1SXJB

Crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
316
structure length
316
Chain Sequence
b'LQLPWVEKYRPQVLSDIVGNKETIDRLQQIAKDGNMPHMIISGMPGIGKTTSVHCLAHELLGRSYADGVLELNASDDRGIDVVRNQIKHFAQKKLHLPPGKHKIVILDEADSMTAGAQQALRRTMELYSNSTRFAFACNQSNKIIEPLQSQCAILRYSKLSDEDVLKRLLQIIKLEDVKYTNDGLEAIIFTAEGDMRQAINNLQSTVAGHGLVNADNVFKIVDSPHPLIVKKMLLASNLEDSIQILRTDLWKKGYSSIDIVTTSFRVTKNLAQVKESVRLEMIKEIGLTHMRILEGVGTYLQLASMLAKIHKLNNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activator 1 95 kDa subunit
publication title Structural analysis of a eukaryotic sliding DNA clamp-clamp loader complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
total genus 110
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00004 AAA ATPase family associated with various cellular activities (AAA)
B PF08542 Rep_fac_C Replication factor C C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1sxjB02
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 1sxjB03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1sxjB01
4KLNA 1N6PA 3B6EA 2QPOA 1RVDA 2BM0A 3FDIA 3SNHA 1XXHE 4NCHA 1U8YA 1G3UA 1T8UA 3IHWA 4PC1A 2O8BA 1M34E 4RFSB 4TL6A 1XTIA 3Q5EA 4D4KA 5JJKA 2XTNA 2BKEA 3C16C 1AIPA 1ZM9A 4RD3A 5FTJA 3BH6A 2PJZA 5TXGA 1E2GA 4EPXA 5K8LA 4JMPA 3AKEA 4IDPA 4HB3A 3VKGA 3JVUA 2F55A 1KI7A 3TSOA 1A4RA 2FSIA 3EASA 4PXAA 4XTCS 1XTSA 1VIYA 3BXZA 4C4PA 4PPQA 2D06A 3W9YA 1LY1A 4WBSA 1AK2A 1FTNA 4URXR 3REGA 5TARA 4HB2A 1EFRD 2B7CA 1T91A 2FFBA 3HR7A 3BE4A 2HT1A 2XJ4A 1OH7A 1G7CA 4Q01A 1K5GA 3I3SR 4M1KA 1KSHA 1OXSC 2H16A 5FI0B 4IOJA 4M8NE 3IDQA 3UWOA 4A2QA 1NNEA 3NEJA 4HLUC 2ORIA 2ZITA 3NC1C 3K09C 1D2MA 4UNQA 1DAGA 1G16A 2O8BB 5J5CA 1CJUC 3CF6R 1ZU4A 3UK6A 3UMFA 4NU0A 3T06B 3X1ZA 5JECA 2J1LA 2K5UA 2A3RA 3B85A 2Z83A 3Q3JB 4LK2A 1AQUA 2IS4A 1CLUA 3PR1A 4UNSA 2F3RA 3X1WA 5IF9A 1ZINA 1E0AA 2VP5A 5JCZA 1KJYA 2AKYA 1SVWA 3C5CA 1JEEA 4I1SA 1JQLB 2QRNA 3OE7A 2P65A 1IXRC 3V00A 3NDBB 2G77B 3KB2A 1U99A 4NHOA 1X8JA 1WE2A 4QFMA 2PMDA 2ONKA 4PAOA 1GG2A 4PHHA 4PC7A 1KI4A 5KDOA 2RHMA 3Q7QA 4BEBA 2JDID 2F1HA 4B32A 2NZ8A 2XSZA 1I4DD 4JLOA 3U60B 3RNLA 3I1FA 2VHQA 3MJHA 2J0VA 4LDJA 4LWZA 5FBLB 3QXCA 4EPTA 2IYZA 1NJGA 4W7SA 4OK3A 3ZH9B 4HAZA 1XTRA 2OLKA 4IEIA 1XWIA 3BH7A 2PX3A 1ELOA 2AN9A 3IKJA 3LBHA 1HY3A 4QBHA 1IY2A 3PVSA 1XD2B 1XCPA 1Z0FA 4L9SA 2IX3A 1D5CA 2RMKA 1ESNA 1N5LA 1ONBA 3B8HA 4HLCA 4DCUA 3OF5A 2QMUA 3GLHA 3P32A 2J7PD 3HPRA 1MO5A 4RY2A 1HUQA 4YLGA 3LRPA 3VHLB 3EZ6A 4MRRA 1KZ7B 3LY5A 2GJ9A 4LHXA 1OF1A 4L8GA 4Q1DA 5GJVC 4V0LA 4HATA 4MYUA 3QVUA 2VYFA 2E87A 4OK5A 2IW3A 4BASA 121PA 1EX7A 2A5YB 2VLIA 1ZRHA 2VP6A 4LJAA 5EE9A 5H68A 2J7PA 3I4LA 2CE2X 2FH5B 3NVAA 3ZD7A 1FNNA 3FKSD 1NVMA 1WXQA 4ZPXA 1Z0AA 1CEEA 1GWNA 1G291 3KXIA 5DNYB 2BBTA 3C5HA 3VHXA 4XWOA 3U5ZB 1E9CA 4AG6A 2DFLA 4XD7D 1UKVY 3BB3A 1PLKA 2WWHA 4IXNA 4YXWD 1AKEA 5L3SA 4OI4A 1HH4A 4OL0A 4QGHA 3N2EA 4MUAA 3RS7A 3U3RA 3ZZ0A 1I4TD 5G3ZA 1E69A 4FINA 4EKDA 1RRCA 2WAYA 2Z43A 3FTQA 5IDVA 4YDSA 1UKZA 1GFIA 4B2PA 4TMKA 1V5WA 4URYR 4A0RA 4XD7A 5LB4A 2OCPA 5L8VA 1Q22A 1GDDA 4NCIA 4D0LB 2WV9A 4B3BA 5L3QB 4OKSA 2RHDA 1IXZA 1SGWA 2WAXA 2Q9CA 2NQ2C 4S35A 2IA5A 4DDWA 3PEWA 4H1UA 5AJYA 4IDQA 4JLKA 2FN4A 4FMDF 4R98A 1D9ZA 3TKLA 2Z4SA 4FMBB 4C0HA 2VO1A 5B30A 3UG6A 2XJ9A 1II9A 4LI0A 1G4AE 4DSNA 1CR4A 1KO8A 4TSFD 1W36C 1SZPA 4GPTA 2MMGA 4RZXA 4HAWA 3EWSA 4Q9IA 1Q12A 4B3CA 4D6PA 4U7DA 2ZSDA 2W83A 4TT3A 3L82B 4FD2A 5L3SB 1AZSC 4E03A 4NMMA 8OHMA 2ZVQX 1RYHA 3B1XA 1CR2A 1NMXA 4W5WA 3K0SA 4MKIA 1DBSA 5HCIA 1NBMD 1GILA 4RD0A 4J0QA 1GM5A 1U8ZA 3UATA 4HB4A 5EP4A 4Z54A 4CEIB 3L0PA 1DAKA 4PR0A 4DIEA 1X8LA 2QN6A 2YOGA 3CH5A 1XRJA 4PO8A 1XEWX 1WCV1 2QP3A 3VR5A 4E5UA 1Q1QA 2YWHA 4RCYA 3E5HA 4YMWA 1P73A 3IPYA 1Z6YA 1X86B 2C9YA 2V4ZA 3LW8A 2W2VA 4B3DA 3QKSA 4CW7A 2ZAMA 3EG5A 1N6NA 3PUXA 2FPLA 4PQRA 3RHFA 2WJHA 5KSYA 2KBEA 3Q7PA 4Q4HA 1XEXA 4KV9A 4A8JC 221PA 2GBLC 3CO5A 1L4UA 4WZAE 2ZJAA 3R8FA 2PL3A 4JS0A 2R2AA 5E3HA 4KVGA 3K0EA 1Z06A 5FR1A 1SKYE 2QE7A 3U4QB 5AUQA 4HLUA 5KDLA 5J4VA 1NKTA 1Z07A 5A4JA 2CE7A 4EJSA 4DLZA 3ASYA 3PCRB 3UKDA 1G41A 2JLQA 3LXRA 1I4LD 4LBZA 1QHXA 1YZNA 3EZ7A 4AKIA 3O8CA 3CF0A 1GRNA 3DMNA 3RANA 4XSGA 4MH0R 5IK2D 1OV4A 1SQ5A 3MG9A 1OE0A 2EU8A 1WA5A 3OEED 2P5TB 3ASZA 2QW6A 4GOJA 1WDTA 3KKOA 1QHHA 5A5GA 2WIBA 5EE5B 2GZAA 4ARZA 1M74A 1U9IC 1QF9A 3QKSB 2HT6A 1T3LA 5JS8A 2BMEA 2VP9A 2H7VA 2REXB 4MQBA 4NL4H 2QT0A 4BFYA 2CNWD 5JBQA 1TAGA 1UEIA 3EPLA 2ZUCA 2G1KA 2YC2C 4DSTA 1RFLA 2CJWB 2ZRMA 2ZRBA 5CLQA 1XPUA 3AEZA 1IONA 5CM8B 3VMFA 4X8HA 4I99A 4LJ4A 4EJSB 4BFZA 3VFDA 2ZI6A 4OJQA 2VHUA 3QBVA 1UKEA 3EZ9A 4DWJA 2QPTA 3E70C 1CU1A 2KE5A 3CWQA 4Q5IA 3ZD6A 3KUDA 5B64A 1E0KA 1SXJA 3GMTA 4LJ5A 3FVQA 4JYBA 4NCKA 1N5IA 2NO6A 4NCJA 1EFTA 2FPKA 4MGZR 1KJZA 1G17A 4ZV4A 2FJUA 3OFNA 1QHHB 2FU5C 3QG5A 3ZLJA 2P6UA 2GETA 1NIJA 4AG5A 1XZPA 1U8AA 1JR3E 1VCIA 3W3ZB 1G5RA 2OV2A 4JSTA 3BGEA 2IYRA 3F3YA 1P61B 4URWR 2BBOA 3SBDA 1TNDA 3DO6A 1ZUHA 3U61B 1E2FA 2PZGA 4A6XA 3KB1A 1DADA 3QKTA 4BFXA 5FOWA 5C46F 4KI0A 1EFUA 2HF9A 2IS2A 3AVVA 2VF8A 5E7MA 4US0R 5FOTA 5H70A 5G40A 2V6IA 1XMIA 2A5DA 4Q4JA 5FPSA 2DFTA 3KW6A 2D74A 2NGRA 