CLVA 3ZIAA 3W6OA 4DIEA 2ZAMA 1K6MA 1LFDB 5AJWA 1EFHA 5KDOA 3L82B 4B43A 5SZIA 3D6TB 1GUAA 4Z1MA 1ZIPA 2XXAB 2J3EA 2ATXA 1VKJA 1YZTA 3A4MA 1QHSA 4DWJA 5KSZA 3RRNA 4C0BA 4RD6A 2IUSA 4Q1EA 1DO0A 1E79A 5DYIA 3FHTA 2ORVA 1SQ5A 3B5JA 4NPHA 2GCOA 3C7KA 1KI1A 3L8YA 4ESVA 3CBQA 1A5TA 4GT1A 1AM4D 2J0SA 4TL7A 3FOZA 3WY9A 3THYB 2HCJB 4LV8B 4PTLA 3V00A 4OI4A 4NU0A 3QPWA 4JLVA 2R6AA 3Q5DA 2EQBA 1R2QA 4JJKA 3I8SA 4G01B 4DT1B 4B48A 2XZLA 1IY1A 4B2LA 3U61B 2FEMA 4CRWB 3R20A 2GK7A 2ODBA 4AYWA 1SVIA 1U2RA 1JQLB 3H4MA 4KBGA 4MRNA 3LXXA 5E4FA 4BFYA 1P2UA 2W6ID 5GVRA 5IT5A 4CEHA 4BLOA 3K0EA 1W1WA 2WSSA 2RGCA 4W5WA 4KSCA 3NC0C 1II9A 1ZJ6A 3IDQA 2G0TA 1WQ1R 2NPIA 3PEWA 2JLUA 3OE7D 2IA5A 2KBEA 3ADBA 1IN5A 2Q9AA 1KI8A 2FZLA 2YHSA 2YJTD 4MQBA 2ASEA 3AGPA 1R4AA 1LVGA 1GNQA 1PLKA 4CEJA 2C5LA 3B8HA 4Q1AA 2O8BB 1U94A 1I4TD 4QXAA 3OZXA 1JQJC 1RPZA 1MO4A 1OLOA 5FOUA 1D6JA 2QMOA 3JZAA 3AP2A 3L2OB 1N5IA 2ZXUA 1P61B 3KJGA 1KI7A 3GLHE 3OEEA 3DMNA 4OHZA 2PCJA 4TMKA 1JR3D 1UBEA 1OXTA 3IIJA 4KU4A 1R10A 4IFBA 4AI6A 1S9DA 3IPYA 1XMSA 3KXKA 3DZ8A 3QY0A 2XNSA 4MRSA 2ZANA 3SHWA 2ODEA 3U6KA 3M0EA 3CH5A 3N5CA 4C3ZA 1W7AA 5J4LA 3KXLA 4HB2A 4Q9KA 5CM9C 2F1IA 3U3MA 1T3SA 2BVNA 1DADA 2UKDA 5EE0A 3GJ5A 2AHOA 1K5DA 4W7SA 4TTQA 3KW6A 1SULA 1YRBA 3X1DA 3TLXA 1ZD8A 3EPHA 1JAHA 1J99A 1VPLA 3VKWA 4BFXA 4Q01A 2WWXA 4V0LA 4DCNA 4JYBA 3EZ7A 4BFUA 1KO7A 1OW3B 2OFXA 4FCVA 1AS0A 3G5UA 4LPSA 4Q4AA 2ZTSA 4V0ME 2VF8A 4CT4B 4PXAA 1GL9B 2IK8A 2V4ZA 3QSYA 3VX3A 1MABB 4I1SA 1WA5A 5C46F 2O0KA 2I3BA 4B73A 5KDDA 4LX0A 3NH6A 1M7GA 5EE3A 2FE4A 1CJKC 4IEIA 4DLVA 5FPTA 2ZRAA 3ICEA 3MD0A 4PZZA 3HJNA 3FYHA 3UMFA 1XEFA 2VP5A 3U5ZB 2X1VA 3HPQA 3CIOA 1E98A 4LJ7A 3FFAA 5H1YA 2IX3A 3SQWA 3P4YA 1ONBA 3DZDA 4PHHA 5EXXA 2EFCB 1E4YA 4BGDA 2RGNC 1SXJC 5FPYA 4OK3A 2O8FB 1XU4A 3TUZC 1BKDR 1NLFA 3K70B 1G20E 1V43A 3BH7A 2ODWA 3KDSE 5DIFA 1HQCA 4TLCA 4KCGA 4LJYA 1EFTA 3DKVA 4A6PA 5DISB 4C2TA 1Q22A 2ZSBA 1P9WA 5FH9A 3I92A 3WP0A 2OV2A 1HE1C 1TU3A 2ZJBA 1ZD1A 5JBQA 1EFRD 1SHKA 4FMBB 1SVWA 4TYPA 2VHTA 4PAMA 1FX0A 4XSGA 4JS0A 1BMFD 1AGPA 3CR7A 3TW8B 2GA8A 2J0QA 2ZETA 1G7SA 2QM8A 2XZOA 2RB4A 1E9SA 2DFKB 2OESA 1NN5A 1P4SA 1AQUA 2RGBA 1BYUA 3GEHA 4CEIA 3FGNA 1GRRA 1P9RA 4MUAA 4I4LA 521PA 1KY2A 4B3DA 1ZCBA 4KFTA 3SNHA 4EPXA 2J0UB 5BXQC 4GRAA 1AGRA 4RFSB 1IOZA 2A5FA 1ZINA 3X1YA 1E2HA 2WOOA 1TU4A 4IVQA 2W2VA 4URZR 1KNXA 4W5JA 3NHAA 1IAQA 2FX3A 1NSFA 3TH5A 1N6RA 4KFSA 4QJ5A 4AWXA 1D2EA 4HAUA 3U6BA 3W6PA 3QKRA 4PX9A 1ZNYA 1DS6A 4MH0R 1E2DA 3HU1A 2AR7A 1OH8A 4PHFA 4BRWA 4HZUA 2IEZA 1CIPA 1EFRA 2ZR9A 1DAMA 2PZEA 1XEXA 4KI0A 1S96A 2VSXA 5LD2C 1YKSA 4EJSB 4PHGA 3MHVC 2SHKA 1RJ9A 3ASYA 2DB3A 2GBLA 2BKEA 3V9PA 3NDBB 1NVXQ 3QXSA 4JZKA 4ZDJA 2LKDA 1XB2A 1XP8A 3ONWA 2C2HA 3NG1A 1VG9B 1DARA 4LUCA 1P5ZB 4Q7KA 3CWQA 4QG7A 3PEVA 5KOYA 3WXMA 4A2QA 5UKDA 2XGJA 1FUUA 5CB6A 3K0SA 1XNJA 4MRRA 1E2IA 2IUTA 3T1TA 2GBLC 2NO6A 3QBVA 3JVUA 2WSSD 1P3JA 4BWYA 1VG8A 4DDUA 4KSBA 3T06B 1ZU5A 3U3RA 4AK9A 2B7BA 4D4KA 4QFMA 2DPXA 1BYIA 1Q1QA 2XOKD 3I4LA 4OQLA 5FPKA 1N2CE 1E1RA 1BO6A 1CF4A 1GTVA 3ZVNA 5IRCD 3B78A 4NCHA 2G77B 4NL4H 1T8UA 3RYTC 2NMVA 4A1FA 4QNRA 2WIBA 3EZ6A 4ITRC 4B71A 4Q18A 3T5GA 1JECA 2RGDA 3EASA 3B1VA 4GPTA 4L9WA 1AKEA 4RZ3A 4BLQA 4UNQA 1QHXA 4LGMA 5HKKD 4POAA 1VIYA 4ZI3A 4OI1A 4L15A 2FA9A 2HDNB 3GFTA 4F38A 1AIPA 4LJ5A 5TB5A 1DOAA 1XXHB 4NP6A 