1SXJB

Crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
316
structure length
316
Chain Sequence
LQLPWVEKYRPQVLSDIVGNKETIDRLQQIAKDGNMPHMIISGMPGIGKTTSVHCLAHELLGRSYADGVLELNASDDRGIDVVRNQIKHFAQKKLHLPPGKHKIVILDEADSMTAGAQQALRRTMELYSNSTRFAFACNQSNKIIEPLQSQCAILRYSKLSDEDVLKRLLQIIKLEDVKYTNDGLEAIIFTAEGDMRQAINNLQSTVAGHGLVNADNVFKIVDSPHPLIVKKMLLASNLEDSIQILRTDLWKKGYSSIDIVTTSFRVTKNLAQVKESVRLEMIKEIGLTHMRILEGVGTYLQLASMLAKIHKLNNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activator 1 95 kDa subunit
publication title Structural analysis of a eukaryotic sliding DNA clamp-clamp loader complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
total genus 110
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00004 AAA ATPase family associated with various cellular activities (AAA)
B PF08542 Rep_fac_C Replication factor C C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1sxjB02
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 1sxjB03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1sxjB01
3QQ5A 2DFNA 4E07A 5G3YA 3R7WB 4ASUD 1T9HA 2QL6A 3CO5A 2IYTA 2FA9A 3RANA 4I4LA 2JLYA 4DCNA 4N3NA 1P2UA 2IUTA 4MGZR 3KDSE 2W58A 2GWHA 3TRFA 2RGAA 2JCSA 1KMHB 2AWNA 4H9GA 4NCHA 2JLVA 2WZQA 2CLSA 3ZQ6A 2FEOA 2NGRA 5KPJA 4OK6A 2IA5A 1WP9A 3W5JA 1W0JD 1ZC3A 2WWYA 3Q7PA 1U94A 2PX0A 4KSCA 4V0LA 1II0A 1TMKA 2JJ8A 1US8A 1ZW6A 2W0MA 4EQ6A 5FPTA 3VR3A 3LVQE 2RCNA 3GD7A 4CEIB 2BJWA 3W8NA 3LW8A 4EAQA 2GZHA 3N70A 3GEEA 1TQDA 4F4IA 2BM0A 4KHZA 3KJEA 1J7KA 2ERYA 1DO0A 2IS4A 1ZAKA 5FOWA 1KKLA 5IRCD 1D5CA 1JAHA 1KO4A 3P27A 1YR8A 1OFUX 4IVPA 1NNEA 1E4YA 2ZJ8A 1G1MA 3VR5A 1CR2A 2DCUA 3VX3A 1E32A 3ZZTA 2CJWA 5KDDA 3GLGB 4B74A 4OI4A 4ON9A 4QOSA 1IN8A 5L3QA 1X37A 4KFSA 5FBWB 4QBIA 1ZIPA 2RGCA 3ADCA 4U00A 1AM4D 3RRNA 3K0CA 3QKSA 4DCVA 2XOKD 4B47A 4JLNA 4UJ5A 2IBMA 2QAGB 1V43A 5HCNA 5DSZA 4AKHA 3GLGE 3FFBA 1E3MA 3B82A 3ZVMA 4UJ3A 1E2QA 3DHWC 4D4MA 1UDXA 2W2XA 1YZGA 4AIIA 1DE0A 1G3UA 1KI1A 3K0CC 4LJ5A 4HB3A 1I4LD 2QBYA 1T3LA 3MUFA 5BWMA 3K70D 1M7HA 2HJGA 3NH9A 4JL8A 4MGKR 4EPVA 1OXUA 1Z47A 1MRNA 1RKBA 2IXGA 4DLUA 2G1KA 1NMXA 2RMKA 4NL4H 1NMZA 3AH8A 4OKSA 4AYWA 2ZVPX 4JL6A 2IXFA 2MMGA 4BZQA 2DPXA 1IHUA 4IOLA 5DN6A 4AY2A 4MKHA 2GJSA 4LZZA 4ESVA 1SVLA 2VHTA 4NYIR 2GA8A 5C4MA 1R0XA 4LPSA 3SE0A 1VMAA 3C5HA 4EPRA 4DCTA 1F2TA 3EASA 3DL0A 4M9SA 2BEKA 4F4JA 4QHTA 1SGWA 3I62A 2CHQA 1U0HC 5G40A 4ZDIA 4Q18A 1GILA 1IAQA 3OE7A 2RH5A 1P7CA 1ZUHA 4P4SB 4BFVA 1QHGA 1P9NA 2EFGA 2GJ9A 3I72A 4D81A 4JKIA 1JR3D 1CRPA 1W7AA 2ZJZA 4FI3C 3A4MA 1EX7A 1D6JA 1RVDA 2VTKA 4KJZA 4BQSA 3BB3A 3FE2A 1YQTA 3S1AB 3C4JA 3QF4A 2HT6A 2PCJA 4LI0A 4PSAA 4PPFA 4G5RA 2DWPA 3L43A 2GILA 2B8TA 3AUYA 1M2OB 2CL0X 4PQFA 3KJGA 1DTSA 3VAAA 4DDVA 1AKYA 1KDTA 4MGIR 1MABB 4PAOA 4LHWA 1IXRC 2CCKA 3O8CA 1L8QA 1HE8B 4B3CA 3QEJA 1GM5A 5JCZA 2ANBA 4Q4LA 1TU4A 1YR9A 4GZLA 2GZAA 4R2IA 1KI4A 4HUQB 2ZVQX 1E1QD 4GMXA 3V9PA 4B33A 1VYUA 1WQ1R 2EW1A 1G9XA 1Z6AA 1KNQA 2GZDA 2RB4A 3BD9A 2C9OA 1CLUA 2WAYA 4KVGA 4DUGA 3QXCA 2ZIAA 4AD8A 2ZETA 3TSZA 1Z0FA 4FMCB 521PA 5KSOA 1NY5A 2V54A 2WWHA 5KNCA 4DKXA 2V6IA 4B76A 1OF1A 2V7QD 4XWOA 4L9SA 4AC9A 1KK3A 3GFPA 1CULC 4I1SA 1R4AA 3NBXX 3M6AA 1N6IA 2XZPA 5CLLA 3VU9A 3GLFE 1P61B 3LBNA 2WTUA 2DY1A 3RAPR 4D26A 4LPKA 2XXAA 3BE4A 3W6OA 1AN0A 1Z63A 2PMKA 2QT1A 3BH6A 3BIFA 4URZR 1DAIA 5EUMA 2F9MA 1JPJA 1Q44A 2CHGA 4FWHA 2ZM5A 2OG2A 1KZGB 3PUXA 4RKEA 1N5JA 2ZRBA 1W36D 3D8BA 4RZ3A 4MYCA 3F3YA 3LQRA 