1N6KA 4XSHA 2XTMA 1SXJB 3LW7A 4K8OA 4FWIB 4A0GA 1U81A 2DZNB 2F1IA 4JL8A 4PC6A 3ZVRA 1J70A 3EZ2A 1N6IA 3L43A 4R7ZA 2VP0A 3K9HA 4Q1AA 3ZIAD 2HXYA 1AZTA 3AV0B 3C41J 4DLWA 1UDXA 4MYCA 2XOKD 4GP6A 3CRRA 5K8TA 1KDOA 3B82A 1XXHA 4LSGA 4PPGA 3DM5A 1A5TA 1US8B 4P33A 1D8TA 3ZZTA 2QI9C 1NY6A 3DKPA 2CL0X 1KK2A 1G7TA 3REFA 521PA 3AP2A 3ZIAA 3RS4A 3CLVA 2DWZB 3NBFA 4UXJA 2EFCB 1NVVQ 4B6FA 5BWMA 1F3OA 1E1QD 2P0EA 2WOJA 3K0FA 2XOKA 4GMDA 4B35A 4AY2A 1KDTA 1CR1A 1R7RA 2RGCA 3UXMA 2YZ2A 3GQBA 4GRAA 3M6AA 1N6HA 1OSNA 3U3OA 3R7WA 5JHGB 2EFGA 2GZHA 2EYUA 2GCNA 2KI5A 5DISB 4F91B 4D82A 2DZOB 4LBYA 2Z5FA 3I32A 4Q4JB 5KSZA 3CRW1 2GXSA 2WM9B 5JSZA 1ZMXA 4GOXA 3MFYA 5KYKA 1VKJA 1JECA 3AF2A 4CVNA 5J4YA 1Z2AA 2RGNA 1O87A 3K9NA 4GMXA 4OI2A 5F9FA 3O47A 4JL6A 1KKMA 1VCOA 1F2TA 4R2IA 2RGBA 2B92A 2GEVA 4LRWA 3RLFA 1LFDB 721PA 1XXHB 3CIOA 4TL9A 3QPWA 4LC0A 1HE8B 1KO7A 1T3SA 3W6NA 2BOVA 4ZCMA 2N1BA 3B1YA 1VG1A 5DO9A 3EA0A 3AP3A 3CNLA 1KO4A 1COWD 2AD1A 4E07A 3AVUA 1YR8A 2YYZA 3F5FA 1BOFA 1NLYA 1MOZA 3K0FB 4E09A 1E32A 1JI0A 3QXSA 4M1WA 2R9VA 1Z8FA 2O52A 3CF2A 3QEJA 5HE9A 3U3JA 1TL7C 1W36B 2IBMA 2V1XA 3KJHA 3QBTA 2YKGA 3C4JA 2ZE7A 4RKEA 3R7WB 3LWNA 4B74A 5KNCA 2ZI4A 2ZRFA 3EXAA 4A8JA 3THYA 1KKLA 1LV7A 2KSQA 2JASA 3KJGA 3QXHA 4BECA 5JSZB 1FFHA 1R0XA 3C15C 2YJTD 1E79D 4M9XA 1NSFA 1JXOA 2J3EA 4ASUD 4RKFA 2CCJA 4NONA 5JEEA 3AKCA 1OB5A 1N6RA 1IOZA 4CEHB 4A6PA 2PEYA 3NDPA 3QF7A 4N1AA 1KI6A 1UF9A 1U2RA 3KFVA 4KVAA 2WKQA 1E3MA 2XEXA 3GLGE 2C8VA 4JBYA 2I1QA 1TMKA 2IYUA 3CWZA 2OBMA 3PUYA 2PMKA 1Q1BA 4JIMA 4XTRA 2IEZA 3RS2A 1E9EA 3W8RA 5JS7A 3OEHA 4JLDA 4XOIA 4ZDWA 1E96A 2RKOA 3VTKA 4US1R 2XNDD 5C2JB 4ZCIA 3BFXA 1SHZA 1OIXA 3PFIA 4NP6A 2OCAA 4US2R 4C0SA 2QM8A 4D0NA 4FWHA 4KHZA 2P67A 4A8JB 4AKHA 2QMEA 3THYB 3EIEA 2KJQA 4IJMA 4OQMA 2HUPA 2QAGA 4QL3A 4Z51A 1NVXQ 2BKUA 1Z3IX 3T1TA 2XNDA 5FOSA 4A4DA 4CZ2A 1CKEA 1DOAA 3FHOA 1NRJB 1XCMA 4OQXA 3NHBA 2IWRA 4B43A 2XGJA 3TE6A 3O8DA 1KI6B 1QHGA 3R20A 3SZRA 3CB4A 1YR7A 1KOFA 1Q3HA 2CLDX 1E2JA 5SZHB 4Z1MD 1R5NA 4TLAA 4DDTA 4DB2A 5UKDA 5LB2A 1HURA 3GFPA 4P4TA 2J0QA 1QHIA 2BEKA 3NBYC 1A2KC 4QJ3A 2BJVA 1SVLA 3CX6A 2QMHA 4Q00A 1MO6A 2ZRDA 3X1XA 3SI7A 1ZC4A 5JI3E 3T34A 2IF2A 4DRZA 3I5YA 4G1UC 1K5DA 1RRPA 3A4NA 2V3CC 2FEOA 4YMTA 2QAGB 1DS6A 3BFVA 5LPNA 2ECKA 3PEUA 4U02A 3UIEA 1VCMA 3AUYA 2NO1A 2OAP1 2DR3A 5GJCA 1D2EA 4V0KA 2JJ2D 2KBFA 2Q3HA 1X6VA 3A4MA 3VAAA 3W34A 1FUUA 2GESA 5C4MA 3AVTA 5DHAA 5E95A 5KSOA 1T3HA 1FMJA 1W4CA 2XITA 3RRMA 4I4LA 1E2HA 5EE0A 4G5RA 4KSBA 4A2WA 1BIFA 1ZJ6A 2IHYA 3IEUA 1X37A 2MSEB 1XX6A 2JJ2A 4FW9A 5ANRB 1KY2A 1YVDA 3B1VA 2C03A 2WZQA 4JZKA 3MMPA 3KX2A 5CIQA 1XDBA 2GA8A 3GJ5A 3C14C 3GCGA 2JJ1D 2A30A 4RCZA 2CCGA 1GUAA 5EXSA 4GL2A 4DLXA 1KDPA 4A3VB 2OCYC 4UXHA 5JFGA 3MLEA 1YHNA 2A5GA 3R9XA 2ZAOA 3NBXX 3K53A 1ZUIA 1ZYUA 3CNNA 2FOLA 4XJXA 5EQTA 2NO9A 2JLYA 2C2HA 1H65A 1SVOA 4RFSA 2IEYA 5FPHA 3VLFB 4CF7A 1RRGA 4LV8B 4NDZA 4C0AC 2IWHA 4MYHA 1GSIA 2I1VB 4XVUA 5BN4A 2FX3A 5FL7D 3LX5A 5HE8A 1OPXA 1QBKC 2Q6TA 2A5FA 1IQPA 2JATA 2YNMA 3OAAD 4N0EA 2JLXA 2IC5A 4GFDA 4Z8XA 4JSYA 1DARA 5FPYA 3U7HB 4LV6A 2REBA 5KHOC 2H1LA 5F9HA 3DDCA 2XXAA 1F6BA 2OT3B 2GEUA 3B78A 1QHYA 4PZYA 1CRPA 3KXLA 3Q85A 1SULA 1KZGB 4B3XA 3BWDD 1YRAA 3OAAA 3CRQA 2GCOA 3IBYA 3FHTA 4YMUA 1LNZA 1UM8A 3LLMA 4NPHA 1NI3A 2W0MA 4GITA 1OJLA 2FGJA 2Q3FA 3M4YA 4JLPA 3L8ZA 1E2EA 4POAA 5G53C 1WP9A 3ONWA 1FP7A 2ZQ5A 3SHWA 3WHKA 4BFSA 5J4KA 2GZDA 4TN1A 4MA4A 1K6MA 2AFIE 4RD2A 4JVSB 3SDZA 1P9WA 3C8UA 3IIKA 2P3SA 1TU3A 1IN6A 1AGRA 1EG7A 1AGPA 4GOKA 5JWOA 4V0NA 1DO2A 2VIIA 1P72A 2PT5A 4Q9JA 5F98A 1ZW6A 2VHCA 2A2ZA 2A9KA 5P21A 1PV4A 2AFHE 1T5IA 2ORVA 2ZROA 4BQSA 4DLSA 1P6XA 1XTJA 4KYUA 3ZYCA 3SYKA 2QRZA 3LLUA 1Q1EA 2JLVA 3P26A 4ERNA 1Y3AA 1M1YE 1T9HA 2XXAB 3B2EA 2XX3A 4QHYA 2XZLA 2QM7A 5DYIA 1L7VC 1WRBA 3NH6A 1G21E 1T5LA 1P2UA 1SKYB 4QGFA 1GRRA 2GCOB 2XZPA 3Q8XB 3IIJA 2B6HA 2IXFA 1ZM2A 4TQUS 3SE0A 4MKHA 4RSGA 4URVR 1OFHA 2ZUBA 4TL7A 3BOSA 3ZGXA 5AUPB 1R5BA 4BLQA 2VRWA 3K70C 1OXUA 3IUYA 3Q9LA 3OE7D 4WOPA 5EUMA 2WPDD 4FWDA 3QKRA 1HT2E 3RSLA 4LJ9A 2VHJA 1M6NA 4MGYR 2ODWA 1KJWA 3A8TA 1PJRA 2DWQA 4DCVA 3SQXA 4DCSA 1XD2A 2YVUA 3IIMA 4LUCA 3THXA 1X3SA 2YWEA 1JAIA 3T1VA 2XSZD 1YR9A 3IBGA 1S96A 4M2LA 3BD9A 5CJ2A 1T8TA 1XJCA 4ACAA 2PX0A 1Z0DA 3ADBA 2QA5A 1EX6A 2QQEA 1P2VA 2WPDA 1NN3A 4QBIA 3FFAA 1T0HB 4QXAA 2FV8A 2ODBA 4BFTA 3GEIA 3KJEA 4D4LA 5EXXA 4PC2A 1ZM4A 1BKDR 2OE2A 1R8SA 3KTAA 2FFQA 4GBMA 4B75A 1AKYA 3W5IA 1TUEA 3J81k 4HZUB 3SJZA 4TLBA 1XB2A 2F9LA 2CLSA 3BH0A 1S8FA 4A92A 1ZD8A 4EFNA 5BXQC 1KMQA 3LA6A 2G1JA 5FOXA 3ZS8A 5J4LA 4B33A 3B1ZA 4IVRA 3PENA 3KL4A 3SN6A 1NL3A 5AWFC 1EGAA 2IK8A 1ZNXA 1KDRA 4BEJA 1KK0A 3AH8A 3QKRB 4YMSA 2R9GA 3ICQB 3A36A 4LOAA 4U5XA 1QG2A 1ZC3A 3GD7A 2V9PA 4C30A 3NEYA 1E2MA 2DFKB 5E7IA 4G3XA 4P4SA 2JLRA 1FQKA 3THXB 2ZI7A 2ZYWX 3KJIA 4NYMR 2VTKA 3I62A 4EPYA 2QAJA 4HLDA 1C9KA 3MCAA 1NKSA 1JJVA 2GJKA 2HDNB 3ZS9A 3RSOA 4LRSA 3FHCB 1A7JA 2EW1A 1E0SA 1HTWA 5L3QA 5L3RA 4AK9A 1G8GA 2IL1A 3GLFE 1JPNA 1QG4A 3KTAB 3QEOA 4DSUA 1NMZA 3BIFA 4GNKA 5EZ5A 2RH5A 4LHVA 2KRKA 2WKPA 3WBKA 2FWRA 3UG7A 1KSFX 1WBDA 2QENA 5JLJA 4Y0VA 2IYSA 4DBLC 