1E9EA 2J59A 1TMKA 1XTQA 3I61A 2C96A 4FN5A 2XEXA 2EYUA 2WV9A 2B8TA 1TF5A 2B8WA 5B57C 1VYVA 2FJUA 1G41A 4MGZR 1OKKD 1DAIA 1CULC 3PCRB 2MMCA 4LWZA 4K8OA 2FGKA 1KI6A 2GILA 3H84A 3QF7A 2BBTA 2E1RA 3AV0B 2ZAOA 1KO8A 1W4RA 5CIWA 4C0JA 1KSJA 4HLUA 4XD7A 1O3YA 4B6FA 3OIUA 1DO2A 2CL6X 1P62B 1XJ0A 1ZM3A 4LBVA 2A30A 5EE1A 2BMJA 4GI7A 3F5FA 4KV9A 1SVSA 4D4JA 4V03A 1XD2B 3MJHA 2WOJA 4JLAA 1RC8A 4D0GA 3IEVA 1FQKA 4D2IA 2JLRA 3EZFA 1HYQA 2V1UA 4YXWA 5FTMA 1HEIA 1D2NA 3IO3A 1IQPA 1TQ2A 1B23P 1S1CA 4JLJA 2H7VA 3UMSA 3WBJA 2IS4A 3KQNA 3ZS9A 3THXA 3BB1A 4OI2A 1I4LD 1JI0A 4P31A 2NO1A 2HYDA 2XJ4A 4G0NA 2ZYUX 5L3SB 5JRJA 5JS7A 2CL0X 1UJ2A 2ZRIA 4M4SA 3DPUA 3QKSB 2GKSA 4C4PA 1XCPA 1OH5A 1W47A 2G6BA 1P60A 421PA 1ZNZA 4IRUB 1TF7A 4M1KA 2FFBA 3THOA 4EFLA 3MFYA 1DG3A 3FKSA 5C1BA 1RYHA 4KJZA 4CDGA 2OZEA 2ORIA 5FI0B 3LLUA 2WWIA 1OHHA 5EUQB 1GNRA 4NCNA 4DSOA 3RC8A 4PSAA 5F9HA 3CONA 1OT3A 3AF3A 3KL4A 4JVNA 1CR2A 2J0UA 1U8AA 2ZUDA 2OO7A 3CKLA 2GAAA 4JLMA 4U5XA 1Q1BA 2ZJYA 4CVNA 2ZE8A 2ZYWX 1ZUNB 1A7JA 2QP4A 3PR1A 4EFMA 5G40A 1XWIA 3MWJA 1F5NA 3IO5A 2VRWA 1GIAA 1NP6A 1QG4A 2O8CA 1SVOA 4W9MC 1WRBA 3KJIA 3FVQA 4M1MA 4LZZA 4HLDA 4HAZA 1D2MA 1KOFA 1E94E 2ZPTX 3Q7QA 1FX0B 1GOTA 1TQ4A 3K09A 3CM0A 2QPAA 2ZJ2A 1YR8A 3FB4A 4QBIA 4B33A 3UXMA 2RHDA 3GJ6A 2AX4A 4KITB 4Q02A 4F4IA 4Q4JB 4BECA 2W2XA 4BZPA 3LO5A 4DCUA 1CR4A 1TUIA 4C30A 1JR3E 2JLSA 3KKPA 5LPNA 3GLGB 4TQ9A 4BE7B 3FE2A 3Q8XB 4K46A 3GEEA 2FEOA 2YYZA 2REOA 3W5IA 5L3SA 4KLZA 2QP9X 2CNWA 2GEUA 2IC5A 3OIVA 4I99A 4JMPA 1OF1A 1T9HA 2REBA 1DELA 2ZVPX 4MGIR 3SBDA 4NTZA 1GRNA 1Z0AA 4D0NA 2QT1A 4IXNA 1NMYA 3A1SA 3PJRA 1NVMA 2QAJA 4PANA 5AUPB 1OFHA 2V3CC 2FV8A 4PHTA 5F2EA 1Q12A 1Z0DA 3TAUA 4FCTA 3NWJA 1WXQA 3PUZA 1W44A 1XD2A 4QL3A 1IN6A 2C99A 2VO1A 5BN3A 4PZLA 4OJKA 3X1ZA 1FMLA 4JJZA 1P72A 3C4JA 2J0VA 1NN1A 2JDIA 2QMEA 4I1OA 1T0JB 1QVAA 1YJ5A 4RD3A 3ZGXA 3ZQ6A 4B3BA 1XTSA 3L0OA 1L8QA 2YOFA 2D7CA 3ZS8A 3KUCA 2GDJA 2B6HA 2DVWB 2QQEA 1KHTA 4RD0A 3IBYA 2FN4A 4EPYA 1CR0A 1BIFA 3TBKA 3VR3A 1X3SA 4OHWA 4CF7A 2KSQA 121PA 1Q21A 4PO9A 3VU9B 3A1VA 2OM2A 1XPRA 4JVSB 3U60B 5HCIA 1ZAKA 2YNMA 3ICQB 4HDOB 3QF4B 3SDZA 3RS3A 3KJEA 1HUQA 1A4RA 2JLZA 1RKBA 3QENA 4A8JA 1G19A 3AB3A 4KBFA 4X8MA 4TYWA 3P1JA 4WZBE 1BS1A 2LCFA 2QBYA 1G1MA 3THWB 1KY3A 1UBFA 1G3UA 2VP4A 3TGPA 1UKVY 4N1AA 3ZLJA 3LA6A 5D3QA 4H9GA 2WPDA 1N6LA 4Q4HB 1TQDA 1IM2A 4TMTA 1OIXA 4FWHA 1YZQA 3DHWC 5GJCA 3TK1A 4DVGA 3F0TA 4ZCIA 2E87A 4L4UA 1SXJA 3CF6R 3IIMA 4HUQB 5CDFA 3SU8A 2ZS9A 2ZU0C 4PC2A 4M22A 4C9BA 3QOFA 1Z28A 3GD7A 4DSUA 4L5BA 2BMDA 4B3CA 1KTVA 4TLAA 2VPPA 3GJ7A 1HQYE 1OKKA 2IF0A 2ZIAA 4Q9HA 3A4NA 1MR3F 4Q7LA 4S35A 4IHQA 2QUZA 3MG9A 5JECA 4OJQA 1D9ZA 2ERXA 3NVAA 2OCAA 2IF2A 4LBYA 1N0UA 1RJ9B 2FPMA 1E99A 3CX8A 4AG5A 2PLRA 4LHWA 1XEXB 4MYTA 2ZI4A 4CW7A 5AJYA 3W90A 1VMAA 4HZUB 1EFCA 2C77A 2WMNB 3B1YA 2OBNA 721PA 3CRMA 2WJYA 2QNRA 3LFUA 1G16A 2HF8A 1W36D 1JXMA 5IDVA 3K0AB 1ZW6A 2JLWA 1EWQA 3LDAA 2V6ZM 4TN1A 2AKYA 2FFHA 4JLNA 4AKHA 3VQTA 4TMZA 1JBKA 4RZXA 3H1TA 3D8BA 1XJCA 3NHBA 3OIWA 4LSGA 2GCPA 4H1UA 2QW6A 4HDQB 4GZLA 2YWEA 3W3AA 3H2YA 4US2R 3UKDA 4I81A 2PX0A 3AF0A 3QG1A 3WP1B 1AS2A 2NO0A 3NEJA 2GXAA 2BJWA 3NEYA 3QXXA 1DE0A 2A9KA 2J46A 2IWHA 3OAAA 4EPWA 1TQ6A 2GCNA 4YDSA 2Q3HA 1W2HA 2QEQA 1NJFA 4EPRA 1T3LA 3SYKA 1NBMA 3EXAA 1RE0A 1FNNA 1A2BA 4PAQA 3THWA 1VCNA 1Q57A 