1AGPA 2E1RA 5EE9A 1GRQA 1G7CA 4FW9A 5H70A 2Q21A 3B7GA 3THOA 4CW7A 1QZXA 1W46A 4ESHA 3RDPA 5FL7A 5P21A 4TZ0A 1ZU5A 4M1SA 1NIPA 2AXNA 2CK3D 1M1YE 2XNDD 3KKPA 3K9HA 4QHYA 1SVMA 4JBXA 5LBIA 2QORA 5EXXA 3BFXA 3SS8A 5L3SA 3AVYA 3WMGA 621PA 5LD2B 2NIPA 4Y0VA 4B2PA 1EFTA 4ZCLA 4LJ7A 2GNOA 2F1HA 3AKYA 4NYMQ 3IPYA 1YR6A 4JLAA 4EJSB 2Z43A 3VHLB 5BW8A 121PA 1KTVA 4US2R 3AVXA 1XMIA 1GL9B 1XXHB 2GAOA 4M2LA 3TJZA 2VLIA 4NDZA 1RYHA 5LB4A 4ZDKA 5KDOA 3C41J 1LY1A 3R9XA 4Q4HA 3UXMA 4OQNA 1T91A 4O3MA 2J9RA 4XD7A 4NMMA 1Z28A 3ZQJA 2LKDA 2QQEA 4DC9A 2CL7X 5IDVA 3SBDA 1OXSC 3QI2A 1RRGA 3ZS8A 1CIPA 5FOSA 3LBHA 2O8FB 2VP9A 4PAMA 5FBQB 1JR6A 3EA5A 1JI0A 2ZE5A 2FV8A 1R0WA 2F1JA 3CF2A 4B75A 1E79A 2W6ID 1KSGA 3IUYA 2IXEA 2W2VA 2E87A 1P2VA 2Z5FA 4CRWB 3VR1A 5KO2A 1BIFA 3K0EA 1ZNYA 4C7OA 4PHTA 4AURA 1E2HA 1TEVA 5DHAA 1JALA 4OHVA 2ZI6A 4Z51A 2QA5A 5JRJA 1BH2A 1E0JA 2ZRGA 4MITA 3U3RA 5FPYA 5D3MB 1HUQA 5TMPA 1YZLA 4HB0A 4QRHA 3AVOA 2GCOB 4Q4JB 2A30A 3TIFA 1KO7A 1NL3A 1Q1ZA 1NP6A 2G0TA 3IQWA 5HE8A 2ZSAA 3T12A 3VKGA 4JVMA 4B6EA 1E2GA 4FWGA 5FL3A 4TLEA 1MV5A 1R10A 3AF1A 3ZVRA 2H92A 4JL5A 5JHGB 3SYLA 1XEXA 2G88A 2VF7A 1EFCA 4G3XA 4G5QA 4JSYA 5AJVB 3WXMA 4PHGA 3B1XA 1G17A 4TMVA 1WF3A 1X1RA 2P3SA 4JLJA 1SXJE 5B30A 1EFRD 1KO8A 3QIAA 2VP5A 1KJWA 2QE7A 4YXWD 2ZRHA 3EW9A 1OYWA 3KW6A 3VKHA 2Q3HA 2AWOA 1U99A 1XEWX 1VCNA 1IQPA 2YWEA 1GIAA 2CLCX 2VH5R 3UPUA 3G5UA 1RE0A 1DG1G 1MO6A 2VF8A 3B8HA 3SJZA 1JXOA 4JSTA 2GF9A 3SYKA 4PXAA 2OO7A 5AJYA 4XH9B 2VO1A 1RC8A 3AVUA 1KZ7B 2B7BA 1G4AE 4YC7A 3A6PC 2WKRA 2A9KA 3PEYA 1G3IA 5J4VA 1TUIA 3CUEF 3EWSA 3AF3A 1EFRA 4IDPA 5E7IA 1U9IA 3EA0A 1WA5A 4RVCA 1FQKA 3LFUA 3RRMA 2OAQ1 1ZM2A 3QKRB 5FR2A 4KODA 3EC1A 4NKRA 4QG7A 4QXAA 4IEIA 1G8GA 1OH5A 4BZXA 2ZEJA 4C0AC 4LJ4A 4F38A 3C5CA 2Q6TA 2OHFA 2ODBA 1NKTA 4URVR 1OH8A 4Q9JA 3GLHE 2ODWA 3IILA 1TEXA 2HDNB 5DI9A 1U9IC 1KIMA 4IW3B 1I2MA 2BDTA 1I4DD 2G77B 1RFLA 1CEEA 1UBCA 3F0TA 4A8JA 1KDOA 4PSVA 1M8PA 2OBNA 1ZCAA 2C96A 1ZUNB 4MRSA 3KTAB 2R2AA 1P2TA 4Q19A 2GEVA 5FOUA 1UKEA 1XTRA 4FINA 1M7GA 2MMCA 4LHZA 2OAP1 2OUKA 4C9BA 2PEZA 3CRQA 2VP2A 1JNYA 4M53A 4NCJA 1ZNWA 1HA3A 2VP6A 5A4JA 1MRSA 1FW6A 3T06B 3LBIA 4B2LA 4LX0A 4A8JC 1NJGA 1CR1A 2KBEA 3QXHA 1QHXA 2VQSA 4M9QA 3U2QA 1TAGA 1BO6A 3PEWA 4LDJA 3LDAA 3QXXA 2ZYTX 1D2MA 1UEJA 1E9RA 2O8BA 2ECKA 4XTCS 1T8TA 4AK9A 5CIQA 3HJNA 4PSKA 2F1RA 1U8ZA 2OT3B 5DISB 3WP0A 4D0LB 1M7BA 4B2IA 3KQKA 4WAUA 3B5JA 4BFYA 2C8VA 3GP8A 2F43B 3BJIC 5EP4A 3DDCA 4GDFA 1W44A 2AD5A 4KSBA 5L3RA 4JT4A 1COWA 1Z22A 2YVUA 3IEUA 3QPVA 4TYQA 4DLTA 3MGCA 5J40A 1G3QA 3UWKA 2EYQA 1E9CA 3RLFA 2WJIA 1NI3A 3KUDA 1P9WA 3NKVA 2HF9A 4KFRA 1E0SA 4NPHA 4OYHA 4N0EA 2O8DB 1AQUA 4YMUA 2UKDA 3E2IA 1Z06A 4AKEA 4G5OA 2AFIE 5FI0B 2YKGA 4BLOA 4FMDF 3GLIB 3E1SA 3VR4A 2OSBA 1XWIA 1OFHA 4G0NA 1E2LA 1MR3F 2PZFA 1G8YA 3AKDA 2QG6A 3OIWA 4Q1BA 3U3OA 1GFIA 2FFHA 4MGYR 1P75A 3AV0B 3OZXA 4HLDA 4YMTA 3EPKA 2MSCB 4ACBA 1RRCA 5BYJA 3ASZA 2WMOB 3PXGA 4PPQA 3BOSA 1VCOA 2ODEA 3FKQA 5FPHA 3CF6R 3FKSD 2H1LA 1P4SA 2X2FA 1SXJA 3GLIE 2ZI5A 5ANRB 1OLOA 2X77A 4IOKA 5JZVA 4JVLA 1XFAA 3RS0A 4IJMA 3TQCA 2BEJA 3LXRA 3EIHA 2IUSA 3UMRA 1DAMA 1S3SA 4URYR 3CZQA 1IJEA 1E0KA 1XPRA 4ARZB 2Q3MA 1Q20A 3NBZC 4DWJA 2P6RA 3ZIAA 2IF2A 1KDPA 1SXJC 2ANCA 1KI6A 4Q4AA 4QL3A 1NVUQ 3PEVA 4ZI3A 2IYSA 2VP4A 3WY9A 1E2KA 4ZDJA 3AKCA 4KYUA 1W4CA 4Q03A 2CCGA 3AVVA 1E2DA 4TLCA 3RC3A 3NEJA 4DLXA 2JIZD 4JS0A 1K6MA 1E1RA 1US8B 4DSOA 2ZUDA 2QZ4A 1E9SA 1KK1A 3SJCA 