2ERYA 1OT3A 2PZEA 2WJIA 2XB4A 5AR1A 1Z2CA 4H1VA 4IOMA 3RRZA 4ZDIA 4D81A 2QMOA 5EUQB 4UXIA 3WMFA 2PH1A 1W0JD 3VNVA 1CP2A 2WJGA 4P4SB 3QIAA 2W2XA 2W0SA 1E9DA 5BW8A 1M2OB 2FSGA 2X1VA 3AQ4A 3HJNA 3TRFA 4KO8A 1YQTA 4P3YA 2ZJYA 4TLCA 3QUSA 1BS1A 2JA1A 3SJBA 2C98A 4DB4A 4PO9A 4C0QC 4G5GA 4CEIA 2VH5R 4PQYA 4JBXA 1W0JA 1Y63A 2ZETA 3P4XA 4F7WA 2AWOA 2AL7A 3NXSA 821PA 2BVNA 1G5TA 2CLCX 4IOKA 4TT3D 1EWRA 4TTQA 3A4LA 5FBVB 3VKWA 3DM9B 4XWAA 3I72A 2GRJA 2FG5A 2YC4C 4ZIRA 2G6BA 1M7BA 3NBZC 3U7EB 2RGDA 2CHGA 4LGMA 1TX4B 4RD6A 5FUYA 1WBBA 2FF7A 3GEHA 1XEWY 5IT5A 4O0MA 4PHTA 5CLLA 4Q03A 1NG1A 1S2MA 1NP6A 1V43A 2QT1A 3B60A 4OI1A 4NYIR 4CRWB 3U4QA 2JCSA 1KO1A 2OEPA 3WBJA 4B34A 3GLGA 3D3QA 2PCLA 4JLAA 3S1AA 4M53A 2CCKA 2Q3MA 4LCBA 2YOFA 1JJ7A 2D62A 3NG1A 2R62A 1KHTA 1OLOA 3AM1A 1JB1A 1W0KA 4HAXA 4IXMA 2GILA 2UVQA 2VBCA 3AVXA 1SVMA 3CW2A 4K81B 4OHZA 4WZBE 3GJ6A 4M1SA 4AURA 5FTKA 4WIAA 4R2HA 2OFWA 1G8PA 1W4RA 4FI3C 3FOZA 1T6NA 2W2TA 4JLBA 2EVWX 4P4UA 1XTKA 1AN0A 3FWYA 2FSFA 4M21A 5EE3A 3T5DA 4C2UA 1ANKA 3LBNA 5GJBA 2DWOA 1IN7A 2E9SA 2EYQA 3AF1A 5GJWC 2VP2A 2ZTSA 4MGIR 3D7MA 1R4AA 5F2EA 2QE7D 1Z6TA 2NIPA 4URZR 4ZIRB 1RC8A 2DVWB 2FFAA 1XMVA 4ZKEA 1W4AA 4DEXA 5G3YA 3W8NA 5LD2B 2EFHB 3EZFA 4JLJA 4JN6A 1S3SA 2CJWA 4IW3B 1NJFA 1L2TA 3SFZA 3VR2A 1YZGA 3L0IB 4QC2A 2V7QA 3WRYC 3BFKA 3GLGB 1TPZA 3S1AB 2J45A 1XNJA 1J7KA 1S1MA 3BK7A 1XU4A 2CVHA 1DE0A 2OSBA 2WWIA 2FZLA 3IHLA 3K09A 3M0EA 4NBSA 4KAXA 2P6NA 3TR0A 1TF2A 1GL7A 3ND8A 1U0HC 1E2QA 1CF4A 4Z8YA 2GVDC 2IHBA 2D2EA 1P2TA 1DAIA 2NG1A 3ND9A 1UBFA 2ODEA 3NKVA 1S9HA 1G7RA 1YRBA 2FPMA 4C0BA 5JJIA 2R6DA 3LQQA 1QZXA 5DHFA 3FB4A 3AF3A 3ICEA 2L0XA 3DEFA 2BEJA 3KKPA 4HEJA 3K1JA 4V0ME 5J47A 1F60A 1XF9A 2OBLA 4TQ9A 1EFCA 3FMFA 3I73A 4V02A 4BFWA 1SHKA 4ESVA 1G6HA 4NYJR 3OHMA 3PQCA 4BUJA 3LD9A 2ZR9A 2IUSA 3KDSE 4W5JA 4PO1A 1VHLA 3KKMA 1JBKA 2H5EA 2Q9BA 4IFBA 4UKDA 3RS3A 1SXJD 4F4CA 1XMJA 2SHKA 2ZJZA 2AHOA 3HDTA 1MO3A 3K70B 2G88A 4MITA 4EIWA 1N0WA 4KXFB 1Z47A 1EFHA 4D80A 1ZCBA 3FMIA 1GNPA 3OFND 3A1TA 4I1UA 5CB8A 4EAQA 1E99A 4TWZA 3WNDA 2HF8A 1ZIPA 4C2TA 4TL8A 3TAHA 4BZXA 2D3WA 5JHHB 4C0LA 1YZQA 1U98A 4B48A 3BORA 2CK3A 2J41A 4Q1CA 3TQCA 1FL9A 3MWJA 3NIBA 5BN5A 3W90A 4LC1A 4HI0E 1ZP6A 4JLMA 4R71A 5EXPA 1XP8A 4KJZA 2NPFA 1US8A 4AYWA 1XEFA 3TAUA 3EAQA 1G3QA 3TVTA 1BYIA 5CIWA 2MSDB 5FTNA 1YZKA 3GJ8A 5JZVA 1BYUA 2GXAA 3RVBA 1YR6A 3H84A 3K0AA 4KU4A 5CK4A 4DLRA 3TSZA 1KAOA 2WIAA 4AKEA 4CT5A 2GTPA 3EPJA 2OFOA 3WMGA 3N70A 2C5LA 5FI1B 3SFVA 4Y0AA 1KI1A 2NOAA 4BFVA 5DSZA 1DEKA 3GP8A 3BB1A 4PFSA 1DAEA 3FMOB 4Q9KA 2VQSA 2QPAA 1WQ1R 2N42A 2QGNA 5FBQB 3CX7A 4MRPA 4M9SA 5D3QA 1E4VA 1K8RA 1Q21A 1OXVA 1XZQA 1ZU5A 4KBGA 4IEEA 5B58C 1W36D 2RB4A 1P4SA 2WJVA 4TMXA 1LF0A 3FPAA 1EK0A 1P62B 4PAQA 4KFTA 1UJ2A 2BHRA 1E9RA 1ZIOA 1FZQA 1VG8A 4BWYA 2J0UA 1Z6GA 1KI9A 2Z0MA 4DXAA 5KDDA 4EQ6A 4QBGB 2ANBA 2W6IA 1W1WA 3PUZA 4JBWA 3K0AB 3DPUA 3QF4A 2FE4A 2MSCB 2IS1A 4DDUA 4Q7MB 3CX8A 1LS6A 1FOEB 2XTZA 3MJRA 4BE7B 2XNSA 4DUGA 1D9XA 4GP7A 4O3MA 4QJ4A 4F92B 5B2ZA 1II8A 4YQFA 4JKIA 5BQ5A 2Q21A 4S2EA 4CEHA 2RCNA 1II0A 1M7GA 3SU8A 5EP3A 2QG6A 4UJ5A 3T15A 2QUZA 1RKBA 4A1FA 5AK0A 1H8EA 2QTHA 1E9FA 1DPFA 3LO5A 3Q72A 1NIPA 3CR8A 4LYFA 4R9UC 2ZREA 4B6EA 2IT1A 5TY0A 2BCJQ 2G0TA 3W5JA 4TMZA 1UBEA 3D8BA 2OBNA 4FCWA 2J0UB 4JLNA 3SJCA 4ILEA 1TEXA 4BLPA 2OESA 4LX0A 4A82A 1Z0KA 4HYYA 4EQ6B 5J4HA 1Z63A 3EPHA 4P32A 2IS6A 4IDNA 1PUIA 1W4BA 2C96A 2WJYA 5AUNB 2NZJA 4WZ6A 3K0CC 1LF5A 1VYUA 3QF4B 3WNCA 4I81A 1XD8A 1GKUB 1KI2A 5FPKA 2GBLA 3TNFA 3AJIB 3RC3A 3FMPB 2ZI9A 1B23P 4D4JA 2HYIC 4LPSA 4XWKA 1EWQA 2GAOA 1FX0B 4QNRA 2MMCA 3WY9A 2C95A 2FFHA 4JYCA 1Z0IA 1AS3A 2TMKA 3LVRE 5TV2A 4DZZA 1II8B 4OYHA 4L4UA 1T0JB 3OEHD 1QHNA 3TSWA 2P5SA 4Q7KA 1RW4A 1Z29A 3B9PA 4DCTA 3T1QA 2JJ8A 3VR4A 2CVFA 3V4FA 2VF7A 2AXNA 5M04A 4AYTA 4GDFA 4JVNA 4BPBA 4UQOA 4QM7A 1IBRA 2GJSA 4BLTA 5JEDA 1G3RA 4JT2A 1VMAA 3PEYA 3B5JA 2UZ3A 3QPVA 4OQNA 4L16A 4DEYA 1FPMA 4M9ZA 3EPKA 3FYHA 5CDFE 2OXCA 2WBLC 4TTRA 4C0KA 3KQHA 3CKLA 1U9IA 4PC3A 4PHFA 4LRTA 4EFLA 1LS1A 1OXXK 1Z08A 2JAQA 3BERA 1S0UA 2IYLD 4Q48A 2ZJBA 3SOPA 3CTDA 2WMOB 3SJAA 4LJYA 4HAVA 3BBPA 3K8YA 2ZS7A 2ZJ2A 1JEDA 1E9BA 1R6BX 2EWVA 3Q5DA 5CYPA 1JAHA 3TQFA 4B76A 1OYWA 3GLFA 3SQWA 2CL6X 2J0SA 1BH2A 4LV5B 4G5QA 2ZI3A 2ZSAA 5B57C 5E7JA 4TYNA 3CBQA 1KO5A 3VR6A 3MD0A 1NVWQ 3QSYA 2O8CB 1F5NA 5KNBA 1GTVA 1NBME 3TMKA 5TB5A 1DAFA 3LDAA 2CHQA 2CMKA 1UAAA 2B7BA 4D0GA 3ADKA 1ZD1A 4BLRA 3HU3A 1UKYA 2ZSEA 1J2JA 1C1KA 2KB0A 1SVIA 3GJ4A 3L8YA 4Q4LA 1Z0JA 4EPVA 1CBUA 4TYWA 1VG9B 3ZZUA 1IJFA 5FTLA 3QI2A 2ZYUX 3A6PC 2C04A 2PT7A 4QNMA 4OQLA 5BYJA 5FUWA 2PBRA 1DG3A 5CB6A 4KFRA 2JIZA 2VL7A 3EC2A 3LFUA 3GLFB 4QKQA 1DVRA 2XB2A 2D4HA 5JWHA 1RIFA 3N5CA 2IYTA 2J5XA 5CK5A 1CULC 2NO7A 2VA8A 2WMNB 5FTMA 2BDTA 3AVPA 5KU1A 4MYTA 3DOFA 3TGPA 4DT1A 2DY1A 2G0NA 3CZPA 1OFUX 2VPPA 1GZSA 1MV5A 3AGPA 1E0JA 2ZXUA 2AK2A 2ZIAA 4B3FX 2UKDA 2ZRJA 4D25A 3KFXA 4V03A 4N0DA 2ZE5A 5GADl 2HCBA 4ZKDA 1WB9A 3QJYA 1VYTA 3U6BA 1G20E 1AS0A 1Q44A 3ZVLA 4HDOB 4CDGA 1TF5A 1ZNWA 2J59A 3ECCA 4HDQB 1FNMA 1ZNYA 1Z28A 4BRWA 2ODNA 4AWXA 2W58A 4HLQB 1O3YA 4DDVA 1CXZA 3LXXA 4AIIA 