2I1VB 1N6PA 3AH8A 1KK0A 2XXAA 3LBNA 1X86B 2W58A 2A5JA 5J4HA 3BC1A 3UANA 2JEOA 2O0JA 3HDTA 4A8JB 5JWRA 3B1XA 5FR2A 2ZUBA 2V54A 4FMDF 1E9DA 2F55A 4B6EA 1FTNA 5JEDA 2QQ0A 3E5HA 4GP7A 4LV6A 2OBLA 4Q1DA 2BBSA 1KK2A 2D2FA 3I32A 1YQTA 2P65A 3VAAA 1G8GA 2Z4RA 1G7TA 1XJQA 2F9MA 3G82C 3PUXA 1S2MA 2WJHA 3VU9A 4QGFA 3VR2A 3A36A 2VP6A 1RRFA 2UZIR 4IW3B 1FQJA 2HF9A 3OESA 4KYIB 5F3WB 3SJBA 1UM8A 3I5XA 2LKCA 1YR7A 1E0AA 2H1LA 5F98A 5K8UA 3FKQA 2YC4C 1SVLA 1XZPA 3ADCA 4QJ3A 4PPGA 1GNPA 1LNZA 3PEYA 1Z47A 5DN6D 1Z07A 1U8YA 3KTAB 2ZYTX 2EU8A 1E96A 2XITA 3LW8A 3N2EA 3OEHD 5F9FA 4LYJA 4LJAA 1OXUA 4A92A 3CPHA 1Z6YA 2MSCB 4GBMA 5DI3B 1G64A 2E9SA 5BN5A 3BFKA 1YR6A 4BQSA 1J8MF 1E79D 2FPKA 4JBYA 1XD8A 4ZDKA 3MUFA 1T6NA 2IYXA 3W6NA 1U90A 4A0GA 4TYNA 4MKFA 2QY9A 5FUXA 3I5YA 1QG2A 4AIIA 5FUWA 4PZYA 5AJXA 1MABA 5FUYA 2D7DA 1VYTA 2ANCA 2QRNA 3GEIA 1D8TA 3VR5A 4Z1MD 1FW6A 5JCPA 1G4UR 4M21A 3A8TA 5DGXA 4GOJA 1NY5A 5FTLA 1QHYA 3E70C 4Q4AB 4O2LA 4DEXA 1G8YA 1E9CA 1GL6A 1DVRA 4TTPA 2PT7A 2RAPA 3IGFA 4I1VA 2RCNA 2ZVQX 5EZ6B 3TRFA 3ZVMA 4Q4JA 5L8VA 3QIAA 2CLCX 2HLDA 1VIAA 1CJVC 3R8CA 1RRPA 3Q5EA 3AVTA 1XRJA 1KZ7B 2BEJA 3VHXA 1Q20A 4M0LA 4E22A 2ZI9A 4GDFA 5EXSA 3LX5A 3WMEA 4HEJA 4TLDA 4DKXA 3OFNA 2O8CB 1N6IA 1BMFA 3SJCA 4EKDA 2IS1A 3GQBA 2R6FA 1YZGA 2ZI3A 4O25A 2J7PA 3CR8A 3TSOA 1P6XA 2LWIA 2V9PA 5L3RA 4MYHA 2QGZA 2WKQA 2ZJOA 3K9HA 4Q4LA 1H65A 3H0KA 5AWFC 2WTUA 5CK4A 4LY6A 3UG6A 4UJ5A 2BMEA 2OG2A 3NH9A 4Q48A 1E0SA 3BB4A 4CEJB 5KSOA 3B9PA 3K0AA 4JL5A 1E2GA 2ECKA 4PC7A 3VR1A 1U81A 3IQWA 2XTNA 2AWNA 1NNEA 4ASUA 1T4GA 2QTVB 5B30A 1W46A 1Z08A 2VP2A 3T12A 5AUOB 1WCV1 3TVTA 3LBHA 1KSGA 2OUKA 4X8OA 1MRNA 3SBEA 3LD9A 3QKSA 4CEHB 1N0VC 2QA5A 3RSLA 5HZHA 5EXTA 4B76A 2JLVA 3FMIA 4HLCA 5KPJA 2ZR7A 2IYZA 3OF5A 3KQUA 1C9KA 2QL6A 3ZJYA 3ZZ0A 2ORWA 4S2EA 2OXCA 2OAP1 4KO8A 2OSBA 3QUSA 4UXJA 3RS5A 4XTRA 4B3FX 2XNDD 1ZVQA 2XSZD 4QGAA 4LBZA 2VP9A 5FBWB 2VQSA 5LDDC 1TX4B 1XTRA 5ELXA 2AKAB 4C0QC 3W9YA 1Z0JA 2W6IA 4LV5B 2C9OA 4HUQA 1SXJB 3TSZA 5EJEA 5IHPA 3DVLA 4FWIB 2Q9CA 3RABA 2NOAA 1TEXA 4QBFA 4R2IA 1SZPA 2P6RA 4TL9A 2C95A 2AL7A 3QPVA 4UKDA 4Q4HA 5B58C 4GL2A 3QXHA 1GVNB 1KI6B 1KGDA 4PSVA 4EIWA 2RMKA 2KI5A 2VL7A 3I62A 1A82A 2QG6A 1FTSA 1OFIA 2GRJA 4FWTA 3EIQA 3W5JA 1NSTA 2YKGA 3MLEA 5ANRB 2QBYB 4PFSA 3F8TA 5J40A 3TW4A 2VHCA 2WWGA 1XXHA 1KJYA 2V6JA 2ZYVX 3QG5A 2QE7A 5G53C 2ANBA 1HE8B 4K81B 4DDVA 3U7FB 2BBOA 4CT5A 2AD5A 4URYR 5GJWC 3QF4A 4TYYA 3L43A 5KNDA 3R7WA 1YR9A 3TMKA 3C14C 2BCGY
chains in the Genus database with same CATH superfamily
3BAZA 4IF6A 3T3HA 4F06A 2A1TS 5DBOA 2X0FA 1T3TA 2P6NA 3OKCA 4QU0A 3OX2A 5ALOA 1BE8A 2JKZA 1KO4A 2HLNA 3WGTA 1CJMA 1HA3A 3GMTA 3GZJA 4C0XA 4E2FA 4GKJM 1ZGZA 2VH2A 2I8CA 1KRWA 4GPEA 2JGJA 4MW2A 4O5OA 3U4GA 5DX1A 1D6SA 2CCGA 1H5UA 2W7TA 3SARA 2C5AA 2WI8A 2FK7A 3HVUA 4HH3C 4IH4A 4PLFA 4WJKB 3CLTD 1HC7A 5BQFA 4C6HA 1J09A 5BUSA 1AK1A 3K73O 1K97A 3TXYA 3ZHYA 4Z54A 3S5UA 4B83A 5A5DA 1DWQA 2PH1A 4BFSA 4HNVA 2JGRA 3I2FA 5EP4A 2A0UA 2VQ3A 2JLQA 2OCBA 3EOBI 1SVMA 1QV6A 2NUAA 3HZZA 3M6WA 4UOZA 1DCMA 2EFJA 3GRYA 2EWVA 4L3OA 2J9YB 3DA1A 3TE6A 1JE1A 1JU4A 4OYYA 1Z63A 3ZWQA 3OHMA 3GCXA 3UA3A 1DGQA 5EXDA 1ACMA 1JEAA 4U3JA 3LTEA 4JXZA 3MHPA 4BFTA 3EF0A 4LSZA 1L4YA 3H1FA 4TLEA 1SUSA 3PX2A 2QZZA 3HABA 3KAKA 4G24A 2LVNC 4RZUA 2OPFA 2PUEA 2B34A 1WMSA 2GNPA 4MNTA 1LF0A 