5B58C 4EQ6B 1ODFA 4R98A 2OE2A 1UF9A 5DYIA 2WSSA 3BS4A 1GL7A 5CK4A 2ZANA 1HY3A 3VLFB 2YV5A 1S2MA 2ZAMA 3W3AA 3V00A 2NPIA 1U8YA 4HAVA 3LNCA 4GP7A 4OQXA 2ZS9A 2NO0A 4NTZA 5LB2A 3NH6A 4B3XA 4TL9A 3GLHA 2JJ1A 2RGBA 3RHFA 4TTQA 3EARA 5F3WB 1JQJC 3EZ7A 4JYBA 1XZPA 2ZI9A 3BWDD 3DOFA 1V5WA 1Z6TA 3WRXC 3JVUA 5A5GA 1H8HA 1TQ6A 1AZTA 3DZ8A 2PEYA 2CJWB 4RCZA 4GMDA 4HEJA 3EZ6A 1E2PA 4GOXA 4L5BA 5HPYB 2J87A 2XJ4A 5L3QB 3AM1A 3TH5A 5GJVC 3BERA 3QKSB 5HKKA 3CW2A 2DFKB 2AX4A 3QVVA 5CIWA 3QKTA 4BWYA 4E09A 1R0ZA 3OIUA 2HLDA 1N6OA 2CDNA 4XOIA 3IQXA 3IHWA 4JLBA 1G18A 2ODNA 2XITA 2QENA 3G82C 2XTZA 4TTRA 2QPOA 3PUZA 4TLAA 2R9VA 3TW8B 1MO4A 3P26A 3GJ6A 1MO3A 2PCLA 5FOVA 3OFNA 3WBJA 5JLJA 4B3BA 2QBYB 4RY2A 3EWAA 1JECA 3NG1A 4Z1MD 1VCIA 4UXJA 4P33A 5JRZA 2AK2A 2BWJA 1NBMD 3KKNA 1DOAA 2VP0A 4TMZA 1A7JA 3UIEA 4MUBA 2K5UA 3CZPA 5E95A 3HP1A 1KY3A 5FI1B 1UKVY 1OPXA 1JJ7A 4GT1A 1E98A 4MRVA 3VX4A 2GEDA 3TR5A 2H18A 3FGNA 1E6CA 1H8ED 3AVTA 1J90A 1BMFA 2C04A 3U3KA 1XNJA 1F2TB 2ZJ2A 4D4LA 2BVNA 1OW3B 4MA4A 3DMNA 4IFEA 2F1IA 1DARA 2IUUA 4EFNA 2R9GA 3KJHA 1CR4A 2RGXA 3PEUA 1JEDA 1SVIA 1G8FA 1W1WA 1CRQA 3KJIA 4QGFA 4UKDA 5LPNA 3QG5A 1X1SA 2XB2A 2GTPA 1OE0A 3O8BA 1LVGA 2O5VA 2UZ3A 2GRJA 4PZYA 4ZIRB 4Q9IA 2HT1A 1NY6A 3CNLA 5J5CA 3ZVLA 2ORVA 2BKUA 4YLGA 1P60A 2AR7A 2GEUA 2ZREA 2D2FA 1Z6GA 3C7KA 3ZD6A 2VBCA 4V02A 1XPOA 3CONA 4LYHA 2FZ4A 3QF4B 3SNHA 1ZU4A 2FX3A 2O8EB 2QP4A 5FOXA 1I4TD 1N25A 1KI8A 2OLKA 1FP6A 4TMWA 1P62B 4JJZA 2ZRLA 3LH5A 4Q5IA 4L8GA 5J4YA 1PLJA 5GVSA 2QN6A 1UKZA 2GXSA 3NHBA 1QBKC 3WMEA 3W90A 8OHMA 3P4YA 3RS3A 1EG7A 5FBVB 3KL4A 2BMEA 3CRW1 1U8AA 4I99A 4OI0A 1MT0A 1Q22A 2H16A 1G7TA 5SZKB 3B60A 3AP2A 3SQWA 2W00A 2I1QA 4Q48A 1SHKA 1PZNA 2P5TB 2YNMA 4QJ4A 1IY2A 2WV9A 2AFHE 3GJ8A 4M1KA 2OXRA 2ZJ5A 3GJ0A 2FGJA 3E5HA 4NONA 5IK2A 4E5UA 4F4CA 1F5NA 4WZAE 4XSGA 2WWXA 2NG1A 4GI7A 1W0KA 4IDQA 1EFHA 3TW4A 1OB2A 2O8CA 3HDTA 2QW6A 1QF9A 1G3RA 2AKYA 4ILEA 3VU9B 3NDBB 1OHHA 3SFVA 4EIWA 4IHQA 4DT1B 2XXAB 2P6UA 3T34A 3IBYA 1SVSA 2FSIA 3GEHA 4RD3A 2J0UA 4TMTA 1F48A 3B13B 2IT1A 1CR0A 4WOPA 3LD9A 5FOTA 2WWGA 3M1IA 3VQTA 1FQJA 2EWVA 3DOEA 4HAYA 4N0DA 4PC6A 1ANKA 2XSZA 1FFHA 2DVWB 2BBOA 2HYIC 1XPUA 3RS2A 1B0UA 3B1ZA 4URXR 4OK5A 1Z5ZA 4H1VA 4LUCA 3BXZA 1DPFA 1P5ZB 3T35A 4V0OA 4QC2A 2IL1A 2BBSA 3EZ2A 5DGXA 4XWAA 1G64A 1QHIA 2VHCA 1XTJA 4J0QA 2ZJBA 3Q9LA 1RZ3A 3T61A 2NPFA 5L3SB 1IN5A 4S35A 4FMCF 4IKEA 3K0AA 2DBYA 3UMFA 4JVSB 1KY2A 2V3CC 4LYFA 5JEDA 1GWNA 4LYJA 3BB1A 4RCYA 1W36B 1II9A 2IS6A 1ZNZA 1D8TA 5DN6D 1S3GA 4AKGA 2DHRA 3W6NA 3DKPA 4BLQA 4CT4B 3OIVA 2ONKA 5J47A 1N5KA 5KTYA 2CEAA 3Q7QA 1SVKA 2EWWA 2YC4C 3QKUA 4Q4HB 2QTFA 5JECA 4CEHA 4OJQA 1Y3AA 1RPZA 3MHVC 3UKDA 1TF2A 1S9DA 3NEYA 3U4QB 3I5YA 1N6NA 1F60A 3L82B 2P6NA 2PL3A 2ZROA 2WPDA 3OE7D 4CEJA 1QHHB 2OM2A 1S96A 3KQLA 2ZS8A 2F7SA 2L0XA 3I92A 1K8RA 1N6RA 4EPTA 4AKIA 2GJKA 5UKDA 1G291 4BE7B 2OV2A 4DJTA 1G16A 1P6XA 2BMFA 2PBRA 4Q9KA 1FMJA 3LY5A 4EUNA 4C7OB 5BYKA 5BN4A 2R6CA 4LHVA 3AEZA 3FFAA 5EUQB 2G9NA 2BBTA 5KU1A 4JYCA 3KKMA 5EZ6B 4P31A 3X1ZA 1HV8A 2V1UA 1YZQA 2WWWA 3W8RA 2GCNA 3H84A 3N2EA 5DH9A 3SI7A 1QVAA 2WWIA 3FMFA 3PR1A 3KUCA 3RSOA 3K53A 2CNWD 4FD2A 5SZIA 5AJZA 1G21E 4F93B 3U3JA 4M9ZA 2VHJA 2A7QA 4JBWA 4TT3A 5F98A 4WXPA 5HE9A 5KNDA 4A4DA 5KPDA 4DUGD 4RKFA 1GSIA 2DR3A 3ZVNA 2A78A 4I1OA 4JZKA 2BHRA 2IYQA 3RNLA 4IFBA 4PC2A 4RFVA 5IT5A 4C2UA 5EQTA 3UK6A 1ZM4A 4B3GA 4D4JA 1Q21A 2J1LA 2W0SA 2ASEA 3D31A 4MYUA 4R71A 2AHOA 5EE0A 3QVUA 