5KO2A 4QBFA 1H8HD 1W48A 1GNRA 4KYIB 2ZJOA 2QBYB 4PPFA 1S4QA 4QHSA 4TQAA 2AWNA 2RGXA 3R8CA 1JNYA 5LDDC 1OYYA 4TMTA 1NLZA 1W2GA 2QEQA 3ADDA 4JT4A 4DT1B 4FCTA 1E94E 3AVWA 3GFOA 2I4IA 1YZTA 3HR8A 3OIVA 2NO0A 4JVLA 4OJKA 1KSJA 3L0SA 2WSSD 4DSOA 1H8HA 3K9GA 2IYQA 4TMVA 3ZDQA 1HT1E 4G01B 4ACBA 4E22A 4RFVA 3IQWA 1MRSA 4DIDA 1OFIA 4L5BA 3X1DA 4JL5A 1VPLA 3AF4A 2O8DB 3I5XA 2Z6VA 4Q1EA 4LYHA 4EFMA 2IYVA 3MHVC 3CRVA 2WSSA 4Q1BA 4ZDJA 5DN6A 1GKIA 2GXQA 5BYKA 1E2PA 4YMVA 4QHTA 1NG9A 1GRQA 3B13B 1KTVA 2CL7X 4HAUA 1G9XA 4RD1A 2ONJA 3DZ8A 5KNDA 1KSGA 2XAUA 3LX8A 3RS5A 4IOLA 1NSTA 3QPUA 5DI9A 4CGZA 4V0OA 1XD9A 3NWJA 4G0NA 3RAPR 2H17A 2V54A 4D26A 1QZMA 1TU4A 1GITA 3GLIB 2JLUA 4FWGA 1M8PA 2V1UA 3RDPA 5FUVA 3NTUA 1ODFA 2ZRGA 3GEEA 1QHSA 1YZLA 1N0UA 3MUFA 1TUIA 1KMHA 2HEIA 1W49A 2RGAA 3OESA 1RRFA 1HQYE 2F1JA 2GAAA 1IJEA 1DAHA 3RRNA 1LB1B 1WMSA 2ZEJA 1Z83A 1KGDA 1QVRA 5EP1A 1UDWA 1KYIA 2ZI5A 3A1WA 4YONB 3AKDA 5HPYB 4HZUA 3LVQE 3NH9A 4PSAA 2ZRLA 1IHUA 3LAWA 3E2IA 4DLUA 2D2FA 3K9LA 1MO4A 1P60A 2CEAA 2GHIA 2QL6A 4KCGA 2V55B 3TH5A 3IILA 5JRJA 2R65A 1GOTA 4HUQA 4IKEA 1OXTA 1Z22A 1NVVR 2FA9A 3VNUA 2B8WA 4D4MA 4MRNA 3VU9A 1CTQA 3AF0A 2IXEA 2GNOA 1G19A 1GKYA 1JR3D 1E4YA 2ZRIA 3H2YA 1ETUA 1F2UA 3LQRA 2QY9A 3WP0A 4DLTA 2ZRHA 2QNRA 5C18A 1D2NA 3AKYA 2EFDB 3P1JA 5A0FA 4FWTA 4ITRC 1JR3A 4A0FA 4LYJA 1C1YA 4FMCB 4FXPA 5EXTA 2BBWA 1NY5A 3TVDA 4JVMA 2QP9X 1KMHB 3U44A 1W5SA 2X2EA 2G3YA 3RRYA 4Q7JB 2QTVB 1L4YA 4EJSC 1NN1A 4I1OA 4FIDA 1AA9A 1EFRA 1X8KA 4ZCLA 2ZM5A 5J40A 1Q3TA 5HTKA 3SYLA 4PSVA 2ZU0C 3VX4A 1XCGB 4G5OA 1YE8A 4HUQB 621PA 4L15A 4GT1A 3RABA 2WWWA 3VU9B 5H1YA 2GJAA 1WF3A 2HCJB 5SZKB 3U6KA 3V9PA 3KQKA 1F2UB 4WA7A 4C0JA 1JPJA 2J87A 2FNAA 1E9SA 3CUEF 3LH5A 1VG0B 3AB3A 1AQYA 1G18A 4A0HA 1P5ZB 3ZVMA 4M4SA 2BM1A 2C77A 1OH6A 3TBKA 2C99A 3D31A 1P2SA 5TDHA 1DG1G 2X2FA 2DPXA 2H92A 4NTZA 1SKQA 4W5HA 1GP2A 1YKSA 3UANA 5K8IA 3IEVA 3EA5A 4BZPA 3U44B 2ZSBA 2V6ZM 1Z5ZA 1L8QA 2JDIA 2WWFA 1CJTC 3MRSA 4PX9A 1TQDA 1E6CA 1OH5A 3CPJB 2DHRA 1NN5A 1MH1A 2IF0A 421PA 2ZSFA 1SXJC 3CONA 5DYGA 3EIQA 2WTUA 3UPUA 1J8MF 3BAFA 1U94A 2FGKA 3G82C 1VIAA 4UNPA 3EARA 3QE0A 2I3BA 5AJVB 2YINC 2R6GA 1G1MA 1IN8A 1DELA 3A1UA 4FCVA 3HYRA 4Q1FA 2D7CA 4QJ5A 3TJZA 3CM0A 4ON9A 4LHYA 2B8TA 3BGWA 2F9MA 4LHZA 5AJZA 1VCNA 2ORWA 2QORA 4QG7A 2H57A 3TR5A 5JCPA 2QSYA 2IYXA 3AUXA 2ZRAA 1TTTA 1FMLA 1CR0A 1IAQA 1VYVA 2BWJA 2GDJA 2OUKA 1VECA 4ZO4A 1XPRA 1RZ3A 4OI0A 2BCGY 2WHXA 3KZ1E 2GKSA 5KPJA 4LJ6A 4HSEA 1J90A 2O0HA 4BLSA 1IM2A 1KK3A 3EW9A 3QENA 4P0TA 4Q19A 3DZDA 1TADA 4X8MA 2PJRA 5FL3A 5K8UA 1EESA 5AUOB 3FKSA 1G64A 4GZMA 2HV8A 1U90A 5CJPA 1J8YF 1GL6A 1E2IA 1E1RD 3GLHB 5IRCD 1S9DA 1R0ZA 2WOOA 3V4RA 3BC1A 2NMVA 1R0WA 4YXWA 5HCNA 4JJZA 5FH9A 4DJTA 2FMXA 2RGEA 3SC3A 2WWYA 1W0KD 1P3JA 1YZUA 1PUJA 1VDZA 4OHYA 1CRQA 4LPKA 2ASEA 3UMRA 1UEJA 1E1RA 2C9OA 3GJ7A 1DTSA 4LJ7A 1HV8A 3OIWA 1MKYA 3FGNA 3AVOA 1I2MA 1SVSA 5DLQC 3T12A 2LWIA 4M1TA 4LZZA 4F38A 3PUVA 3EC1A 2H18A 3BRWD 5CDFA 2BMDA 4WVFA 4XVRA 1OB2A 4IFEA 4L9WA 2JLWA 1XJQA 1G8HA 2VHTA 1E2NA 3PITA 1HE1C 4JJKA 5ELXA 4RD4A 3VQTA 4OBEA 1XJ0A 3PUWA 2ERXA 4CT4B 4TSFA 1ZCAA 5SZIA 1W7AA 1R8QA 2RGNC 3CPEA 4X8OA 4KLZA 1GVNB 4YC7A 4F93B 1PLLA 1ZBDA 3GLIE 2GEDA 2QSZA 2V7QD 2YWGA 5AJXA 4A9AA 2WKRA 3PXGA 3K70D 3VR3A 1P75A 4TLEA 2NTYC 4UJ3A 2QZ4A 4TYYA 2DWPA 2X77A 1NBMA 3ZJYA 4ZI3A 2BJWA 3ZQJA 2DB3A 5FFMA 3WXMA 3KKQA 4MKFA 1LVGA 3QY0A 2CXXA 4OHXA 2ZS9A 4LBWA 5FBRB 1TQ4A 2GCPA 3H1TA 1QRAA 3O8BA 4ZI2A 3P27A 2R6FA 3PG5A 3MWKA 4RZUA 3U3MA 2JLZA 1G6OA 3WYFA 2WSMA 1IY1A 4QOSA 4NZYA 4A15A 4C9BA 3SR0A 4DCNA 3WNBA 4AD8A 3FKQA 2GWHA 2Q9AA 4OQFA 4DLYA 1OHHD 5KPDA 4DKXA 2FEMA 2F6RA 3TIFA 4W9MC 2FSHA 5C1BA 3CR7A 4MRSA 1OFTA 1G4UR 1YJ5A 3TK1A 4Q21A 1VHTA 4PHGA 1E98A 2DFNA 2BV3A 2PZFA 4JKYA 4N3NA 2BIFA 4KITB 1X1SA 3CNOA 5FOUA 3W6PA 5CITA 3T61A 3KXKA 1XFAA 3KKNA 4TYQA 1OHHA 4IHQA 1G3MA 2ZR7A 2QGZA 1KI8A 2W00A 4OHVA 4TMWA 5KTYA 1RYFA 1HYQA 4A36A 4P31A 4EPWA 2DCUA 3F8TA 4MRVA 1U0JA 1Z6AA 2CK3D 3H0KA 2OFXA 1MRNA 3GFTA 1CS4C 4O2RA 1NVUQ 1W46A 3IPXA 2IUUA 2ZANA 3THWA 4M1YA 1E2DA 2J9RA 2EQBA 4M0LA 3UWKA 4MDEA 3SBEA 5IK2A 2WVJA 4BLOA 4Q4HB 1XEXB 5D3MA 2ZJ8A 3HPQA 1UBCA 3PV0A 4HB0A 4OHWA 2RGGA 1NLFA 1QVAA 3OEEA 2QAGC 4F4IA 2O8EA 3U2QA 3HYTA 4NH0A 1N25A 3QKUA 2IYWA 4Q47A 1G7SA 1UPTA 2BC9A 4RVCA 2IXGA 4QGGA 5HR5A 2CNWA 5FOVA 2KWIA 1I2DA 2ZPTX 1TEVA 1ZUNB 3FE2A 3KQUA 1KNQA 5CM9C 5JJLA 3HWSA 5H8WA 1RPZA 4II7A 1A2BA 2AK3A 1CJVC 2WICA 3TUZC 1N0VC 4PSKA 2ZRCA 2C9CA 4M22A 2PEZA 3IQXA 2O0KA 4BRUA 4PQFA 4MUBA 4I1VA 4A2PA 5EP2A 4HZIA 4K46A 2ZVPX 1OIVA 1IN5A 2UZIR 4WXRA 4ARZB 4TTPA 4HUTA 4BGDA 4AKGA 3EIHA 4TYPA 4KBFA 2QTFA 2HYDA 3THWB 2Z4RA 2F1RA 1UADA 2J7KA 2ZS8A 4TLDA 1N5JA 4URUR 4IRUB 5LBIA 1JQJC 1HA3A 5D3MB 3G5UA 1UBGA 3EX7C 2GXUA 1ESMA 2F43A 2OO7A 1MT0A 1ZAKA 1AJEA 2O8EB 1CJKC 1IY0A 3AP1A 1FP6A 2E1RA 4RJLA 3PEVA 4NKRA 3H86A 2AKAB 2W6ID 2ZR0A 3CRMA 3JZAA 2BMJA 1AS2A 3U7FB 1QDEA 1OW3B 1UFQA 1A82A 3B9QA 4B2IA 4O25A 2ANCA 1S1CA 5EZ6B 1Q0UA 2YHSA 1W44A 4DUGD 5HKKD 4M9QA 2ZRNA 4XVQA 3WYAA 2AX4A 4QGAA 3CZQA 3LBIA 1Z6XA 5EJEA 4HAYA 4MGKR 4HDCA 3WYGA 3X1YA 3GLHE 3AGQA 3WHLA 