2AN5A 4XDYA 1DX4A 4HGYA 1Z4MA 1QORA 2BEVA 3AFNA 1ZUIA 5TJHA 3OEHA 1F2TA 1AQLA 2IY9A 2A35A 3M5CA 5FFNA 2Z6QA 2IGBA 1EJ2A 1NTOA 1BXGA 1XO1A 2PSEA 4GXRA 4WMLA 2WAYA 4XFKA 3L6RA 3GLGA 4ZRMA 4EBFA 4YY3M 5KOJB 3MT9A 5A05A 5B3JC 5KAMA 1GCGA 1M76A 3C3KA 2D5BA 3PFKA 5BMOA 2NV6A 1JIKA 4MW7A 4X93A 5L3QA 1I01A 3W5AA 2KNZA 1O58A 1RP7A 3M1YA 1R5NA 3EMBA 3KR1A 2BKLA 3NONA 1OV4A 2D7EA 4GGMX 3AZQA 3V2HA 2HNKA 3QUTA 4LDNA 3T1YB 2CCKA 2C03A 2C2MA 5ULLA 3Q0TA 2HRZA 2J48A 4DA6A 5DP1A 3U6EA 2D00A 3BDIA 5JZSA 1AHPA 2FG5A 4K9SA 3EMVA 3HUTA 3L0SA 4HAXA 3TBHA 1UJMA 4FE4A 2YVLA 4A6EA 2WSFF 4RFSA 2C4NA 3ZCQA 3GU3A 5JVDF 2SCUA 2IL1A 3CNLA 1KQ3A 2JJ2A 3EW9A 3NPAA 5IWCA 3OI7A 5TARA 4U7PB 2C7BA 3M9LA 4C6SA 4MB2A 4QECA 3JY6A 4UU8A 1MC5A 3WNBA 5CA1A 5K0TA 4DV4B 3VR6A 2KHHA 2Q4TA 4CR7A 5DPMA 2DWMA 1CZRA 1U3FA 2AG8A 2QN1A 4JBWA 4ROSA 5DHFA 1K66A 4UPEA 1KYWA 2PUGA 1JDPA 4XW2A 2AQHA 2HIAA 3HBMA 3SZOA 3QPAA 2PV7A 3STXA 1B1AA 2FZ5A 3GH1A 2FRDA 4QC2A 4ARBA 2AH5A 3VVMA 4F84A 4TLAA 5AOVA 4E5SA 3QVWA 4DDMA 1F6DA 2FX2A 1RD4A 3AONB 4Z4GA 2DHCA 2NN3C 4PLZA 2VFAA 1HG1A 3KELA 1W85A 2Z8YA 2AR9A 5EY5B 3ELUA 3ZI7A 5B2ZA 3GDOA 3SZ3A 5DO9A 5EIHA 2IOQA 2WSEF 1G18A 4RY8A 2BFAA 1P9NA 2OLKA 3CEPB 1DC5A 1SUDA 2HTEA 5DCWA 3O47A 1G17A 5IC4A 3U4MA 2J5QA 5FBQB 1T5LA 2YY7A 5CVJA 2B3TA 4LJ4A 1NM5C 1QNLA 1QK5A 2GEBA 3GAFA 1ANKA 1YIAA 3UOWA 5C8XA 1VI2A 5I4CA 3THXB 4WCVA 1F7UA 4OQ4A 2WWFA 2AIRA 1AO3A 2O06A 1CP2A 3HE3A 3IUBA 3SJ7A 2WEKA 4DSZA 5B4TA 4MQ5A 1WZUA 5GZ3A 1QFSA 3N2IA 2AB0A 1F4LA 5D51S 4JUIA 1RWXA 2VIIA 1BVYF 3IE2A 3QE2A 3TO5A 2UXBB 4AQYB 3VPAA 4CKEB 1O7JA 3Q9SA 4H6PA 5CEEA 5KVVA 1ZHOA 3OCWA 1IXSB 2VJMA 1Z12A 2BTQB 4LMRA 4FQ5A 3L0BA 2IZZA 2JASA 3FJOA 3QGMA 4QOEA 2KM1A 2OHFA 2ZT6A 3AUSA 3BXFA 4UVIA 4HZGA 4OLBA 3R3WA 4UASA 4A8PA 1TC1A 1YV9A 5EQDA 5HILA 2Z1NA 4Y2PA 2PD4A 4RSMA 5IUKC 3N6XA 4BHTA 1L4EA 2FSHA 5AM0A 1Z22A 2GETA 3F3SA 1ADFA 1V8OA 1FTQA 1Q7EA 2DAPA 2VSYA 3D02A 2H18A 2AOUB 3F2VA 4WFIA 3URMA 1G5TA 1MN6A 4CF4A 1ZFNA 1IXKA 3S2EA 3UK6A 4DV1M 4Q5IA 1DPGA 2IYAA 1KQNA 1RM0A 4C0LA 3HB7A 2WG0A 1KL7A 5FA6A 1PR9A 3R8XA 3TJRA 4Z8XA 5A5GA 4QDZA 2R8YA 5DSZA 4XWWA 4JP1A 2B5WA 4JLOA 2DP4E 1FMJA 3GEMA 1HPLA 3JAWB 5L6LB 4MLZA 1KMQA 4I14A 3KP1A 4M2LA 7REQA 3BT7A 1H4VB 2Y1DA 1IBSA 3BIXA 3KZMA 4HWOA 1ZIXA 3N58A 1IMJA 1FRQA 3DM9B 5E6SA 5ECWA 5BT9A 4XQ0A 2OFFA 2P9BA 3G7UA 1YE3A 3USES 2LNDA 2JAOA 1B3BA 1LZKA 3C87A 4R2MA 3B8EA 1NJSA 5CNJA 1X8LA 6PFKA 1SN7A 2CNNA 2PGLA 3UAWA 3DE3X 3DKIA 4GOOD 4L8YA 3AUXA 1RKXA 4PSUA 1SRQA 3QSGA 3CMMA 3EAGA 4RLSA 1VOTA 1PGPA 2VZ0A 4MVJH 5DCLA 4I9NA 1A8QA 3RR2A 4PX2A 4NZPA 1PR2A 1GZ4A 2OQ2A 4P08A 4HL4A 2CNBA 5D3MA 1E5DA 4WOCA 3S68A 1C4XA 4KXFB 4YHHB 1W75A 4QOJA 2BFBB 4DMGA 5A2QA 3DBHB 4KJXA 2LVAA 3MBKA 1HY3A 1XTIA 2WHXA 1MTZA 2AA3A 4NCJA 2YJ5A 1Y1QA 1U0NA 4F60A 1W4CA 3A4VA 4R3WA 4RPKA 1EU1A 4I3GA 4UU0A 3E2IA 2R4QA 2A2ZA 2DQSA 3D5QA 1YZUA 1ID1A 1YDHA 5L4NA 5JYBA 4ETMA 2VUIB 4Q21A 4ZO4A 2PMWB 3P2MA 3IG8A 2H2IA 3L46A 3N28A 1HWYA 3G0HA 1ZEJA 5B1HA 3FAZA 1EZ1A 4J16C 5CX1B 4WFKA 2P3LA 1IPEA 1N2JA 3MCUA 2F48A 3WTCA 1I6MA 3NBXX 1M3SA 4HGZA 1G66A 1TU0A 1HXHA 4GP6A 1NPYA 3EHDA 5DNYB 5A3VA 1SIUA 1Y5NA 3EGVA 5DHAA 5JFGA 5AW6A 1GITA 3IHLA 2PZAA 3M6FA 1TC2A 4ZHQF 5IJ0A 4B74A 1UEIA 3HY5A 2F9LA 3O90A 4HAWA 4LRSA 1JEDA 1USUA 1W4AA 1MO6A 1EXWA 3KOWA 4PX5A 1VI5A 3W5CA 4JROA 4BQOA 