4DIDA 2PZGA 2VPPA 1YZUA 2AK3A 2FFBA 2OFOA 4DLWA 5FPSA 2F3TA 2CNWA 3RABA 2CE2X 2FF7A 3TSOA 3B78A 2FE4A 4NBSA 2KWIA 4KV9A 1OXXK 1J8MF 4YONB 2N46A 1OT3A 5AJXA 3GLFB 4DLVA 5HTKA 4W9MC 4A0RA 1VECA 4CZ2A 1EK0A 1JPNA 5F2EA 4K46A 1QHYA 3CX8A 3MJRA 3TVTA 1E69A 3AQ4A 4HAXA 5FUYA 1XCGB 1II8B 5CM8B 3VNUA 4IDHA 1CJUC 2R44A 2WIAA 5FL7D 2IYXA 1DAHA 5LDDC 2JLSA 5KSYA 1RIFA 1D9XA 1VHLA 3NWJA 4I1UA 2PJRA 2KE5A 3WYGA 1TL7C 5JBQA 2A5FA 2QSYA 4GP6A 2O0KA 4MUAA 4E22A 3CX6A 1UBEA 4LJYA 1DAEA 2XEXA 5EXTA 1EXMA 3L0IB 4LHYA 3VHXA 2FJUA 5JWRA 3LLMA 5CLQA 2C77A 2GXQA 2GCPA 1XB2A 2HXYA 4QNRA 4PO9A 2KB0A 3CNNA 5ELXA 1KMHA 4O0MA 2ZSEA 4ZDWA 3A1UA 5GVRA 1OKKA 4HDOB 2VIIA 1B23P 3H4MA 2B6HA 2R6GA 3LRPA 4XD7D 4TMKA 4L9WA 3A1TA 4ZV4A 4QM6A 4FN5A 1UFQA 4DLRA 1ZCBA 4M0LA 5CITA 3OEEA 1OFTA 4C0KA 2ZSDA 2O8BB 1YE8A 3KKQA 1E79D 4CEIA 1OYYA 2AD1A 1G5RA 1PJRA 3HR8A 5L3VA 5KNBA 3FTQA 5CM9C 2QTHA 2JJ2A 4QHSA 3RSLA 4QGGA 3BGEA 1E2MA 4WBSA 1NN0A 4C0QC 5C2JB 2FOLA 1DG3A 4PC7A 4QJ3A 4BGDA 3GJ4A 1WBDA 3ICEA 1XDBA 3W3ZB 3CWQA 1AKEA 1C9KA 1W2HA 4KITB 4AYXA 3OAAA 4K81B 5JJKA 3CNOA 2OCBA 2NMVA 1Q1QA 1KI2A 3R8CA 2P5SA 4IRUB 3TGPA 4EDHA 1LF5A 1M74A 5AK0A 4PC1A 2QAJA 1ZUIA 3AF2A 2BV3A 4PC3A 1LTQA 3Q5EA 1A1VA 2FNAA 2HCBA 4WZ6A 4FWDA 221PA 3TVDA 1N3BA 1NVVQ 2QE7D 4D4KA 1UBGA 2ONJA 4Q1AA 2BJVA 2FGKA 1KJZA 4GZMA 1ZNXA 2CL6X 1T0JB 2KJQA 2XZLA 2J7PA 1LV7A 1VTKA 1Z3IX 3AVQA 1SXJB 1T3HA 3G0HA 1HH4A 2V1XA 3HR7A 1I2DA 1O3YA 3ADDA 4A6XA 4C4PA 1LS6A 2RHMA 2EFCB 4NYMR 2DFTA 1D2EA 4BEJA 3U7FB 1AQYA 5F9FA 2WM9B 2XTMA 3MG9A 3X1WA 4URUR 3OESA 5AR1A 1HTWA 4H1UA 3B2EA 4KYIB 2BC9A 2ZR9A 1IN7A 1E2IA 3HWSA 4DCUA 5EP3A 1SKQA 3HU2A 1KI6B 1N0WA 4Q4AB 1KKMA 4B3DA 4II7A 4DDTA 3IIJA 4PTLA 1N6HA 5K8IA 4L16A 1E9DA 4QBHA 4EFMA 1J99A 4L4UA 3WHKA 2C9YA 1P72A 2ERXA 3QXSA 3WNCA 4XVUA 2GJ8A 1BOFA 2BCJQ 3VR2A 4CIDA 1Z29A 3AF4A 4IVRA 5JS7A 1XD9A 3LQQA 3GJ7A 4P4TA 2C95A 4K8OA 5CYOA 2P0EA 4RZXA 3KKOA 4V0KA 1GKUB 1ZBDA 2ZRMA 1R5NA 3S1AA 2KRKA 1U0JA 1NVWQ 5EZ5A 3K9GA 1Z2AA 4OI1A 1XTKA 3K8YA 4NU0A 2FFQA 4X8LA 3GLHB 4FCTA 4BFUA 1T4GA 3LAWA 2P2LA 4ZO4A 1SVOA 1PLKA 5GJCA 2O0JA 1G5TA 4NH0A 1L4UA 1VIAA 2JLWA 4NHOA 3NTUA 3QNUA 1SKYE 1X86B 2GKSA 1KK0A 4RSGA 1XMSA 2DB3A 3R9IA 2I1VB 1ZD9A 4DLYA 1VPLA 3RC8A 2LCFA 4M1OA 3IO3A 4LC1A 4PPNA 1Z2CA 1RRFA 3CX7A 4Q21A 3DZDA 4FCWA 5JHHB 4BLPA 2RGEA 3F8TA 4EPYA 2JASA 5FTLA 1IONA 2WJHA 2RGDA 3D7MA 4NCIA 2RAPA 4UNQA 2CMKA 2HEIA 5TDHA 4KCGA 3M4YA 3THWA 4OQFA 3DPUA 4HB2A 2A5DA 4RJLA 2HYDA 3THYA 1JAIA 1R7RA 1PUIA 2EVWX 1NVMA 4B35A 3B9QA 1JQLB 1COWD 2IX3A 2FZLA 1CF4A 4D6PA 1F2UA 2GESA 2B21A 2NZ8A 1EFUA 1FZQA 2C2HA 2A2ZA 3I5XA 1P73A 4KBGA 1KHTA 4PHFA 3PUWA 4NE2A 3IIKA 3UATA 4DCSA 4ZI2A 2JLZA 1RRPA 3CB4A 2ZYVX 2REOA 3BH7A 3LV8A 1UJ2A 3T1VA 1XP8A 1E2FA 1AIPA 1GTVA 1KOFA 1W4BA 3AUXA 2KSQA 3EG5A 1XX6A 1VHTA 2IYRA 1G41A 2EFHB 1NKSA 2D3WA 3B6EA 4PR0A 3AP3A 4OHYA 4M21A 1SXJD 1E9BA 4JLOA 1Z6YA 2R6DA 1ZD8A 1YU9A 5C1BA 2I3BA 2ORWA 3SZRA 4KO8A 1DS6A 3T5DA 1NN3A 2X2EA 3R8FA 1CJVC 2UVQA 3A1VA 3Q85A 2XJ9A 4D82A 4BFTA 4DEYA 4LGMA 1FNNA 2XX3A 1XF9A 2Q3FA 1TTTA 1AK2A 2VRWA 1ZP6A 4HZUA 4Q02A 2OCYC 3T15A 1HQCA 2F9LA 2V6JA 2QTVB 3ZIAD 2IYWA 3RS5A 5TB5A 4BRUA 3U5ZB 2PH1A 4NYJQ 3UANA 1S9HA 4AG6A 1A5TA 1WRBA 1K5DA 2IEZA 3DMDA 1LW7A 2R6FA 4YDSA 4AI6A 2FN4A 2W6JA 4GOJA 1KYIA 2D62A 4PO8A 3RYTC 2DFLA 2G3YA 2J3EA 3C8UA 1OJLA 5FH9A 1E1RD 4WIAA 1N5LA 5TXGA 4MYTA 1AS3A 2ZRCA 1BS1A 3Q5DA 4M1TA 5D3QA 2WSSD 5KSPA 4CGZA 2HCJB 3IHLA 