1R5OA 3E1SA 1H8ED 4TZ6A 2V8OA 2ZE8A 5DIFA 3M1IA 2AD5A 4LBVA 5HKKA 1FX0A 2F43B 2GK7A 4IDOA 4LJ8A 4GSYA 2ATVA 1IXSB 2WJJA 1G5PA 2F7SA 4UNNA 5GVRA 4B71A 5KUTA 2YWFA 2WWXA 3AVQA 3DVLA 3QG1A 2LCFA 3QOFA 4LYAA 2OM2A 5L3VA 4M1OA 4B3GA 2GF0A 4H9GA 3CPHA 1LTQA 2VSOA 4AYXA 2A7QA 4B2LA 4F4JA 2D7DA 3SS8A 1PVOA 3ZQ6A 4AI6A 1E1QA 2OG2A 5IHPA 1R10A 5E4FA 2R44A 1Q1ZA 3GJXC 2A78A 1HEIA 3P4YA 4FMDB 3VX3A 2HLDD 1N2CE 4CYMA 1MABA 3O8RA 4Q9HA 2AR7A 3RS0A 2GF9A 3TUJC 4QM6A 1XBTA 1E9AA 2PCJA 3VR1A 1OKKD 1ZM7A 4YDHB 4DC9A 4GZLA 2ZJ5A 1GIAA 3D6TB 5C4GB 4AC9A 2OILA 1N6OA 3NHAA 3C7KA 2OLJA 1W5TA 2OHFA 2DBYA 2IYYA 4Q9LA 5DH9A 3IO5A 4EPRA 2HLDA 2JGNA 5KSPA 3THOA 3QQ5A 1FQJA 1G3IA 1FW6A 4PZLA 1B0UA 1OKKA 2OZEA 5SZJA 3VKHA 2O8CA 2N46A 1LW7A 3A1VA 3W3AA 1T4GA 1RJ9A 4IVQA 4DLVA 1P9RA 2ZRPA 5DE3A 5TMPA 4KFUA 4LY6A 4FMCF 4UNRA 3H4MA 3PIRA 1KIMA 4PPNA 1COWA 1P7CA 2QQ0A 4IVPA 4WXPA 1FTSA 4FN5A 3SHFA 3QXJA 5KOYA 2X8AA 3R9WA 4NYMQ 1KAGA 1OIWA 1Q20A 5FBWB 2C78A 5FR2A 3I8XA 3TW4A 3F0TA 1G8FA 2PLRA 1MABB 3IO3A 5FUXA 1F2TB 1XMSA 3MAAC 2EFEB 4C3ZA 2VSFA 3L2OB 2GJ8A 2R8RA 1GNQA 3TW8B 3I92A 3HU2A 3OZXA 4IDHA 2LKCA 1TQ6A 2XZOA 3HU1A 4PAMA 1E79A 2OAQ1 2R6AA 3A58B 4PZZA 4DVGA 3KQNA 4ASUA 1N6LA 2RAPA 1N5KA 2WWGA 2HXSA 1DAMA 5F3WB 2FZ4A 1NMYA 4Q02A 1C4OA 4U00A 4EUNA 4MKGA 4Q4AA 2CBZA 2W6JD 1X1RA 4WW0A 1RJ9B 2J46A 4B73A 5GVSA 2QU8A 4RZ3A 3NC0C 4MDFA 1ZM3A 4B47A 3L0OA 2VP4A 4CIDA 1GAJA 2JIZD 2ZRKA 1MR3F 2OCBA 2O5VA 3DL0A 4RZ2A 4ZDKA 2W6JA 1NN0A 2P2LA 4PANA 2YOHA 2IUTA 1PZNA 4XH9B 3RC8A 2OXRA 3U3KA 3I8SA 3WP1B 3UMSA 2ATXA 4XIGS 1N3BA 4NE2A 2AXPA 3DKVA 4ABYA 1XPOA 2O8FA 3ADCA 2GVZC 5HZHA 1E2LA 1OH8A 1PLJA 2H8KA 4ESHA 1SVKA 3TLXA 2QROA 3JZMA 2QBYA 2PLFA 5TVKA 2B21A 3X2SA 3MSXA 4DHEA 2DYKA 3CH4B 1CIPA 1KK1A 1ZNZA 3ETLA 1AM4D 4Q4AB 2X19A 3A1SA 4Q18A 4Z1MA 3WRXC 1J99A 4TZ0A 1DO0A 4KODA 1RE0A 1XTQA 2CDNA 3WMEA 5JRZA 2O0JA 3HP1A 1ZD9A 3B1WA 1JALA 3MWYW 1A1VA 4CEJA 5JWRA 3ZVNA 1M7HA 3T1OA 2R6CA 3GJ3A 1TF7A 4NYIQ 5G41A 2BMFA 4EDHA 3TUIC 1U0LA 2O8DA 3P20A 4X8LA 3QVVA 3QNUA 3B7GA 4O2LA 3FFBA 2JEOA 1Q57A 4BFUA 3KQLA 3R9IA 1NF3A 3SEAA 3OIYA 5JI2E 3MGCA 2JLSA 1FUKA 4KSCA 4D2IA 3MWLA 3GPLA 1E2KA 1EXMA 1KI3A 1VTKA 2V6JA 2O8FB 3QXXA 5CYOA 2ZE6A 5BN3A 4C7OA 1F48A 4PTLA 2REOA 5DI3A 2A5JA 2G83A 4JLVA 2NPIA 3T5GA 1G8YA 2HJVA 3KUCA 1W2HA 1SXJE 4GI7A 4Q7LA 1GL9B 1D6JA 4LHWA 3GLIA 4B44A 2P6RA 1W47A 2EWWA 2ZUDA 3JVVA 3I61A 1BMFD 3RWOA 1IN4A 2BBSA 1YU9A 5DN6D 4CEJB 3DOEA 1P9NA 3T35A 1JR6A 3G0HA 2LKDA 3BJIC 5EE1A 2HJGA 2QP4A 1BO6A 1KY3A 4M1MA 1JXMA 3IGFA 2JJ1A 1BMFA 2VEDA 3LNCA 4BZQA 1R2QA 2ZU6A 3DHWC 1ZVQA 3BS4A 2FDCA 1S3GA 3W6OA 2ZYTX 3GJ0A 1HQCA 2ZYVX 3LV8A 1R0YA 5DGXA 2Q0HA 3DMDA 2GK6A 4OK6A 2YV5A 4G5SA 3PJRA 3SYNA 3BB4A 1KNXA 5FPTA 4C7OB 4WAUA 5JMTA 5DI3B 3U7GA 3AVYA 5FL7A 5HZKA 3A37A 4QRHA 2F3TA 2VSXA 1CJMA 3RYTC 2G9NA 3K0CA 5AJWA 4V0MA 4KFSA 5LD2C 3N2IA 2CHVA 3RWMB 6Q21A 2Y8EA 4NCNA 1TQ2A 3OIUA 4NYJQ 4Q66C 3EWAA
chains in the Genus database with same CATH superfamily
1MENA 4KLNA 5BV1A 1RFGE 2YV1A 4HNTA 3VV3A 4ALJA 1QP4A 1XXHE 4C21A 1X77A 2XTNA 3EPRA 1E2GA 3AKEA 3ZE6A 4RIFA 4ICIA 5FRDA 1PEKE 1CUVA 4PXAA 3U6PA 1GTG1 1VGVA 2EDAA 2MR9A 1XNRM 3H7AA 3D3EA 4A2QA 4QVKA 1RXYA 2NU6A 1F9AA 1NP3A 1F2VA 3QNMA 1PRYA 1P9LA 1CJUC 3T06B 3WKAA 3HMQA 1AQUA 2FETA 3WSWA 2ZZMA 3NASA 3V00A 1R9GA 3GFGA 3NIDB 2ZIUB 1IVSA 4BEBA 1IVYA 2Y0BA 4LDJA 2C3OA 3KUXA 1YR2A 4YRRA 2FWBA 2R86A 5DM1A 1B6TA 1NDUA 2RFLA 2C2XA 2OLKA 3WGUA 1TA9A 3N39C 3SAVA 3J27B 2QMUA 2HQBA 3N6VA 2P9TA 4RY2A 2F8MA 3ULKA 4LHXA 1HOXA 4B6RA 4WNAA 3I4LA 3KOZA 3ESXA 3DLPX 1PR5A 2BEVB 3DOUA 3IAM6 4L5YA 1TD9A 1E9CA 1RLTA 3RS7A 4PIMA 3DE6X 5IXJA 4TMKA 5KX5B 1EE8A 4QFDA 2LIVA 4A91A 5AJYA 4O29A 3JWPA 3M6FA 2AQ8A 4UAUA 1NVMB 2L42A 1KZHA 1GCIA 1AUAA 4GPTA 2BFFA 4EW1A 1LC0A 2NZUG 3TLJA 3Q3CA 5CFQA 1MJFA 4LFBM 3VR5D 1VL6A 1GILA 1R0KA 1DC7A 3B7ZA 1VJ5A 3H5TA 1IN1A 3WNVA 3WGOA 1M3SA 4XX0B 4IP0A 4WZAE 3T9EA 2R2AA 3SKYA 2C20A 4R1MA 5ESXA 5KDLA 1T1SA 3ZOKA 3CHYA 1QHXA 4H7FA 3E8SA 4MH0R 3IPCA 1WA5A 5ESWA 1QHHA 5A5GA 2WIBA 1DGBA 1U9IC 2BMEA 1GPLA 3M1AA 3SZ3A 4BBZA 3EZGA 2Y3IA 1B00A 2A4MA 4BLCA 5IN4A 3VMFA 5LWQA 4LJ4A 1SC3A 2FEWB 2ZI6A 2H54A 3JAWB 1N5IA 2Q1TA 3KR0A 3DNMA 4ZV4A 2A9QA 1F0YA 3PI6A 3K71B 2AN4A 2VXBA 3R74A 3FZEA 5C0OE 3TTXA 4M0FA 2EJBA 4GLJA 3DO6A 2ZBEA 5B7GA 5LP6B 3LMMA 4Q4JA 4X6UA 1N6KA 1SXJB 3EFHA 1N6IA 4R7ZA 4O33A 4DLWA 2ORED 1WQ3A 1XXHA 2COUA 5BV8A 1WJ7A 1KYTA 4IGIA 1NVVQ 4ETMA 5M5BA 1J56A 2Z5LA 4BVGA 3CRW1 5JSZA 4KV7A 3RRFA 4C6SA 4ZANA 1WW3A 3V8BA 3ZCPA 4IRXA 1T3SA 4DA6A 3CNLA 5I7SA 1PJIA 3F5FA 4XIFA 4BDTA 1U2DA 3CUYA 3QEJA 4G4IA 2PAFA 3UNXA 1DTEA 4B74A 5KNCA 1ZNQO 3THYA 3A1NA 4AG3A 3SAJA 5EQDA 3O31A 4ZZ1A 3ELWA 2AYZA 3RU3A 3TF5A 3RFVA 2UVPA 3HKCB 2Y1WA 2JAHA 5F1PA 2W11A 1EAMA 1PNTA 3OZRA 4UVGA 2I7TA 1TMKA 2IODA 5EI5A 3RS2A 1X39A 1E9EA 4IYJA 4ZVPA 1PL7A 4AJJA 2QJTA 1BE6A 2VYNA 4YR7A 3PFIA 2XNJA 2BZ0A 1KVUA 1QLJA 1E1YA 3TE6A 2XKAA 1U8CB 2Z9DA 4WFIA 2JAOA 1DBWA 3GFPA 1NZFA 3N53A 1A2KC 1TU0A 3CX6A 1MO6A 2IHNA 4HTFA 1KVSA 4MTCA 4JGBA 2HA6A 2ZTDA 4F4UA 2F67A 1YKGA 3L8EA 3VAAA 4NAUA 3GF4A 1WHTA 1FMJA 3RRMA 1E2HA 5CT9A 1E3TA 