2VPWA 2NYUA 2JGDB 3EIOA 1E77A 4P81A 1H2XA 5CM8B 2B1GA 3F7MA 3ZZMA 5HFAA 5K0GA 1Q6ZA 2R84A 4BMYA 5G02A 3D7MA 2DSTA 4LG1A 4QBKA 3WGOA 1XDUA 1VSUA 2GEFA 4E3WA 5C5DA 4H60A 4IKPA 5C35A 2FMUA 4KE8A 1NGSA 2IXDA 4W82A 3GJ8A 3WC4A 4IBFA 1VLVA 4BNHA 2OQIA 4A9AA 1VG1A 1L9KA 2IXEA 2SKCA 2ZJZA 3EUWA 4DJAA 2Q3LA 2XNCA 1JDZA 1V1MA 4FSDA 2DR3A 1EBFA 1RC1A 2IYTA 1QIGA 1R6TA 2P0YA 1VEJA 3RUDA 2R65A 1EWVA 1ZESA 2NO5A 4B6SA 5A1TA 2E4UA 3C0KA 1YNSA 5TLSA 1Z5GA 4UOQA 2GCOB 2XCLA 1L6IA 2IELA 4WZBB 3UKOA 5EAIA 1NKSA 4TKZA 5JNVA 1LXCA 5LQRA 1FB5A 4I8DA 3PGMA 3SEQA 2XTZA 2QYTA 2AQ8A 2G6TA 1MX5A 3HHEA 3PTAA 2DY1A 2G72A 2VDRB 3JD4A 4MQFB 1PGJA 3GBPA 3VJKA 3ZX4A 2RJOA 1N6HA 3PJFA 3RSQA 2QD4A 3O8QA 3BFVA 3CKMA 2PRJA 1ZMUA 1DOZA 3WLOA 3EIEA 3PXGA 3DC2A 3GN2A 4FWBA 4M55A 1JAIA 1RXIA 4CV3A 5BV0A 2Q2VA 1I7PA 2ZROA 2PR2A 1W2GA 3DLPX 4CGYB 1KVSA 3TVYA 3GVHA 2LTUA 5ED4A 4KE9A 5FLKA 2GM9A 4ZREA 4WJZA 3EEIA 4R2XA 3WNDA 4B84A 5HK9A 3SVZA 1P73A 4HH0A 2P2LA 2WQ7A 2J45A 2DCMA 3NTUA 4O2AB 2IXFA 2QIPA 3ISTA 4EHBA 1ISJA 5BNFA 3NTRA 2JDID 1Y48E 1QDUA 2QPTA 3AFGA 3L7LA 3E03A 2DENA 3K5PA 4KNYA 2H3HA 2XA2A 1NNUC 1XMJA 1M34A 1E2QA 1GD1O 1GJRA 2PKCA 4JKYA 4D3FA 1JE0A 2VOJA 3LKZA 1E1QD 4LRTA 2YZ7A 4ZV7A 1EFAA 3JU3A 1IULA 1ZKDA 2L18A 3AFOA 3GMSA 4GI2A 5JCJD 4KFCA 1HNZB 1S3GA 3MRVA 4O4IF 1Q3BA 3IVAA 5TR9A 1NE7A 1XVLA 3WG9A 2GR9A 1UAGA 1YDMA 3RU7A 1HSOA 2BEUA 2Y1WA 8AT1A 3HN7A 1GZSA 1UBJS 1J2JA 1IFYA 3VR5D 4KNWA 4FC6A 2QV7A 5EPUA 5IVKA 4RF2A 1D4OA 5LB4A 1FL9A 1AKWA 3U40A 1Y1KE 2KZSA 1CS4C 2VPYA 3TXXA 4REOA 4Q1BA 3W7BA 4E6EA 2IYSA 5KTSA 2ZQ5A 2JLYA 4ZCSA 4J4BA 1YHNA 3M2PA 5H9VA 2FKAA 4E94A 3ZEIA 1KKLA 2JB9A 5CLQA 1WY5A 1V35A 2A1UA 2BM1A 3SBOA 4F7DA 2O0HA 3ECAA 2W2QA 1QH9A 4QE3A 3X43A 5KSYA 2ZSAA 2QF7A 3JD2A 4V2IA 5C8YA 3SYNA 5B6PA 4A2PA 4KODA 1PLJA 4L5YA 3TNYA 4EEZA 4MV8A 3LUDA 3LUFA 4RVGA 3EDQA 5IT5A 2WJAA 1YFLA 4XXHA 1DJMA 2KB0A 1G0OA 2RONA 5ICCA 4X1KA 2MIIA 4XOUA 3KTDA 1N92A 2V7QA 2Q4RA 1D2AA 4UM5A 1P1HA 3V7WA 4F7WA 1NC3A 2RSLA 1PCXA 2I71A 1RFLA 3T9AA 3NC1C 3HYCA 5EWMA 1EE2A 2VHQA 4Q7MB 5TSDA 4MDEA 3AILA 1DQNA 3PPIA 4JP8A 4WXYB 3FCEA 1RKUA 5ILQA 4I9UA 5KMGA 5JO0A 1RYMA 4I19A 4G1BA 3GBVA 2JI4A 3Q7RA 4XYEA 3I28A 3FD9A 1J9GA 5FBHA 4I5FA 2IHBA 1U28C 2GS9A 1UKAA 2X3FA 3UT6A 3L8GA 4I4TA 5DT9A 3IT1A 5IM4A 5EZYB 3JWPA 1X77A 4CMEC 1MAHA 4RHEA 4KZPA 1LS1A 1VHDA 1DEKA 5GVSA 2NU6B 4J2OA 4NLLA 4R0VA 1B6GA 5DV9A 3WOHA 4Z5XA 3VTAA 2CV1A 5K0SA 4RTRA 4NONA 1MO3A 1N2GA 4DQXA 3IHPA 4COOA 1WGNA 1Z2PX 3A31A 4XA8A 4CIWA 3L40A 3KFUG 3ML1A 1EX7A 1KI2A 2PSJA 3GJQA 3QEOA 1QIKA 3GARA 1X1SA 2JIBA 1QHGA 2DT5A 4L73A 4WXRA 3VZBA 1EA7A 1SCJA 2BR5A 4DF3A 1UK7A 1FP4A 2JI8A 3R9IA 2JHAA 4U9UA 4GBJA 1KVUA 4MS3A 4HAVA 2PU7A 3NUZA 2FSFA 5IK2A 2QJRA 1J5PA 2GOYA 4FUQA 3RBZA 2C7OA 1M8PA 2OGWA 3VTZA 1AB5A 1W0KD 4RD2A 4YJDA 3F74A 4PRYA 3SYLA 3U6LA 2EC5A 1RKQA 1GFWA 2K7ZA 4P3XA 5FBRB 3V8EA 2EKDA 5CDTA 1YR3A 1KJZA 3C74A 3Q88A 1EHCA 3RRBA 2AUNA 1JFFA 3E3AA 3VO2A 4H77A 2XRFA 2HJGA 1E89A 3L7MA 1NPTO 2GFIA 2H1FA 5FOXA 3JQ7A 3J2PB 2F7SA 5KQSA 3VNVA 1OBFO 2CCJA 2Z8XA 1S2GA 4WSOA 1LJ8A 3G1WA 2CJYA 5TV2A 1PJSA 1TMGE 1OSNA 4Q3NA 1AK2A 1CUUA 1TJ4A 4C08A 4ZGWA 1D5WA 1NUHA 2DJIA 2ID9A 5BWLA 5CB0A 1G6OA 2FAXA 2JI7A 2YNMC 3NALA 4DSTA 1I2MA 3AERA 3HR8A 4GKVA 1N9KA 1WD5A 5ALGA 3NBUA 3VDUA 4FT4A 1KK1A 5CFRA 2O3JA 2V3VA 2FLWA 5KO2A 4Q3OA 