4BLRA 2D7DA 3L0PA 2WBLC 4TQ9A 4HAWA 2B8WA 2JATA 1GNRA 1KO1A 3QPWA 4JLKA 3I4LA 1GITA 3PQCA 2IEYA 1NLZA 2O8CB 2JJ1D 1SZPA 2EU8A 1TF7A 4RFSA 1HE1C 3FOZA 2ZRFA 5D3MA 3CPHA 4TLBA 2R65A 2GCOA 2NOAA 2ZJOA 3CR7A 4KI0A 4Q4JA 2RGNA 3C15C 4LRTA 5EP1A 3CLVA 2D74A 3CM0A 1H8HD 5SZJA 1R0YA 1DBSA 3MLEA 3AGPA 2A5JA 3A4LA 3LVRE 3IBGA 4R7ZA 5BQ5A 1QG4A 4BASA 4DSNA 1G7SA 5HKKD 1XEWY 2D4HA 4YDHB 4XJXA 1DADA 2I4IA 2RGNC 1C1KA 2ZE8A 4TZ6A 4NCKA 2HLDD 2YWHA 3F5FA 3PIRA 2FDCA 2YYZA 2VA8A 2DZNB 1S1CA 1E9EA 3NVAA 5DIFA 2C5LA 1Z6XA 2QPTA 3HYRA 1DEKA 1X8KA 1OFIA 4WW0A 3OFND 1WCV1 4HB4A 1KAOA 3TK1A 2XB4A 1J2JA 4DXAA 4QKQA 3TNFA 4GSYA 3GJ5A 4ZCMA 4RD4A 3FHCB 1FOEB 5FTJA 1UPTA 3K0AB 3KXIA 1GL6A 1KSHA 4DLSA 3V4RA 3J81k 1CJTC 2OEPA 3CWZA 4QBFA 1DAGA 4PZLA 3KQNA 3QOFA 3RRYA 4JLVA 4HAZA 1EESA 1GG2A 2QMHA 2ZAOA 2NTYC 2J59A 2N42A 2QNRA 2VHQA 2J0QA 1OIWA 1E4VA 2JDIA 2DWZB 3QKRA 1BMFD 1OH6A 4CEHB 5KHOC 4M1WA 3CH5A 2BCGY 4F7WA 3NC0C 3EPHA 2J41A 4U02A 3CRVA 2H5EA 1NMYA 4MDEA 3NIBA 1AGRA 2MSEB 1GKYA 4CEJB 1KMQA 3BAFA 4A3VB 4JMPA 3QBTA 3GQBA 4BZPA 4JJKA 4OJKA 1ELOA 1KI9A 3DEFA 2FG5A 3SU8A 2JGNA 3GFTA 1XD2A 2QROA 2OCPA 4OK3A 2ZE6A 3LWNA 4LRWA 4LY6A 1N6LA 4FWIB 1E2JA 4ZKDA 3KX2A 5H1YA 1GKIA 4ITRC 5CB8A 2YWFA 4OQMA 3CTDA 2Q9BA 5DI3A 2KI5A 4MKFA 2QI9C 3VTKA 2BOVA 1NVXQ 3SDZA 1FPMA 2OFWA 3NC1C 4HDQB 3DVLA 1D9ZA 1ZMXA 1ESNA 2PT7A 2YOHA 1GDDA 1W4AA 3B85A 2NO1A 2EFDB 3JZAA 4KFTA 2W83A 1WBBA 3PVSA 2ZRJA 3W34A 3I8XA 1W48A 4D80A 2GK6A 3EPJA 4ACAA 2J5XA 4LRSA 1XJCA 1L4YA 1NN1A 4XVQA 3OF5A 3IDQA 3A36A 4MH0R 4OQLA 2GBLA 4G5GA 3W6PA 1GUAA 3RWMB 2CVFA 2XGJA 4R9UC 5JJLA 2C9CA 5IK2D 5JSZA 5TY0A 1JBKA 3BRWD 4LSGA 1JJVA 3U7EB 2IYYA 3LO5A 4DIEA 1FNMA 1W0KD 2BBWA 2C78A 2IYUA 5C4GB 2JLXA 2GHIA 4PQYA 3HYTA 3OIYA 3VKWA 4U7DA 3ZS9A 2VHUA 1OHHD 3AGQA 2ZE7A 3O47A 2GVZC 2Z0MA 3KFXA 1GVNB 1PVOA 4Q1CA 2GBLC 2P65A 2QMEA 3HPRA 3WP1B 1DAFA 2QP9X 1CXZA 2HXSA 3SHFA 1JB1A 1W4RA 3NHAA 2NO7A 1XMJA 1E99A 3FYHA 4A2QA 4HUTA 4JLMA 1IXSB 3CF0A 4NCNA 5B2ZA 1Q12A 1QZMA 5FUVA 2XSZD 1AS2A 4Q7KA 5TARA 4A2WA 1A82A 1VG1A 5C46F 1Z0IA 3DO6A 1WDTA 4TSFA 4BUJA 5EP2A 3SN6A 4HLCA 2Z4RA 2XNSA 4X8OA 4W5WA 4MRRA 2IS1A 2FSGA 3ADKA 2DZOB 721PA 1IOZA 3K0FA 1A2BA 4G01B 4CT5A 5HZHA 4JLDA 4QNMA 5E4FA 1PV4A 5CK5A 4LWZA 2FPMA 1Q0UA 5J4HA 2H17A 3BGWA 4XWKA 5CDFE 4HLUA 5CJPA 2CCJA 5JI3E 2KBFA 3WRYC 1OV4A 1FX0A 1ZRHA 1SVWA 4GBMA 2ZSBA 2QY9A 4PO1A 1GRNA 2ATXA 4US1R 4OL0A 1Q1BA 4DVGA 2WJYA 3CBQA 5H68A 4ARZA 4DLZA 2YZ2A 4HAUA 3IPXA 1JR3E 3RWOA 5BN3A 4BFWA 4LJ9A 4HLUC 1GP2A 1G3MA 1GOTA 4EKDA 2D06A 4A0GA 3QF7A 3GJXC 4IDNA 4IDOA 2NZJA 4MRNA 5KOYA 3CPJB 1YHNA 2VSOA 3GMTA 4TLDA 4D25A 1S8FA 3IIMA 5FFMA 1CKEA 2IYVA 1QHSA 5J4KA 4C0SA 1RW4A 1TQ2A 2QPAA 1G4UR 2WPDD 2ZRIA 5AJWA 2ZJAA 2B92A 1RYFA 3T1OA 1XZQA 2C03A 4ASUA 3ND9A 3DM5A 4JBYA 3SHWA 5JEEA 4ZPXA 4YMSA 5JI2E 4QM7A 3K9LA 1YRBA 4WA7A 2YOGA 2ZI4A 3A58B 4C0BA 5JS8A 4MQBA 4TYNA 3ZZUA 2WJVA 1RJ9A 4NYIQ 2A5GA 4IOJA 1XJ0A 2CVHA 4GL2A 1YJ5A 1BYUA 1AA9A 3Q3JB 1JXMA 1UBFA 1W0JA 4WXRA 4GNKA 3ZH9B 1R8QA 1NLYA 1HURA 821PA 2YJTD 1G20E 3NBYC 5DLQC 2VL7A 4KXFB 5EXPA 1U90A 4TT3D 1R6BX 5HZKA 1D2NA 4JN6A 4LYAA 2GF0A 2PZEA 2BMDA 5KSZA 1CTQA 2N1BA 3P32A 5CJ2A 3O8RA 4Q7JB 3E70C 3MAAC 3FWYA 4BPBA 4V03A 4QJ5A 3I73A 3KXKA 1E96A 2ZI3A 4IOMA 5TV2A 2WSMA 2Z6VA 3BK7A 3FDIA 4W5HA 3T5GA 2X19A 3CIOA 3FMIA 3U6KA 3ZLJA 4AYTA 3A8TA 4TMXA 3REGA 3U7GA 2FSFA 2F3RA 3CR8A 1VIYA 4LC0A 1J70A 2HF8A 3I1FA 2H57A 1QRAA 4M22A 4P3YA 2FH5B 1M6NA 