2FWPA 2C03A 1BVYF 2V7PA 1EUCB 2QRUA 1S2OA 1DFIA 4UXHA 4YJFB 2BFOA 3HCNA 3I5UA 1JL3A 4MGIE 1U2ZA 1J9GA 2R6ZA 2VK4A 2P91A 1HDIA 4CI9A 2P9EA 2A0YA 4WZAA 2O20A 5IDXA 3HCEA 1WDKA 3CRQA 3D7KA 4NULA 2DRIA 3D4IA 3ZUPA 3W2IA 3AHEA 4NJEB 4GITA 4R31A 4EI8A 1PX0A 3LSTA 3IIKA 3RUFA 3G88A 4B4VA 3EVGA 4DLSA 4CKXA 4KR3A 3LLUA 3R3WA 4KUHA 2P1DA 4H4DA 4ZEVA 2XX3A 5I9LA 4DJAA 4BBJA 3AR2A 2I22A 1BXKA 1QIJA 2B6HA 4OHPA 4RSGA 4EBFA 2JHCA 4PIPA 3COZA 3G0BA 4CDNA 3OE7D 3OSZA 3V2UA 3RSLA 4NARA 3ECSA 4Q6WA 3VYRB 2BKXA 1PJRA 2DWQA 2P4SA 3VTFA 2MINB 2QKYA 5A2QA 3ZLBA 3WA6A 1WCIA 3IURA 1IYZA 4B31A 4PC2A 3O8QB 1SCAA 4IZHA 2DR0A 3ZS8A 3NJ4A 1QDRA 4BEJA 2EWMA 4AJOA 3D7NA 3P45A 3I5MA 2VTKA 4C6TA 2XVAA 4LFAM 3D9QX 3GLUA 4B5KA 1EIJA 2R84A 5C31A 4GYWA 2R68A 4RNDB 1LQTA 2A94A 1O5IA 2J9FA 2YQ4A 3U4GA 4K1XA 3WLOA 4OPMA 4RMGA 2FSGA 4IIDA 5KCZA 5AVZA 2C7RA 1GU1A 4PO9A 3W5DA 2JJMA 3G89A 3D8NA 2JA2A 4YP1A 5T4EA 2CHEA 2GRJA 5KNLA 2RGDA 3IHKA 1XQYA 2APJA 2HNAA 4JI0B 5CLLA 2P27A 1EJ2A 2IFTA 3U4QA 3IB6A 4DR4M 1XLUA 1OLOA 1JB1A 1XA3A 2UU9B 5AT1A 3HHXA 3I3OA 4M1SA 1H0HA 3L02A 3DJYA 1X1AA 3H9GA 2W2TA 3IUQA 5DGCA 2QNBA 4OH7A 1O97D 3BXXA 3TLAA 3HJTA 2OL4A 3ILSA 1DBVO 4RTOA 1M5UA 3OQVA 1O5OA 5C1IA 3VR2A 1ZOPA 1FFCA 1J7KA 4LQDA 4MW2A 2BWEA 1B7GO 1QJ4A 1N1GA 3P9SA 1G7RA 3UT0A 4C4AA 3V1KA 3ZDAA 3TWOA 3WDSA 2PD6A 3B7PA 5CFMA 1E60A 2DFPA 2PRSA 2HX1A 1E5VA 3HDTA 2G88A 4EIWA 2DUWA 1ZIPA 4TL8A 4YBRA 1JEAA 1MRZA 1Q6ZA 4GRDA 2J41A 3P9PA 1AKWA 4LC1A 1Z73A 3ZE2B 5JOQA 1Z2PX 1NNUA 3NTQA 3ESDA 4FYHA 4FW8A 1GZ3A 3DHYA 4GIBA 5TPWA 2Q07A 1BYUA 2XKKA 2ZB2A 5A0TA 4EHLA 1EDOA 1G38A 3QHQA 4REQB 1NR1A 3WMGA 3JYHA 4NR0A 3MTEA 3FPBA 5KMGB 4HH4A 2QD4A 2PUCA 5D3QA 2WM3A 5B58C 2GWRA 4YHBA 3FPAA 4KFTA 4MS1A 3IYLW 2V03A 3K0AB 2JFWA 3AEXA 4RX1A 2XTZA 3ZZ1A 2G04A 1JYFA 4FXOA 4QJ4A 4DGQA 4NY1A 4ZHQF 2KNZA 3GGCA 1A7KA 1MAAA 4AWAA 2QG6A 2DG2A 1H8EA 4IUBS 1B41A 3Q72A 2NNWB 1N2HA 4JFAA 4JLNA 3LFHA 3SR4A 4D5GA 3EPHA 3HKDA 4UE2A 2UZ4A 4JYCA 1QHNA 3K9QO 4JOCA 3HB4X 2Z95A 1PV2A 3L1KA 3EPKA 3AESA 3EXHA 3F7MA 3MCTA 3EODA 4Y6SA 2GAFA 4PGGA 5KNBD 1FRVA 3AONB 4CLOB 2R1VA 4G5QA 3TB4A 2OZPA 1BVRA 2QUKA 2O8CB 4MV6A 4N5HX 1ODSA 1IJBA 4H7HA 2WV7A 4PNZA 2YS7A 1V45E 3HVUA 1DG3A 1TK9A 1QFZA 4ZU3A 4EYQA 3OO1A 1AE1A 5HZMA 3EC2A 1DVRA 3N7UA 3R5HA 4I55A 3Q3VA 5CK5A 2FUNB 5K8VA 3EUFA 3DOFA 1FSFA 3NBUA 4YAJA 2HN9A 5FQNA 1H4TA 1TYCA 2PK3A 3PDCA 5BSVA 4YGYA 3QMPA 1SHLA 4L28A 4ZKDA 3P9IA 3GEGA 3CUUA 1TF5A 4MIYA 1XXLA 4M8KA 4MW7A 1ZIYA 3J2PB 3CO0S 1GFWA 4ZWNA 5JNUA 2AWNA 1W2GA 4DT1B 1OI7A 3U5TA 2Z5GA 1KSJA 1TVMA 5LZ2A 4R68A 3IQWA 4HEHA 3VTAA 2O8DB 4TUWA 3I5XA 2NU9A 3CRVA 5LM3A 4B3MM 4ZDJA 7REQB 1V7ZA 4FHFA 4YMVA 5D87A 1HQKA 1KTVA 4RFLA 1O96B 3WOHA 3FNGA 4NEGA 2VJNA 3NWJA 3LOQA 4FWGA 4Y2YA 4QG3A 4D97A 4I1YA 1CPYA 3NV7A 3UJNA 2DP4E 2EKKA 1Y8CA 1ODLA 2H7CA 1JZTA 1NVVR 3OHPA 4U9IS 3FCYA 3HDHA 4DLTA 1Z26A 3TIGA 3DNFA 5JDIC 3CEPB 1XTPA 3ZHTA 4ITRC 3UH1A 4JVMA 2IYOA 1TUGA 5IC5A 1T0UA 3I0NA 2JD2A 4FIDA 3FWZA 3OBBA 1N34B 1UKBA 4ZO6A 2GASA 5DBHX 1I13A 1IMJA 2QX6A 2O3SA 2C2KA 1A9TA 5F76A 3VDUA 1FVXA 3FOWA 3HTXA 3JQRA 4GC9A 2OVBA 3EB9A 5TDHA 3DA8A 4LYDA 1BQEA 4U6NA 4M7PA 1HE2A 3MRSA 2ZSFA 3F98A 5DYGA 4D8VA 4CV2A 4RH1A 1PK9A 4H2DA 4N8SA 1Z7GA 2AJTA 4XRGA 3L06A 4H3VA 3ONEA 2AE2A 3LBFA 3R09A 3FPSA 3OH8A 3D7LA 4O4LB 4OMDA 1KOJA 1UPCA 1SBYA 2PR7A 3EQ9A 3B36A 2Z1MA 2O1EA 1NUSA 1ZN2A 3DTYA 3IUSA 2WOOA 2NMVA 3FPKA 1QQ5A 3SC3A 4G23A 1V3UA 2QNJA 2E5LM 2DPGA 4CM6A 4AP6A 1YASA 4Q3EA 3EWIA 1DTSA 3DQQA 4GBGA 2X9VA 5AVJA 1XVIA 4EENA 4U8GA 5CRIA 2JLWA 1U3FA 3QFHA 3DBHA 4OBEA 1ZD5A 1O94A 2OXFA 2B3TA 3IH5A 4LJLA 1H0SA 1TQHA 3LHFA 1I9GA 4QOFA 2WSCF 3W6UA 1VL5A 5JXGA 4LBWA 2QX7A 2B82A 2B1JA 1BWPA 4FQ5A 5F5XA 2K2QB 1RI2A 3A3KA 3UJBA 4XXHA 3IJ5A 4FR5A 2O3TA 4QYXA 1VHTA 1MAHA 3DTNA 1OHHA 3WIEA 4OQPA 4MI9A 3HHEA 3H0KA 3CU5A 2VRCD 1CZNA 1VPVA 3UWKA 4H0NA 2IBTA 4OUDB 4EYSA 4AY4A 4YRZA 4UU8A 3VUFA 5AK4A 2QSUA 3BUSA 1M10A 1VL8A 4H59A 4TS9A 1G7SA 1MOPA 4HH3C 3CX4A 4RF3A 4PSKA 3EMKA 1Z4KA 4M83A 4HZIA 4WXRA 4TTPA 5JD3A 3K9PA 4DL9A 2HYDA 1ECFA 4TLDA 3NHUA 5CH3A 3EYWA 3L07A 3EX7C 1UXGA 1TVCA 4DSAA 4OFZA 4OQDA 2QMQA 3PEVA 3ANMA 2PJUA 4DR5M 1S5PA 4ZAXA 4BKRA 4DUGD 4QGAA 1GPNA 3KCQA 4NZPA 2YR0A 5LOVF 2G82A 1JQBA 2F43B 3GO4A 5F7ZA 5KUTA 4G4JA 4JI1B 3AEUB 1P6UA 2VSOA 5IHPA 1BG6A 3TSYA 4FMDB 3VX3A 1PSWA 2IVFA 2GF9A 5DOZA 4DC9A 3AJEA 5C5EA 4YCBA 2HLDA 2JGNA 4WY5A 4L5AA 4O4HB 1KTIA 2PJDA 1VE3A 2VEOA 2ZRPA 4LY6A 3VPBA 3V80A 1ZD3A 5DYTA 2PBZA 1QDLB 4CMIA 3K4QA 1G0NA 2PVPA 2WU3A 3GEMA 5DT2A 3GU3A 4PZZA 3A58B 5EUBA 2W8BB 3FNRA 5IWAM 1NMSA 1JEQB 1PR3A 3B5IA 3OCWA 4H3SA 1XHBA 4AS1A 2O05A 2IH4A 1F4LA 3USCS 3UMCA 4YASA 2JFGA 3DL0A 2W6PA 3O3CA 4P92A 4RVSA 2YJ4A 1Z13A 1R4NB 2P9QA 1QGOA 1PZMA 3ADCA 5A7HA 4Y2UA 2H8KA 4RA9A 3R4VA 3E23A 4B08A 3ZHZA 1NBAA 4XLTA 2DQYA 2D1YA 3VNRA 4TZ0A 1RE0A 4QLBA 5TNXA 5DK4A 3C3CA 3LUHA 3ETHA 2BMFA 2VK8A 3B7GA 3FFBA 4HQOA 4WN3A 4F5DA 4DR3B 1I3MA 1NF3A 3N76A 4DCGA 2WWTA 2JLSA 2VBGA 3HDYA 2V6JA 1KI3A 4TRJA 1QAOA 3FH0A 1DQPA 1G8YA 1W2HA 5AI5A 1UBKS 1ICEA 3NKFA 1C80A 1BMFD 5FTWA 3RWOA 1KZ6A 4YJHB 1YOBA 1NHGC 2XT6A 5ESRA 2FDCA 