3DJFA 3OT5A 1DV2A 1F4PA 1N77A 4H7KA 1EVQA 3JWJA 1LDMA 2WJJA 1O8CA 2M2IA 2G82A 2VJLA 2J9FA 3BMQA 1JSCA 1U3TA 3EDRA 3QYJA 4GZMA 3TR5A 4KLNA 4H16A 5A3QA 3F5SA 3K8YA 2OLJA 2DHEA 2Q5HA 2OZLA 2PD6A 3R24A 3H6HA 4LDAA 4QTUB 2C8KA 3QLUC 4PEVA 2VP3A 3LQ1A 3UH1A 1XN1A 2PQMA 4RZSA 4B47A 4MUGA 1DUSA 4CDRA 1P2TA 1UP7A 1Z2AA 1UBOS 2OZVA 3OHPA 4LF6B 2QWXA 2O14A 1NTRA 2ZWVA 3DD5A 4KHZA 1DBPA 1P2GA 4Q24A 3EXHB 3UUFA 2B8EA 4AKEA 4M89A 5FL3A 3WFJA 5JCZA 3I9OA 1ZOPA 2HMSA 2ZSJA 1N9GB 3ITDA 1K2WA 1YD7A 3K9CA 5B36A 221PA 3A32A 2G25A 3OCXA 4IXWA 1T8SA 1K27A 4XVRA 2PWYA 5CA0B 5J1SB 1T15A 2QW0X 4TWRA 1J70A 2GASA 5A9SA 1NBHA 2WYHA 2W2LA 4Y0VA 2QLLA 3KKLA 4C4SA 1C7FA 1Y6ZA 2MSEB 2A86A 1DIOB 1P7CA 2EKLA 3KWMA 3UMMA 4REQA 1DWOA 3FBWA 3KVRA 3PEUA 3QKTA 5JZMA 3CUKA 1INLA 1H6AA 2REQB 1CJTC 5IXSA 1C3XA 4LHYA 1AJEA 3H04A 4F1IA 1X19A 4QUGA 2XWPA 3A1WA 4IR7A 4R7TA 3WBFA 4CYMA 1XG5A 1K1EA 4B7XA 1GO5A 3ETNA 3OIFA 4D79A 4OB6A 2FG6C 3KDAA 1O0CA 1JG3A 4BX8A 4ZT7A 4F6CA 1FLNA 2F6RA 4LXYA 4QSMA 1M2OA 4Z99A 2C98A 1Z68A 1ZONA 3P0EA 1IVSA 3L7YA 2O59A 3OQ6A 1QO0A 3H18A 1JFSA 4PC3A 1JB1A 2RGRA 1NM5A 3KR0A 1ND6A 3TTUA 3WHKA 2JEYA 1L1TA 1SOUA 2X14A 5ALJA 3SBXA 2A9VA 3PRJA 3VSAA 4LF5M 3QVKA 3U4QB 4LRQA 5FCDA 3IAS1 2VJKA 3TUIC 4PWYA 2NVOA 3DOHA 4Y1RB 4DDWA 2XYPA 3KALA 3FPKA 2P9EA 2L42A 4BKPA 3OFSA 4MLDA 4G3XA 1YC5A 4HYTA 3B3AA 2P9YA 4OU4A 1W581 3HXMA 3T5AA 3QIVA 1MO5A 4FPXA 1J22A 1ATIA 1C29B 4V1CI 4RGYA 5AK3A 2WY2D 4I8OA 1E1LA 2IYYA 3PLRA 1FDRA 1YB6A 3GRAA 1JKJA 4WXPA 5TGTA 2XRMA 1D4AA 3NVMB 4G86A 2OT3B 2YBEA 4FM9A 3ZY6A 4NKRA 3GA5A 5JJBA 2NSHA 2O7VA 1LLFA 1OAIA 1F51E 2M98A 3STWA 4JVMA 8GPBA 4LF8M 3SEAA 5H3LA 4Y0AA 3GHYA 1C7YA 3DTVA 3IMFA 2CBZA 3N76A 4LWQA 3HWWA 2R46A 1RBQA 4CTKA 3K1AB 5KTKA 1BCRB 1HFKA 1W96A 3O8OB 4M1SA 4TXNA 1EWTA 1F2DA 2XVMA 3SF8B 4R3NA 4KXUA 3H9CA 5EMNA 5CCBA 4K03A 1U3DA 5FOTA 1QKKA 2GZHA 3OSZA 3FUWA 3RS4A 3IA2A 5AKZA 4KKXB 3Q3HA 1IUNA 1NVAA 4BLRA 5CD1A 4E6PA 2WV7A 2J7NA 3DV9A 4GX5A 4DGSA 2XB4A 2CLDX 4J8PA 4JAVC 5EP1A 1ARZA 2O05A 2WWRA 4DMKA 3DQZA 3FOFC 3N9IA 2FOIC 3OQBA 1DAFA 2FP4A 2FN8A 3K05A 3GPYA 2GH1A 2VT2A 3DKKA 3K5WA 4EHDA 1RLOA 1YB5A 4HNSA 1Y5IA 4BFWA 5FNVB 3ZVLA 5DYGA 4FD3A 1GPBA 3RDPA 5LOVB 4FQ8A 2XHZA 2D4AA 5CJJA 2OO9A 5EP2A 2I4MA 3Q41A 2AZTA 2QU8A 4QVKA 3SR3A 3T7IA 2P2SA 2B4RO 2YC2C 4AKIA 4FFRA 2F4VB 4EEXA 2X5KO 5LNK1 2JBWA 4HYQA 1BMTA 1DXYA 1I1OA 4A3VB 2FPSA 3OZUA 1ECFA 3IH5A 4KR2A 4Y3UA 1LDGA 2D2EA 1V2GA 1W8DA 3I3OA 5DB4A 2PUBA 3UPUA 4IJEA 2ADMA 4XCVA 4ALIA 2ZR0A 1RIFA 3UT0A 2JAPA 5TVGA 4JJFA 4RQTA 4XIJA 5C8VA 4NEQA 1TGVA 1M2OB 2B1RA 2ZBDA 4ZYXA 5CDSA 1Q0RA 4D3YA 1JP7A 1VKNA 4ED9A 2NYAA 3NIFB 1TLLA 4RH0A 4XARA 2NXCA 3FMFA 1M2GA 2VVTA 3U7HB 1R8SA 3DKPA 5KYKA 3KTOA 2HA3A 3HJTA 2BDTA 1FF9A 1RNLA 3CW9A 4KQ6A 4CM9D 5EJ5A 4UDNA 3A6GA 4IVNA 4DBLC 4MVXA 4A8JC 2UYGA 4I6GA 4LYDA 4KDRA 2O2DA 1MVOA 2XUAA 4LVUA 4OKSA 5A9SB 1W5TA 1EKXA 4X64M 1C1DB 4K9LA 1R5BA 4YMSA 2Q4DA 4JVLA 4POOA 2X8BA 4HL6A 3D0OA 1R9GA 1SVKA 2CVHA 3GP5A 1ZMVA 1Z2EA 4H3SA 4S0ZA 4V0SA 5F52A 3ADKA 4MWTA 3TPCA 4MWBA 5ITSA 4RTMA 3PQ8A 3DMGA 1JXOA 5LBTA 1CNFA 4ETNA 4Z1OA 4DDKA 1E3WB 3HM9A 5KUTA 1D7OA 1YZHA 3IAFA 2FFQA 2IZ6A 3EXHA 4EUSA 4KMSA 4KXWA 5J2UF 2AMVA 3UK0A 1GUYA 3OQHA 3WSTA 5TGZA 1N5JA 1J56A 2WSIA 4ACBA 3SGLA 3S8YA 5K3FB 3T3DA 1Z25A 3DZKA 4BWFB 4EQ6A 1EFVA 1XL1A 1W5SA 1YAJA 