3QE0A 3U6BA 2GJAA 2V6ZM 3H2YA 2J46A 3WNBA 4ERNA 3FHTA 2B7CA 2CBZA 1VCMA 1VKJA 5FBRB 4M1YA 4TL7A 2ZTSA 5DYGA 3WYAA 6Q21A 5GJBA 2XOKA 1XEXB 4TYYA 1IXZA 5CYPA 4A9AA 4BLSA 2CE7A 1SHZA 1X6VA 3ASYA 2JLQA 3C16C 4V0ME 1NJFA 2A5YB 4FIDA 4A82A 2QT0A 4UNRA 1NRJB 3MWYW 2ZU0C 1EWQA 5EJEA 1XCMA 1L7VC 1GNPA 3VNVA 1FTNA 4Q9LA 2ZRNA 4FWTA 3SR0A 3EAQA 5G53C 2ZU6A 4F91B 1F3OA 4BFXA 5K8LA 3EXAA 3IO5A 4Z54A 2IYLD 1NSTA 1XCPA 1Z0KA 4TQUS 3ZZ0A 3UMSA 3U7HB 3TUJC 3QSYA 4HLQB 4ZIRA 1CS4C 2QU8A 3AJIB 3SEAA 3TUZC 5FUWA 4Q66C 2AKAB 5IHPA 3L0SA 2AXPA 1N6PA 1S4QA 1K5GA 3UWOA 5KYKA 3ECCA 2O8EA 2WJGA 4WVFA 3K70C 2WICA 1KSFX 1VG8A 1YZNA 1E9AA 5CDFA 3KB1A 2ZR0A 4N1AA 2NQ2C 3THXA 1OKKD 4LV5B 4Z8XA 1NIJA 3LX8A 4B32A 4LV8B 2WOOA 3U44A 4KVAA 5AUOB 3ZDQA 5AUPB 1JR3A 3EIQA 3C14C 2OCAA 4DBLC 2FPLA 4LBWA 1U2RA 1KDRA 5FR1A 3GEIA 3OEED 1DVRA 4QFMA 3MMPA 3R7WA 1W5SA 1W49A 3GPLA 4A8JB 5H8WA 2OBLA 4OHZA 1NN5A 4S2EA 1QDEA 3KFVA 3NXSA 1EGAA 1IM2A 2XZOA 3THWB 3W5IA 2JJ2D 1PUJA 2ZUCA 1Z0DA 2ZPTX 3MJHA 5E7MA 1N5IA 4DB4A 4A15A 1GZSA 3THYB 1P2SA 3TR0A 3CH4B 3FMOB 4DT1A 3HPQA 1OH7A 1HT1E 4RD2A 1BYIA 4A92A 1KSJA 2G83A 2IC5A 1E1QA 3OHMA 4UXHA 3WHLA 1FMLA 3OAAD 1F2UB 4B34A 4EFLA 3D3QA 2OXCA 1OB5A 3PFIA 2IW3A 1S1MA 2A3RA 2DWOA 1W47A 1S0UA 1E0AA 1ZJ6A 3FMPB 2V7QA 2WOJA 1HYQA 2PMDA 3QBVA 2VSXA 4Y0AA 1G8PA 2YOFA 4HDCA 4BECA 3PENA 4JLPA 2HV8A 3NDPA 3EX7C 4XVRA 4LV6A 4DRZA 5IF9A 4M4SA 2ZI7A 4MYHA 1IN6A 1ETUA 3D6TB 3MD0A 2VYFA 4PHHA 3K0SA 1NSFA 2WAXA 3H86A 2J7PD 4B44A 1OIVA 4A6PA 2CHVA 1ESMA 1MO5A 3PG5A 3GLGA 1TX4B 1E2EA 2HUPA 4W5JA 1G8HA 4TQAA 5JMTA 4JT2A 2J0SA 2F55A 1MOZA 4R2HA 3I8SA 1T3SA 1XD8A 2FSHA 4CVNA 3AF0A 1C4OA 1N0UA 5EXSA 4EPXA 3A37A 1OXTA 1FUKA 3AKEA 4HZUB 2UZIR 2IWHA 2QAGA 3GJ3A 3CRMA 2BIFA 4Q00A 3QENA 1Y63A 3SJBA 2WHXA 1GNQA 4YQFA 1Z08A 2J45A 4DEXA 1YZTA 3GCGA 1NG9A 1VYTA 3SOPA 3U60B 3BORA 3ND8A 3U4QA 2CK3A 2XNDA 2IK8A 1W36C 4I81A 4F92B 1UAAA 2IS2A 1O87A 1WXQA 3ADBA 3BC1A 2RGGA 4V0MA 1QHHA 1KK2A 3P20A 1XXHE 3QJYA 1G5PA 4Q9HA 2QAGC 4AWXA 3CRRA 3X1XA 3CPEA 5K8UA 4GPTA 1LB1B 1KGDA 2FMXA 4TYPA 2Q0HA 2XTNA 3ONWA 4CDGA 4O2RA 4BFZA 1Q3TA 2IYZA 3K9NA 2WVJA 4US0R 4PPGA 4OHXA 4Z8YA 1G19A 1GAJA 2O52A 1NF3A 3RVBA 4RFSB 2QSZA 4V0NA 4D2IA 1T6NA 1YKSA 3R9WA 2ZXUA 5JWHA 3BH0A 4QGAA 1G7RA 2GK7A 1UDWA 2LWIA 3L8ZA 1IJFA 3QPUA 3MSXA 4UNNA 4P4SA 2QRNA 2J7KA 1TUEA 2W6IA 3PUYA 3CKLA 5FUXA 2D2EA 5K8TA 2QMUA 4YMWA 1G6OA 1W5TA 3GFOA 3QG1A 4JKYA 4JIMA 3TAUA 3QUSA 5B64A 2CXXA 1NVVR 1IBRA 1MH1A 1WB9A 1SKYB 4GITA 1IY1A 1XU4A 1Z0JA 1XEFA 2AN9A 1NLFA 3ZJYA 3L0OA 1R8SA 1MABA 2GVDC 5DO9A 4TL8A 4RD1A 4NZYA 5FBLB 1JEEA 2MSDB 1KJYA 4C30A 4LJ6A 1EWRA 4MKIA 2ZRAA 1R5OA 1Z07A 4TN1A 2VSFA 1Z83A 2QGNA 4HUQA 1VG0B 4O2LA 4FCVA 3TLXA 3X1YA 4Q7LA 4OHWA 4GOKA 3GLFA 4P32A 3EPLA 3QXJA 3BFVA 4A0HA 2WJJA 3FB4A 2Q9CA 4XTRA 5TVKA 4GFDA 3EZFA 4PANA 1YRAA 4POAA 1X8JA 3EC2A 5AUQA 4YXWA 4NP6A 4KBFA 4RD0A 4OI2A 5DNYB 5J4LA 2P67A 3HU1A 1II8A 1ZINA 2DYKA 1NG1A 3BB4A 1X8LA 2ZYUX 4IXMA 1L2TA 2G1JA 4P0TA 4C3ZA 3KXLA 5L8VA 2YC2C 2V55B 2FPKA 2OFXA 2ZRPA 5GJWC 4D0GA 4I1VA 1TU3A 4B73A 3B9PA 3PUVA 2QQ0A 1KO5A 4C0LA 2EQBA 3B1WA 1KI3A 3LW7A 4KFUA 2W2TA 1IY0A 2QMOA 4KAXA 1XTSA 1XD2B 2IWRA 2FEMA 3A4NA 3Q72A 3PCRB 3MWLA 2GAAA 3LLUA 3T1TA 3ZGXA 4BFSA 4Q47A 5JWOA 2JEOA 4BLTA 5FTKA 5C18A 1CBUA 4W7SA 3I3SR 2JA1A 4L15A 5DI3B 4HYYA 4BEBA 2OBMA 5BXQC 5JCPA 3VFDA 1QHNA 5G41A 5AUNB 1HQYE 2PX3A 5SZHB 4KU4A 1XMVA 2W6JD 3ETLA 4UNSA 4P4UA 2DWQA 2PT5A 3FVQA 