3R0VA 3U6DA 1S3GA 2ZYTX 3GJ0A 3LV8A 3PJRA 1FRZA 5A1TA 1L8XA 1UMCA 3HCBA 4MW1A 2FZWA 1OV6A 3R7LA 3W9UA 3WX0A 3G2HA 6Q21A 4NYJQ 4G9GA 3JQ8B 1RBQA 3DTTA 2DWCA 1RCUA 4OW0A 1R4MB 3Q5EA 1ZM9A 3QVOA 3VKGA 2UYQA 3KDAA 3RG8A 1P39A 4TLLB 4YALA 4HB2A 4WASA 3U60A 4DV0M 1OXSC 1FTYA 2NACA 9ATCA 3SXJA 1EFVA 1CX9B 2IS4A 3VNQA 1DZIA 3X1WA 3KEGA 1B6RA 4R1TA 2AKYA 1VKOA 3OE7A 1WPXA 4ZQFA 3K6RA 3HCFA 3A4VA 4Z4QA 2PMDA 2GMWA 1GG2A 4JSRA 5KDOA 4HRXA 2EIHA 4B32A 1FJ2A 2XQFA 1WB6A 5KPTA 2G72A 1JZSA 1HMPA 4P38A 3OLQA 3SSNA 4C87A 2YV2A 3AUKA 5AQ1A 2IDZA 5L6LB 2VQDA 1X38A 1QG6A 4YJ2F 1NW4A 3P32A 4PQGA 2ONYA 2OORA 4TKZA 4BC1A 3I8OA 3DZBA 1UZNA 1FS4A 1X19A 5JPCA 4LJAA 3M5CA 3R2JA 3DS8A 4EYGA 3X1KA 2GN2A 1CEEA 5HSGA 2L6OA 1DFHA 2FW7A 2DFLA 5L3SA 3G5LA 5LXTB 3N2EA 4IMJB 1E69A 3EOAI 1D6NA 2CF6A 3S5UA 2W4QA 1WY7A 4D0LB 4LCJA 3ROEA 3ORYA 4DR6M 2IA5A 4J7AA 4B84A 1O4VA 2BGUA 1BEZA 3ORHA 4KGXA 4Q7QA 1DHTA 3PQ6A 4FYVA 3HA3A 2R25B 2WYIA 4ZVNA 4I4IA 3JSXA 1L5KA 1MAVA 3C97A 2AOUB 5K3FA 4OBXA 1U8ZA 2R46A 4Z0NA 2E1PA 4L8YA 4WKOA 3NWBA 4NMXB 3HHZA 3EIWA 2HMWA 3E5HA 1P73A 1XRNA 2ATIA 3QKSA 2JGLA 7MHTA 4JJ4A 3QZUA 1YOVB 3UW3A 3T9CA 5FR1A 2P77A 5E6UA 1H6AA 3LXRA 1UT6A 4LBZA 3TQIA 2VPIA 3RANA 1X7ZB 5IK2D 4QUAA 4WBNF 1NBEA 3FDZA 3PFWO 3CNEA 5TGDA 1WDTA 4ONEA 5JQGA 1MP0A 1Q3CA 2REXB 3CLUD 3E05A 4KPEC 1L1EA 2QT0A 2OO9A 2I55A 1WB4A 4DSTA 2Z57A 1HT3A 1VJGA 5DW3A 3N2GB 1G2IA 4C29A 2FG6C 4R3WA 3SXPA 3QBVA 4MDHA 4MWBA 3CUVA 1CU1A 3ESQA 4TWBA 1JWLA 4ER7A 2OCIA 4BTEA 4JSTA 2ZTUA 3RADC 3KLBA 1X9HA 3SBDA 3S3TA 4GLLA 4Y6LA 1ZAEA 1Q3KA 4R6WA 3V8QA 4B79A 3AJAA 3VYSB 1WMFA 4LWOA 3LW7A 3FW1A 5IVDA 3K9HA 1UPBA 1SK9A 3B82A 3BRQA 2W98A 4K6OA 2CVOA 2WJWA 5JADA 2V5AA 1C0PA 1H93A 1KK2A 1DIBA 1RXCA 4IHJA 3CLVA 4UXJA 4CMJA 4BMZA 5JC8A 3V7NA 1SBHA 3KPYA 3G2PA 1CY2A 3AG5A 5CDSA 2P1RA 2R7MA 2YZ2A 3IE1A 3ROTA 4NCAA 1D2RA 1DXQA 5IS2A 3R7WA 5DISB 3VAZA 5TF4A 1OYVA 4LBYA 2Z5FA 2VPXA 1QMPA 1LUAA 1XR3A 3QSGA 4DA0A 2K0BX 5JCJA 4HX9A 4TL9A 5ALHA 4AMUA 5IT9S 3BE5A 2PGXA 2EAUA 1MOZA 4M1WA 2ID9A 1W36B 1UMKA 3V8PA 2ZBQA 3QVGA 4J1TC 1T8SA 3OD1A 2KSQA 3KJGA 3OPQA 1NM5C 1R0XA 2J3EA 4RKFA 3ASUA 3RO7A 4DG5A 2VYND 3C6QA 1C2TA 3CWZA 1GARA 3ROXA 2LRHA 4EITA 2IEIA 4CMBA 1E3QA 4GDMA 5EWJA 1SH7A 1IBMB 3C39A 1OIXA 4AECA 3UJDA 1RQNA 4IJMA 1UOPA 1SPXA 1QYRA 3QWAA 3WB2A 3N05A 1NRJB 1X1DA 2W2PA 3O8DA 1QV7A 1KMCA 2ZTLA 2WLSA 1DX4A 4TLAA 2AN5A 4WLVA 4KPFC 1O95A 3N07A 4MI3A 4QYMA 1ZS9A 4Q00A 4DW8A 5KAPA 4G97A 2HSZA 5FUBA 5B1EA 3BFVA 3NTXA 3PQ2A 1VCMA 2Y2VA 1AUPA 3HUEA 2JH3A 7ABPA 3IEUA 3UV6A 2MSEB 2JJ2A 1P0MA 3KJFA 1YZYA 1SVUA 4XGIA 4JENA 4NBKA 2X6TA 3TQSA 2AN1A 2PYIA 5CT4A 4X24A 3K53A 1WZ2A 1OA0A 3HLYA 3U7IA 2ODAA 4JQOA 1A4IA 1EP2B 3KB8A 4AQYB 1IQPA 3HU5A 4LXYA 4GFDA 2HU5A 4NFYA 4MAFA 2XXAA 3B78A 2C2YA 4PZYA 1Z34A 1KZGB 3OAAA 2GCOA 4G2NA 4EHKA 4G5XA 1XZMA 3CE9A 3SHWA 3PWSA 3DP7A 1L7DA 2H8GA 4DLLA 3L3BA 1DO2A 2JIBA 2A2ZA 1T5IA 2OBBA 4L57A 1TAQA 3EULA 2C3YA 4HWGA 5LQCA 4E11A 1NZDA 1SKYB 1JQKA 4EH1A 1GRRA 3Q8XB 3OLZA 2Q4OA 4TL7A 3BOSA 4HDRB 1MGOA 4BLQA 1I1NA 2HCFA 4LXQA 2QUAA 5IT4A 2B83A 5AVOA 1XD2A 1Q15A 3QE4A 4M0UA 1JIKA 1FZTA 1WPRA 8GPBA 1Z0DA 2QA5A 1EX6A 1RVV1 2VH1A 3CLRC 3C7AA 1BRMA 3G8BA 1ZM4A 4RXTA 2BMWA 4UCXA 1I10A 1T4CB 4G0XA 2F9LA 2FRDA 1XQ9A 2CDBA 1QG2A 1M2WA 2FW9A 1FQKA 4TKLA 4CIVA 4PQEA 3DR5A 4FEAA 5E9QA 2L18A 2ZAGA 3FHCB 1HTWA 5C8XA 4L2IA 2FSUA 2IL1A 3PSAA 2H06A 3HEAA 1N92A 2O1SA 4MWEA 2F59A 5DV9A 2XB4A 4Q24A 3QFTA 4OYYA 3H87A 3VYUB 2FCRA 2W48A 3AQ4A 1WAMA 4C0QC 1C7EA 4YMGA 1SUCA 4M8IA 1PNOA 2PKWA 4Q3KA 1E1MA 1YAJA 3EGCA 1VSTA 3DWEX 4CM8A 2PA3A 3V9AA 4XGNA 3DM9B 4Y8VA 1UBLS 1I0LA 1NURA 3OEYA 3PGXA 1F06A 4P7KA 5DBOA 3AM1A 3NG1A 3W78A 2OVFA 3MGAA 2BP7A 4RZQA 1OJ7A 5IUJC 2H3HA 1KORA 2EGGA 4N4AA 2O2SA 1THZA 3FWYA 4QRIA 4R69A 1KEKA 1TDHA 3L4KA 4P16A 2E9SA 2R1TA 1YAHA 4CIWA 3I01A 4MCIA 1UDBA 2CJWA 1NJFA 1YZGA 2WIFA 2Q6IA 2FZLA 3K09A 2Y0PA 5I9MA 4K40A 3KAPA 1J0EA 2IGTA 2IHBA 1C8BA 2D2EA 1Y5MA 2HJRA 5JVDB 5DB4A 1BWQA 4KAAA 1P0IA 1U3DA 3DEFA 3BWVA 3K1JA 3H04A 1U0TA 3I73A 1VPEA 4ESVA 4NYJR 1NQWA 2NU7A 2E48A 3SDBA 1B1AA 4YJ3F 4HYEA 4X95A 3C48A 2BE7A 1PR0A 4D80A 2IZ0A 1N5RA 1AH2A 1YZQA 1L5SA 2IU0A 5IUNC 4G86A 2B35A 2HPZA 3TQCA 3PWZA 2VRCA 2QLFA 1XZJA 4BAUA 1RLMA 3UB4A 4PFQA 5JANA 2VJCA 2O6LA 4P3NA 4PD2A 4HDKA 2G4LA 2R7LA 5JAZA 2C5LA 4XQ0A 3EEFA 4UFNA 1V8OA 3MYYA 1GR1A 4C01A 4RQAA 1WXIA 1XZQA 2D5LA 5F52A 2PZJA 1KQFA 3AXSA 4XARA 1ZIOA 4AMBA 3E7PA 4WFKA 4EQ6A 4EYEA 1LXCA 5ITYA 4TS3A 1M6EX 4J3NA 2QD3A 4XJTA 5LNK1 2H08A 2JC3A 4GM0A 2AJLI 4IIJF 4OEHA 1IIBA 2E21A 4DUGA 3MW8A 2JKZA 5BV2P 1L6IA 3SEQA 2EJCA 2QTHA 1DPFA 1NIPA 3LPCA 2ZREA 2YBDA 2PYZA 3Q1LA 4ILEA 3EWNA 5GOTA 3KVYA 4M8LA 4WUTA 4IJFA 4Q16A 2E4WA 5LLDA 3DPSA 1PR1A 1XMXA 3ZLUA 2W2QA 1E2BA 3E81A 2PKYX 3W3AH 1L7QA 2GJSA 3PBKA 2RAVA 1I9CA 2QWXA 3B5JA 3FYHA 4EG3A 4MR7B 1MQ9A 4KXWA 4LRTA 4N18A 1KYXA 1CVIA 3LHIA 4RVOA 2V7GA 4UPEA 1R6BX 2C54A 2YVQA 5A9SB 4FDTA 2ZSHA 1NVWQ 3K5HA 4LMBA 2H00A 1R37A 3C58A 4HBGA 4PE5B 2IE8A 2FEXA 5FUWA 5I7VA 3RBAA 4BQFA 5C7OO 4Y2GA 2XMCA 3CZPA 4R5MA 3TCXB 4BO9A 1XELA 4NJOA 2ADFA 2DJIA 4NAHA 1EUZA 4WLNA 1WZEA 1JIUA 