2VP0A 4KIGA 4I5IA 4D42A 2OZLB 2PRKA 1RTTA 1XDGA 3PRKE 5GV7A 1PBNA 4R71A 3T1VA 3HUUA 4UCFA 2KJQA 1OWPA 3F73A 2J9FB 5DHSA 2ZWMA 5HTOA 2C4KA 3OKPA 4P4TA 2MGWA 3A46A 1XNQM 3OJOA 1NVTA 3FBGA 3PWKA 3IBSA 3EARA 1MQAA 1BNCA 1JFLA 4A73A 2GVDC 2OHIA 1FPMA 4FYKA 2WZBA 4A5SA 1AUXA 4AO6A 4DGQA 4DLLA 2YXDA 3P9KA 4HI0E 3QV2A 4YUZA 3H87A 1TO6A 3UJ6A 2L4EA 1Y37A 2WJGA 2F1OA 1P80A 3UMYA 1Z7BA 3BXZA 5F77A 5CM2Z 1Z2CA 1JYSA 3CLUC 5K0EA 3FRIA 5ALLA 1X0XA 3VJMA 1PG0A 5KU7A 2PHZA 5EIFA 2EKZA 1VP3A 2JA1A 2QRKA 5ENZA 1J9ZA 3HK2A 3WRYA 3AVVA 1C1KA 4HQKA 1L4HA 2QQ8A 1IWBB 3UYKA 4OUDA 3EQZA 1T0IA 1WKVA 5A4JA 1US8B 4CKBB 1Z35A 4IBJA 1NAHA 4OXRA 3KFVA 3SAJA 1KVRA 1WCIB 1C41A 4N82A 4XLTA 1WOYA 4CG2A 4CHTB 2FXIA 1FLVA 3O95A 2YWFA 4Q7JB 1N5KA 3PC6A 4ZXFA 4CNQA 1NAIA 3GDHA 5DDIP 4DC0A 1WP4A 1SXHA 3CLKA 1MIHA 1XRPA 1I33A 3MPOA 3OTGA 4FI3F 4OHPA 4BB6A 4BWVA 4CF6A 2QJWA 4C78A 4ITQA 4KLCA 2FG7C 3D4IA 4FHEA 3FSRA 4LXGA 1W94A 1SB9A 1ZNXA 3KZOA 4MV0A 3M82A 5IZCC 4G23A 4IDAA 1Z6AA 3CISA 3UJ9A 2O8DA 3CNBA 1MFPA 1SXJD 3Q12A 2ECFA 4Q7JA 3ZZUA 2D74A 4CHTA 4RH1A 3FYCA 3R3VA 4Z9YA 1PEDA 2JHCA 4HDSB 3L0IB 4RHYA 3H1EA 1MGOA 1JALA 1G20A 2CYCA 2HJWA 4F3CA 1EGVB 5ECGC 4KQ1A 4ZTUB 4M9UA 2O52A 2X6RA 3BE5A 4EPTA 3DDHA 4YLYA 5HE9A 4DC9A 2Q3EA 2Y99A 5TPWA 1VFPA 4BQFA 3A1DA 3ETJA 4P4LA 2I4LA 2YN4A 2Q5FA 3F97A 5CVTA 2C9BA 3CLTC 2J0EA 1OPXA 3OBBA 1P9LA 3CWZA 1EUCB 3OC6A 1DHRA 3TDNA 4MUKA 1C9JA 1OLSB 1DZ3A 2WZDA 2UUOA 4JQYA 2D0DA 3RSSA 2DUNA 3SQLA 3WYGA 4D43A 1KMMA 5F3RA 1A7AA 1RI2A 1MV5A 2QJFA 3KL2A 4QM7A 1HURA 2ONZA 5BNIA 5KMGB 1YQDA 2I4NA 3CPSA 1HLGA 3ZH9B 1KVTA 4JOQA 4W5RA 3PPWA 1QYIA 1V45E 4OY3A 4J2HA 1YB7A 3DXZA 1O87A 1A2QA 1Z6QA 2JARA 3AGQA 2WJPA 3GLFB 2IEYA 3C8HA 3N2NA 2JGAA 4PDGA 1J07A 3UK7A 2FRXA 3R0VA 1ZP6A 2P6OA 3B5EA 3DDCA 1WIVA 2QOEA 3A1EA 4IRXA 2A5GA 4US1R 1H9BA 1T25A 1ZC4A 2GLXA 4FD2A 1IY2A 1K3TA 4N8EA 1OFUX 3ER9A 2DLNA 3COZA 3MT0A 1BQ4A 3N53A 3KUDA 3WKAA 4D4MA 1VEKA 3ADPA 2DNAA 2WD9A 4IIYA 3HY4A 1UJNA 4YJKA 3AEKB 2E3JA 5KYUA 2A58A 5L3ZA 2WTBA 1M1UA 3TLEA 3RUEA 2EQAA 5JD4A 1TTTA 1FDOA 1Z88A 4NOOB 3FROA 3F5MA 5KWSA 3OA2A 4ON9A 1OFGA 3EVTA 3Q8LA 2H59A 1CR1A 1DRVA 1NJ8A 5K8TA 1ILEA 4RKRA 1R2YA 1PK9A 3PJGA 1KAOA 2C88A 2GEDA 5A9RA 4Z0PA 1F0YA 1GGMA 3QMMA 5AM5A 1OFTA 3IAAA 3QBTA 3S29A 1E5QA 2XKKA 3O4HA 4JEHA 2ONKA 2DWPA 3DMRA 5JEEA 1FYXA 3HXQA 2VQEM 1YSCA 2AEJA 1PR3A 1CQJA 4PO8A 2GT1A 2UVPA 4Y6SA 1XUOA 1RLIA 4G0PA 5DBFA 3KWFA 1GNSA 2AD1A 2PUTA 2YZGA 1U4OA 3R7DA 1E8NA 5G3YA 2V7TA 5CT4A 1Q84A 3N0VA 1IEVA 3LMKA 4DIOA 2GO1A 2JCXA 4DVJA 1W49A 4KXQA 5AUQA 1NQOA 5E9WA 3WYFA 4KQEA 2J7KA 4OGLA 3LZCA 3E23A 2PH5A 3PWTA 3VO1A 1VZ3A 2XMCA 4O2AA 4DCTA 1A9OA 1CRWG 1LU9A 2OD9A 4HY3A 2VWQA 2FMFA 2BGUA 2WIAA 2WIDA 2Y71A 1HDZA 3L4BC 4G9GA 3MCWA 1RQGA 2GYYA 4MA5A 2Q1YA 5J1TB 5LOVA 3FPGA 1P2SA 2C5EA 2YIVX 4DUPA 1CD5A 2Y8EA 2FW7A 4LE1A 4JI4B 1P4GA 1BDMA 1FRVA 2FPRA 2HO5A 4O4IA 2AE1A 4H35A 4JC4A 1HQDA 4DR6B 1FSPA 3ICCA 5LYJA 1IM5A 3OAAD 2ZYIA 2GD2A 5HE8A 1Q11A 4C06A 2VZ8A 4JJIA 1U6JA 4QAQA 2G80A 3GAZA 5F51A 3RHFA 2F8TA 1SOMA 2MCFA 1OBHA 1A9RA 3KZKA 1UDRA 2DULA 3CKYA 4CMIA 2QG9A 1OC2A 4LDZA 1BHO1 3T4EA 1N33M 2PS1A 5JMWA 1E4EB 2C5BA 3JASA 3X2SA 3SX2A 1ZCFA 1IRXA 2CJWA 4DHEA 1KE1A 1T2UA 3LSTA 3NHYA 1DC8A 4NRDA 2HA0A 5E2AA 5FAXA 2X15A 1FFAA 2FZEA 4ISCA 7AT1A 2FJ0A 5HKBA 5HOQA 2YY5A 1NHGA 1EHIA 