4UXIA 1TADA 1E94E 2V8OA 4CYMA 2Q9AA 4LBZA 4CF7A 3WYFA 1QVRA 3KQHA 4A0FA 4TL6A 1P3JA 1WMSA 1U0LA 4EJSA 5JSZB 4PAQA 1T8UA 1J8YF 4Q1DA 5KUTA 3IEVA 2R6AA 3TBKA 4JVNA 1E2NA 1XXHA 1UM8A 4MRPA 4UQOA 4ZCIA 2RHDA 2H8KA 2F6RA 421PA 2REBA 3LXXA 3H0KA 4PFSA 2WKQA 5LD2C 1ZIOA 4DB2A 2ZQ5A 1IN4A 2XAUA 3ICQB 1XBTA 4EJSC 3SQXA 3TKLA 4FMBB 3U3MA 2O8FA 4TWZA 2EYUA 1ZVQA 3MWJA 2QRZA 1YVDA 3IKJA 2FFAA 4WZBE 3M0EA 4RD6A 4DDWA 3N5CA 1NBME 3A1SA 3QY0A 3X1DA 5GADl 5JJIA 2R8RA 3VR6A 3PJRA 1T5LA 1FL9A 5CB6A 1UEIA 1ZC4A 4LCBA 2EFEB 3KZ1E 2HJVA 3K0FB 4DZZA 3SC3A 1HEIA 1LFDB 4PQRA 1TF5A 5KDLA 1YR7A 1MKYA 3EIEA 4E03A 1TNDA 2Y8EA 2FWRA 2ZJYA 5FTNA 3O8DA 4HZIA 3OEHD 4LBYA 2D7CA 4B48A 2JAQA 4HI0E 1R5BA 4LBVA 1Z8FA 2AL7A 1U81A 1FX0B 1TQ4A 1TPZA 2J0UB 2LKCA 4XSHA 1PLLA 2GXAA 3QEOA 4MKGA 3TE6A 1ZM9A 1FTSA 4DDUA 3T1QA 3JZMA 3FHOA 4GRAA 4NYJR 2Z4SA 2BKEA 3L2OB 4M8NE 2GXUA 4TYWA 3HU3A 1AJEA 2FU5C 1CJMA 4PZZA 2OZEA 1T5IA 2JDID 1UADA 3L8YA 2QGZA 1LNZA 3MWKA 5M04A 1OXVA 5E7JA 3FKSA 5FTMA 1QG2A 2WMNB 2ZITA 4LJAA 1SQ5A 2G6BA 2IHBA 3SYNA 2BMJA 3B1VA 3RS7A 3PV0A 2E9SA 1Q1EA 1XRJA 3OEHA 2ZR7A 1N2CE 1Q3HA 3RRZA 2RKOA 2CLDX 5BN5A 2NO6A 3KQUA 4LHXA 3BFKA 2ZS7A 3VMFA 4BRWA 3ZYCA 3TSWA 3Q8XB 1VDZA 3ZD7A 3TAHA 3DM9B 3LX5A 1EX6A 3EZ9A 3K09A 1RJ9B 3N2IA 2QM7A 2QP3A 2ZYWX 2O0HA 4MDFA 3TMKA 3K1JA 4B71A 4DSTA 2H7VA 4Q01A 1KAGA 2NO9A 3I32A 4LJ8A 2GDJA 3MFYA 2TMKA 5EE1A 3R20A 3BBPA 4YMVA 5FPKA 1AZSC 2JIZA 4Q1FA 3MCAA 1DO2A 1UKYA 2YHSA 4HSEA 1T0HB 4IXNA 1GRRA 4U5XA 5A0FA 3K09C 1M34E 1CU1A 2OESA 1VYVA 4C0HA 5B57C 1LS1A 4XIGS 2VEDA 4D0NA 4TTPA 1LF0A 2JLUA 1A4RA 4G1UC 4B43A 1OSNA 1KNXA 3KTAA 2JLRA 4FMDB 5HR5A 3LA6A 4X8MA 1ZM3A 2V9PA 1W2GA 3P1JA 4B3FX 3AP1A 2ZRKA 2X8AA 3SFZA 1BKDR 3A1WA 3SBEA 4FXPA 5DE3A 1ZM7A 2V4ZA 1Q57A 4QGHA 3X2SA 1FUUA 2J0VA 1KI7A 1R2QA 2QUZA 2IF0A 4KLZA 1H65A 2WIBA 2R62A 2YWGA 2ZRDA 1AS0A 2X1VA 1SULA 2SHKA 1X3SA 3DKVA 2ZUBA 3MRSA 3TQFA 1U98A 3NBFA 4X8HA 1F6BA 1P9RA 4DHEA 1CJKC 4M1MA 4B6FA 1E9FA 4AG5A 3UG7A 4DSUA 2PJZA 2QM8A 1XJQA 4ABYA 2QEQA 5JFGA 3RS4A 5HCIA 4TSFD 3TUIC 4RZUA 3AVPA 4URWR 2F43A 2BM1A 5E3HA 5G3ZA 4A36A 1ZYUA 1DELA 1C1YA 4OBEA 4Q7MB 5DHFA 2C99A 1YZKA 2WWFA 3B1YA 4C0JA 3K70B 4IEEA 1N0VC 3W9YA 1N6KA 4M9XA 4EPWA 1ZD1A 1FP7A 4Z1MA 4G5SA 3KB2A 5EE5B 1NBMA 4UNPA 3REFA 2PLFA 3WNDA 3WMFA 3FPAA 2G0NA 4PX9A 5F9HA 5EE3A 1Z0AA 1ONBA 3SJAA 1G6HA 4A1FA 4ZKEA 2O8DA 2IHYA 4LK2A 1HT2E 4C2TA 4Q1EA 3PITA 4RZ2A 4LOAA 1OIXA 4QBGB 3GLIA 2OLJA 2OILA 2C98A 1H8EA 2ORIA 3I61A 1XTIA 2PLRA 4HATA 3AVWA 2GETA 4IVQA 1VG9B 2WKPA 3AB3A 3H1TA 5AWFC 1A2KC 3UG6A 3THXB 4KLNA 1DAKA 2Z83A 1XTQA 2ATVA 4O25A 4A2PA 3U44B 3V4FA 3JVVA 3U61B 2REXB 3P4XA 1WE2A 3IGFA 3WBKA 2ZSFA 1CP2A 2YINC
chains in the Genus database with same CATH superfamily
3V2HA 5G3YA 1XR3A 4IMPA 1XWFA 4I4LA 3VBCA 4H9GA 5F7ZA 3O8LA 3GU3A 3HUDA 1ISHA 1H05A 2QRLA 4FYKA 5ADUS 2O2JA 3MF4A 4WXYB 1FDTA 5F2OA 1VIMA 1G71A 4M9CA 4I1YA 4CEIB 5NLLA 3LHIA 4HQRA 4AZVA 3WGKA 3SSNA 1MQAA 5E6RA 3KJEA 3SF0A 4L76A 1E3EA 4BO6A 3NVDA 1OAAA 2ZJ8A 1JU4A 3SEFA 3NYIA 1CR2A 3IPRA 4MV3A 4C4TA 3SQDA 1OBCA 3QKSA 3H05A 2H4XA 1TA9A 2ZYDA 3DLPX 2JCXA 5I47A 2CMDA 1M7HA 4WJLA 1OXUA 4A1OA 2ECFA 2PAFA 4DLUA 4OKSA 4BZQA 3RYIB 4PRKA 1C3XA 1UWVA 4I4CA 4ZQGA 4LDRA 2WF5A 4HWGA 5CX4A 3TQIA 3CRNA 3UCEA 3KYCA 1Y8CA 2EFGA 1QYDA 3S1AB 2ZT7A 2PCJA 1JIJA 4FXOA 3JD4A 2IDMA 3W8FA 1RZVA 1TO6A 1TT5A 2G9QA 5JCZA 3H8JA 1LTMA 2IHZA 3WB9A 3T7DA 2EUCA 1CLUA 1LSSA 1DQPA 2YV2A 3V8EA 