2P2NA 4RMNA 3GAZA 3B89A 2QZ9A 2WF6A 5ICFA 4G1BA 2Z5VA 5IAJA 4C22A 1PS9A 2QEQA 3OI7A 3GUUA 1P74A 1EIWA 3VXKA 3HR8A 4DSOA 1PR2A 3DFFA 4ACBA 3TKAA 4EO7A 1MRSA 4S1WA 2P9GA 4ODIA 2ZUWA 3M4XA 1GKIA 1ORRA 2H5XA 3G2JA 1KYVA 4HAUA 3EIFA 4R9NA 2FPUA 5K3SA 4YLYA 4FFLA 3QTTA 1O2DA 5DI9A 5FSWA 4QUJA 1JU4A 4G0NA 5ICMA 1FJGM 2X1MA 2EOAA 3VZCA 3E8MA 2H4YA 5FWNA 1J8VA 2PKEA 1O6BA 3TFOA 1M6WA 3WO1A 3E2IA 3ZCSA 4FFSA 3LOPA 2XBUA 4MRNA 4PBRA 3RK4A 5IP5A 1OUMA 3GZTB 2WA2A 5A0FA 3WNZA 4XB2A 1NJ6A 3AETB 5IAAA 4DEVA 4EJSC 2HLHA 5MDHA 2CXUA 4F7DA 1DUSA 3OFJA 4CQLA 4GI2A 1PJ3A 1CY6A 1KQNA 4EKEA 621PA 5FHRA 2HCJB 2ZBFA 4RKRA 1FDRA 5SZKB 3JQQA 1BH6A 4FM9A 6GPBA 3CUEF 4KYVA 4KQCA 1NC1A 1C0IA 3EIOA 3TBKA 5JSHA 2HHCA 3MMZA 4BNNA 4F46A 1I94M 1QYDA 3D0QA 3IQZA 1H66A 1AX9A 1OH5A 4B45A 4NSOB 1STOA 3BAFA 3OQIB 2LVOC 2TMGA 1QX3A 2NYRA 1YDHA 4QJ5A 2VRBA 2QN2A 2BCEA 3BGWA 5EIXA 1TH2A 1HYEA 2QSYA 3AEQA 4B3SM 4W7IA 5G02A 3IA7A 2YJNA 2AQHA 4GZMA 1U90A 2V9CA 4ZYUA 2VWPA 1M2VB 1O7JA 1P7PA 1NNSA 4GPD1 2GN8A 1USWA 1MC8A 5JARA 1O94D 2F3QA 3RH0A 2BGIA 2ZT6A 3G5AA 3I9V1 4RTNA 1Y3HA 1G8HA 3E46A 2ERXA 3MUNA 4QU5A 3GLIE 2YWGA 1X3LA 3HNPA 3GBSA 2BEUB 2PXAA 2FR8A 2DB3A 3KKQA 1FRFS 2EJWA 2GCPA 2FMIA 3O8BA 4ZI2A 4FPXA 2JFUA 4BYMA 4H31A 3NI2A 2RRUA 4N8EA 4OQFA 2BFEA 1OHHD 4PYKA 3JQEA 1C0LA 4XWTA 3CR7A 2CJXA 2X8JA 2DFNA 4KITB 3ZG6A 3KKNA 4G25A 4IHQA 1B6SA 2E4UA 1G3MA 4TQGA 3K94A 5GAJA 1MRNA 3PX2A 1Y6ZA 3THWA 4M1YA 5IK2A 4OY3A 4RDXA 3AU8A 3WK4A 4ZTBA 2JZCA 1VI5A 5KVAA 3WWZA 4MCJA 3FE2A 3VPXA 3AHFA 3HQ4O 5FFFA 2PQ2A 4M22A 4MUBA 5D2CA 2QS9A 3TLYA 1Y3FE 3TD9A 3JAMS 3EPPA 3BBLA 4I55F 1WCXA 4G89A 1XA0A 1G5QA 4MARA 2G9RA 5A5FA 2CFSA 2XEDA 2PKQP 1O58A 2AKAB 3D6JA 2BTOA 3HZRA 3UAGA 2QVLA 4JBHA 2KNVA 1ENYA 2AX4A 3QEKA 4B6OA 2H5IA 2CMDA 3GQ3A 1CE8A 5ITZB 1GZ7A 1Z18A 3H6KA 3UTCA 5HKLA 3K30A 2ZBVA 3T52A 2OBFA 2JCBA 3FF1A 3QG1A 4BYGA 4B3GA 4POOA 4CBVA 4DMHA 1TFRA 3PICA 4JY7A 4DR1M 2R44A 1QR6A 3QELA 3UA3A 2A78A 1K86A 2HLDD 5ITRA 2YJZA 3WZLA 2G70A 4RVDA 1OAKA 1J0CA 4U6QA 1GIAA 4F1KA 4ND5A 3C4VA 2DBYA 3THOA 1GNVA 5HQ3A 3C3KA 4RSHA 4Y6RA 4AUKA 5SZJA 3A1VA 4UC0A 2O7SA 3ENQA 4RPCA 2XKBA 3AIIA 4Y2PA 5D5QA 3L6DA 5BOVA 1QRDA 2R7KA 1ECJA 3MAAC 1SA0B 2R8RA 2LP4Y 2IJGX 4HVCA 3G9ZA 3AUFA 3QOWA 1K3XA 3OTIA 3OX1A 4UVIA 2PFSA 4YQEA 3ZWYA 4UDXX 2CBZA 2H11A 4X0EA 3ENVA 3O9ZA 3LPAA 1GAJA 4YI3A 2D8MA 5JNTA 4DILA 2W6JA 2J9YB 4PANA 2OXRA 3GFVA 1A2OA 2C7QA 3VPAA 5K05A 1OGJA 2DWMA 3MSXA 3K73O 3D1VA 1JG3A 5JRZA 3KOOA 1ZD9A 4Y2XA 1FYEA 5JWRA 1H9CA 4ND2A 3DC2A 4NXMM 4BAZA 4GKVA 3QNUA 2C5SA 5AOBA 1X1EA 3PS9A 4RESA 4KRFA 3A0UA 3OQJA 4EHAA 3DMRA 4D9EA 4K8RB 1RNLA 4J2TA 1VTKA 1Z82A 4XAQA 4ZA2A 5DI3A 4ZVRA 2BGNA 4N47A 4PLCA 4F1WA 2GBGA 4UUQA 1FDTA 5E1MA 1ML3A 3LTNC 3GLIA 4B44A 5ETJA 5GMOA 4Z7JA 2HWUA 3EQ8A 2GR9A 4EJ2A 1BO6A 1ZVQA 2E7ZA 1P9OA 4W1PA 2P90A 5BN3B 1U5BA 3L1VA 4U6SA 4NCNA 1TQ2A 3OIUA 1NQTA 2P7IA 3MUOA 3PF9A 4LK3A 1RVDA 5DCWA 1M2HA 1K6EA 1U8YA 4YUVA 1I6KA 4IDPA 4UQPA 3RSSA 4D3ZA 1U6IA 4RQBA 5AVSA 1A4RA 2FSIA 2O3QA 4UCWA 3R3UA 4C4PA 1IXYA 2JLCA 4QDUA 4DUZB 1OH7A 4Q01A 1A71A 4TTSA 3ZDDA 4GMFA 4HRAA 1E5XA 2IHJA 4EL0A 4MGZE 1WU7A 2XWQA 3C3PA 2XUFA 2CYAA 3GB9A 1E66A 2F3RA 1H2XA 4BXOB 4D9IA 4BLVA 5EJGA 2I6XA 3LMKA 4UM9B 4IDDA 1CDOA 4GVXA 1EE1A 1I4DD 3RNLA 3I1FA 3ZBUA 3SIRA 2J0VA 1GUFA 2F90A 4WJLA 4M6WA 4N3BA 4HAZA 3F4LA 1AV6A 1PFGA 4BQNA 5IBRA 4DLAA 4E0BA 4QBHA 4Y18A 1XCPA 4HEA6 3H75A 4DCUA 3B8HA 1WPGA 2GRAA 4ND3A 3AR5A 3BSYA 3VH3A 4MYUA 1ZRHA 1BJRE 2DQKA 3NVAA 1FNNA 3FKSD 4MI1A 1NV9A 3PF8A 2NAFA 1T0PA 2R5FA 3VHXA 5JJ5A 1TI7A 3BB3A 5DCUA 2F4NA 4OL0A 4MUAA 1I4TD 4FINA 2DAGA 1V34A 2RHOA 1V48A 3B48A 2FUG1 3QWHA 1H94A 3PEWA 3T5AA 4ATNA 4R98A 5B30A 2J6CA 1V6CA 2WB2A 4B3CA 1AZSC 4E03A 1ZFNA 4RF4A 4UM7A 4RYDA 5DBIA 3QK7A 3K0SA 3DYIA 2PUDA 1UBSB 5BSMA 2Q3EA 4CEIB 3ZV5A 3H2JA 2IZZA 2QN6A 1Y1QA 1U80A 4LFCM 3VTZA 3P0RA 3RSGA 2AB0A 3F6SA 2X0FA 3NTOA 2ZAMA 3PUXA 2WU4A 4PQRA 2V0NA 4UHHA 2P3QA 4J07A 1XMQM 4N3CA 3ENKA 3T7DA 1U6KA 3TOZA 4CNQA 3DAFA 4JU8A 4ZK2A 2EBWA 2LZ0A 4GWKA 2EZ9A 4C7XA 4W8HA 1OE0A 5EZQA 4M0KA 4PZ9A 2QW6A 2G6TA 4BFYA 1U7TA 3NJRA 4X1YB 1BA2A 3U4HA 2BDUA 2RHBA 1QO7A 4I99A 1YRLA 4ZEWA 1L7XA 3EZ9A 1U8TA 4YCJA 1PWHA 5B2FA 2H1OA 1RWPA 3MXOA 1M8GA 5LMNB 4LDRA 3IUNA 3W3ZB 1A9ZA 3K35A 3AERB 4NC9A 2FN7A 2OG1A 3OE4A 1OYOA 5IYZF 1LBHA 1U7HA 1ISMA 5G40A 4F5EA 4EX6A 2Y66A 1ZOOA 5FADA 3M9LA 1XKLA 4A0GA 4PC6A 4NE9A 2VP0A 4BBPA 3DOIA 3NHWA 5K8TA 3Q8MA 4O2AF 3GMDA 3AR4A 4NPCA 1HEYA 2RHCA 2X0EA 2CL0X 2EEZA 3ZIAA 4OGLA 2XOKA 4CM9A 3UXMA 3L8HA 2C7OA 1XU9A 3IXMA 7YASA 4HO1X 2EYUA 2GCNA 4ZODA 5JCJD 3AZOA 5LQSA 3OE5A 1B0AA 3ZDFA 2ZJFA 1VCOA 2HGZA 2I2AA 5IWCA 3F97A 4LRWA 4JITA 4LMRA 1MOSA 2HA7A 4PW0A 3MOGA 2HU8A 3AVUA 5I51A 1BOFA 1JI0A 1O0CA 3J7TA 1UINA 2ZRFA 3GLVA 3HWWA 4PFKA 4CM3A 4L74A 3RC9A 4WY8A 1LTMA 4JP8A 2PRIA 4N1AA 3GRRA 4DQXA 3SZMA 1ZMOA 1KDZA 3QLVA 2OBMA 4JIMA 4MB6A 4XOIA 1Z38A 1TTQB 1AF4A 1Z5PA 5KYUA 5CGZA 1XU7A 4US2R 2OCAA 4UE6A 1C7QA 4IBFA 2HBQA 1JHPA 4WBNB 1Z3IX 1O95D 4A4DA 3FBTA 1ULBA 5IM5A 1J09A 5DXAA 1Q17A 1OILA 4LJKA 2CLDX 5COBA 2BUAA 1J07A 4BNGA 5I45A 1Y5RA 1Z45A 1R50A 1Y5LA 1BROA