1WDWB 4RVUA 4L28A 1VPWA 3DFFA 4IM7A 2WC1A 3MD9A 4N3NA 4NBVA 4UNIA 2D3WA 3K2IA 2IXAA 3LVWA 4C7OB 1Z6TA 2AEMA 2WHEA 1QSGA 4RNCA 4BB0A 4WNAA 3UJAA 1PJBA 1GZ5A 5JS8A 4BV8A 1AKQA 2DPYA 3W3AH 4PS1A 2HI0A 2WWYA 1IUOA 5ER6A 3UMBA 5M04A 1XZDA 2BD0A 3PNLA 3E53A 3AVXA 1FU4A 4BUZA 2RH8A 4AJJA 5A2QS 2QGNA 3FNGA 5KCMA 5L40A 4MUXA 4QLAA 1M2VB 3W2EA 5CCDA 3LLVA 1L8AA 1T43A 3SHTA 3W5UA 2ZJFA 5CH5A 1XROA 5C32A 4YRKA 1WZEA 5BYKA 1HTWA 4C1NA 3EEYA 3EIUA 4L22A 3T7DA 3WDMA 3ZD6A 6NULA 1NXOA 5LZ7A 1TR8A 1TKAA 2Q62A 4MSUA 4NZYA 2WKWA 3ZU4A 5EUBA 3EFBA 1RVDA 3U4QA 4QU8A 4W9NA 4A0RA 4NBSA 1BC5A 1SCNE 2Q7DA 5EJ8A 2A5DA 4FDVA 3LBIA 5CEJA 4W8GA 5TPZD 1ZD4A 3E9SA 1ZX1A 3FY4A 4TZTA 2X6QA 3HWX1 4CIVA 3MMSA 5F35A 1SEVA 3EF3A 1KI4A 3KKEA 5LUBA 4AJ4A 3FLMA 1D2CA 2EX4A 1U11A 1C9EA 2AMFA 2P4SA 2Y77A 3QQPA 3QU7A 4Q15A 4TS9A 1QZ3A 4YCCA 1KF0A 3K72B 3G13A 3L0PA 4J7XA 4A10A 1XF1A 4CQLA 3QHPA 2I7PA 3ZTYA 1JV2B 5SYAA 3LFTA 4M1WA 4GHLA 5D3MB 2O25A 2HWYA 3ZUPA 3FX2A 3TB6A 5ADVA 3RFFA 4IJFA 4D45A 1EVEA 2GBFA 2XMDA 3B6IA 2YIDA 4DPMA 3LV8A 1K4KA 1Y7PA 1W0JD 2PVPA 3KD2A 1Z0UA 2GNOA 2HXYA 2D8AA 3VOTA 2P3SA 3VZCA 3A6KA 1QZMA 1FVXA 2Y9MB 3PXUA 3ANMA 4IJMA 4G25A 4LDJA 5CA0A 3COPA 5JYCA 3R7AA 5KTRA 2A1IA 1W5FA 3OE7A 4EMTA 3P7MA 3CRQA 1C0KA 4N12A 3C70A 4IQ8A 1T4DA 2VEDA 3RUCA 3EWSA 4ZZIA 1LTKA 3GLGE 3J27B 3J7BA 1UJ4A 5KTPA 3I6MA 4R7GA 7CATA 4OCZA 3BRWD 1ORRA 4I4IA 4WVFA 3VOBA 2OOKA 4G0MA 4CXMA 1MJNA 1EX6A 1YMVA 4GXQA 4G4QA 3HHXA 2BM8A 4MVYA 1YRAA 4OA8A 3SK0A 3T7EA 4BNKA 3KLBA 5BVGA 2H1OA 3K53A 5KDLA 4ZVRA 4BUJA 2QYSA 1NNSA 1EMDA 2YZ2A 2PA0A 2OGTA 4GMKA 5J59A 3KSZO 4QPCA 3T94A 5G0TA 4ZOLF 4BO9A 4EMSA 1JGTA 4IEFB 4QTTB 4CQMB 2XTMA 3BMQB 2J1LA 3I9LA 1A2KC 4A2WA 5I5EA 3QPCA 3II6X 3L7KA 3QXJA 1FY2A 2YS6A 5DLEA 1RC0A 1T1EA 1XCGB 2H3EA 4BNUA 3VK8A 5E95A 1GKUB 5ALQA 4KAXA 3OTOB 1ZJ4A 2V3WA 1U8XX 1EGAA 1TEVA 2ZE6A 2VDVE 4E88A 5AW7A 2XZPA 1LRJA 2BTQA 4ZQEA 3GI1A 4EABA 1DT3A 1HL3A 2F3RA 3RFCA 2ZZMA 4EY3A 3VYVA 2HK7A 3E81A 3I9V6 3DCYA 3KVNA 5HRUA 3KZ1E 2DQ4A 1E64A 4MGYE 2G83A 1ISMA 5DLQC 3Q7IA 1F9EA 1MVLA 3ZTTA 5LM3A 4F9TA 1SHZA 5TS2A 1N6OA 2X6TA 4XYBA 4DV7B 1TFUA 4OF4A 5A4IS 2Y76A 3MWFA 2C0QA 3RYFB 1B7GO 4CIZA 3IECA 4TQUS 4UD6A 3B48A 4OHOA 3ZV3A 2I4TA 3HH8A 3L02A 1ADCA 1XVIA 3OIDA 5G1OA 3RHZA 2PGIA 1G63A 4IBOA 2PAFA 1T0PA 4R1TA 4KVAA 5PNTA 3KWLA 1WBDA 4G0OA 4XSHA 4BATA 4Z51A 3SVTA 1J9EA 3DM5A 2UYYA 2O4UX 4OQQA 3WLNA 1QWOA 4DLSA 4PZ9A 1FP4B 1PG2A 5IU6A 3N05A 4JQSA 4UXIA 3EBLA 3BGWA 1KJIA 2HRQA 5E7JA 5LQKA 3MAAC 1CRLA 4WW0A 2V96A 1NNJA 3B6KA 3H2BA 4EHHA 5CJPA 5T7BA 2ZQYA 1XU7A 5H16A 2PKYX 3CV3A 3KUUA 3PUYA 3GPBA 3P0HA 4COKA 3ANYB 1NLZA 3ASZA 2BR4A 5A0FA 3FI9A 1W36C 1Z75A 2A3RA 3KSJA 1Z83A 1TZ2A 5KZMB 3U4DA 5L3VA 4IDHA 3KLMX 1ZY2A 1NDQA 1W59A 2MJLA 4A6DA 3EC1A 4C0HA 4MWOA 3LK6A 4R3UC 3ZWNA 2F43B 3IBCA 2H1IA 2Z04A 4KV7A 4QJ4A 1OGIA 3GQBB 4PYRA 3TM4A 3BTVA 2Z2ZA 1FUEA 1YMQA 1ZOIA 4JI8M 4PIMA 4TTAA 2BWJA 2O3TA 2BFFB 3CZ5A 4ZAFA 2C9CA 4DHWA 5AW2A 5KNBA 1N2CB 2WKRA 3RSOA 2RAFA 1GQQA 3WL6A 2VTDA 1ZBDA 1AMUA 3C3YA 2GPYA 3ORYA 1WO8A 2CLLB 5FQNA 3RVNA 4UTVA 1X8JA 4RANA 3LP6A 3R5JA 3BIWA 3W6ZA 4M9SA 2G36A 5LA6B 3VH1A 1RHMA 1UBNA 4A15A 3GFPA 3M4NA 4MV3A 5JQGF 3ZKAA 3COVA 2R7KA 4G3OA 1UFOA 3G2NA 3KSBC 4ZPXA 1RS0A 2GWRA 2HWKA 3D4PA 3ER8A 2XLBA 1SIBE 4EKEA 1LGYA 5AVWA 2VDBB 1JG4A 1OHHD 2BIFA 1Z13A 2G7MC