2P7HA 1DEAA 1MMFB 2FB9A 4TXMA 4NEHB 1U2GA 3I42A 2O3RA 1VLVA 1P61B 2VPWA 2BGKA 3LSYA 4XBOA 4CXMA 1EXDA 4MO9A 3BL6A 1RC0A 3H6KA 4RZ3A 3RH0A 2J85A 2ZBDA 1XZJA 4PSUA 5DM1A 1W46A 4D4HA 2ATEA 3MW8A 1Q0LA 1M1YE 3K9HA 2W98A 5LBIA 1MUUA 3AVYA 2Q8NA 1ITZA 3ORHA 3A3OA 1IHXA 4PFJA 2BD0A 4OP1A 3C9PA 1YR6A 4NCXA 4M86A 1E1DA 4J16A 3EMDA 1TM2A 5LU9A 3RSCA 2GVNA 1QB8A 1RRGA 3VR5H 1FVXA 4PAMA 5DBFA 4OHPA 2HQRA 1JR6A 1JA1A 1JI0A 1NNUA 1EP2B 1KSGA 4TKVA 4GMHA 3TZEA 4DWWA 1RTKA 3TIFA 3TNDA 4RTNA 4M0KA 3WTCA 5HE8A 1N2OA 1PG2A 1XMOB 1R10A 2FMFA 2HZ7A 4K0RA 4J1TA 1FTYA 4EGCB 3KW6A 4CIZA 1NDUA 2Q3HA 1IQPA 2VH5R 1EBFA 1FPQA 2G40A 3QVJA 5EVJA 4FOLA 4FYYA 2GERA 3UK7A 2NUAA 2FUEA 4Q3NA 4JQOA 2YBEA 3B3FA 1L4EA 3VC3A 2CFIA 4F2DA 2IRWA 3G1WA 3NKLA 4CKCA 1QOZA 3COPA 3D6NB 3IXQA 1ZQ1A 4BX8A 5HP4A 3DFZA 1KE2A 2Q8QA 1GGJA 4R9VA 1JNYA 3OURA 2CV2A 1MRSA 1FW6A 4LX0A 5D01A 3MPUA 2FXVA 1TAGA 1A8PA 1P8JA 4EY6A 3KR9A 2FJ0A 3TN7A 1U5CA 3RU3A 4CN8A 2VUUA 2ZT6A 1A9QA 2OPFA 4BKQA 3ZX5A 4Z99A 2O8NA 4HEA1 4RSHA 2BZSA 4TRNA 4FBGA 2PD4A 4OB8A 1G8YA 2QG6A 2FFHA 1P75A 4YMTA 1BXGA 4GVXA 1XMPA 4R2XA 4WTOA 2ID7A 3GUHA 3KVNA 1OLOA 3WSTA 4YCNA 3FF1A 4QFCA 3CZQA 2F4VM 1N9GA 4WBXC 1KDPA 4Q4AA 3WJ2A 3QK7A 2UUCB 3M6MD 2VP4A 1YQGA 1H4TA 4Q03A 4E6EA 2J33A 3SSMA 1C4KA 2CUNA 1WU8A 4RDXA 2J3DA 5CA1B 1JEOA 4B3XA 2ZSJA 5JAZA 5E6RB 5KOIA 5C37A 2C7OA 3EARA 1KH3A 2ZI9A 1JTVA 3I64A 2WILA 3JVUA 3ZXYA 4GI2A 3KHUA 3LC2O 3QKSB 1N8TA 3CW2A 4QUJA 3JATA 5IJAA 1N6OA 1G18A 4E32A 4NPCA 1AB6A 1IZ9A 4KYVA 2PCLA 3TGLA 1JFLA 5JFOA 3ZHSA 1E58A 4CMHA 3CZPA 1QZUA 3R3HA 3AQIA 3ZJTA 4GYJA 5BPHA 3Q8MA 1JEDA 4GEGA 3HHXA 1CRQA 3P9RA 4KR9A 3KYCB 3UW3A 3L1HA 4BV3A 1APBA 4GS5A 5ALXA 3HADA 3FVVA 4W1QA 4DILA 3UAOA 1U1FA 5I7HA 1TT5B 4JJAA 3JQ9A 5AQ1A 5DPMA 4DN6A 2CB9A 3KL4A 2Y67A 2YUTA 3ZU2A 1OFGA 1F06A 1U4NA 2I87A 4M8SA 4JYMA 4YGYA 1X7XA 4BQFA 1RDFA 4KW7A 1VI6A 2YIDA 1AC5A 2BGWA 2HRRA 3R6WA 4B85A 4QUDA 3H18A 1ZA2A 2BSAA 4IH4A 4KQXA 4KG7A 2XDAA 1DMRA 1N36M 1FE8A 2BBSA 1XJ5A 1JG1A 1L1RA 4XWAA 2LHGA 3GMDA 4E5MA 1U5AA 5I8PA 5KVCA 4Q34A 3TF5A 2OY0A 1TC1A 4F46A 1J56A 4LFAM 3W6NA 3NWEA 4BLQA 3D4IA 2CEAA 2JWSA 3KZNA 4DV7B 2COUA 4DXHA 5E4YA 3B12A 1Y33E 3NP7A 3VPHA 2EJUA 4H1HA 4IRMA 1BSVA 3OCZA 1XHBA 1BWRA 4TKVB 2A67A 4ARVA 4WKCA 2ZJ3A 4JYCA 2B82A 1HV8A 4IIVA 5JYDA 2DEUA 3FMFA 3K53A 2CNWD 2C3MA 3ZTTA 3PX3A 5BOSB 1JDSA 4RKFA 2G80A 3OM0A 2BHRA 2IYQA 2PS9A 2Q27A 4D8TA 4S1PA 3DFFA 1PK9A 3AXTA 4D4JA 5FYQA 4DJ5X 2AFHA 4AZFA 2CE2X 1XQVA 1H6BA 3I6BA 2N46A 1IXSA 2E4XA 4HYTA 3CX8A 3C1AA 2NUAB 2C7QA 4V24A 3VNUA 2WIAA 5KBYA 5ALOA 4RMNA 5LZ8A 2HL7A 1T4DA 4CKCB 2AJ8A 2CHUA 4MUAA 4C76A 1T6ZA 3CX6A 4KUEA 4Q16A 3E9NA 2JNWA 3FYSA 5A9TA 4J1NA 5CA0A 4U39A 4CM3A 3CNNA 1GAQA 3I9LA 5FADA 1ESCA 4G4SO 1V95A 2K2WA 5DX1A 4AJJA 1AKTA 2QTAA 4D9NA 1OFTA 4C0KA 3I2KA 1SD5A 3O9VA 5FUQA 2AD1A 3HL4A 5HUJA 4ZAGA 1TDHA 4MQFA 1HEYA 2Q4OA 5C8XA 5AM4A 5IPFA 4CM9D 3G0GA 3ISJA 5C8VA 1T1GA 2GD0A 1M74A 4PC1A 3ZOKA 3A1DA 1XVUA 2HCBA 2LVPC 1R74A 3L93A 3QE9Y 3K30A 2A0FA 3GGDA 2XZLA 1ZAYA 1FUIA 4YXFA 4FLFA 2XLBA 1V3VA 4RXTA 1V9LA 1H9BA 3GBPA 1V11A 3LP8A 1N9GB 1DC7A 4O4LF 4DCUA 5AVWA 2Z08A 3SZUA 4Q4AB 5B1EA 3H13A 5I01A 4H7EA 3FXAA 2Q2WA 2PGAA 3GO8A 2P0EA 2WC1A 3GRCA 3A45A 1AT1A 1E6KA 2LIVA 1R8YA 3KKKA 2P2LA 1I1QB 5FHQA 1PTJA 4QPNA 4YBRA 1VBMA 1Q84A 3ITKA 1GEEA 4CQMB 2FOXA 3ESBA 2I1VB 4KR6A 1FLVA 4WGGA 1F9AA 1ENZA 3H17A 3IQGX 3AZOA 3JATB 4HQLA 4NCIA 4UNQA 2C7RA 3THWA 1WAMA 3FOFC 2H0AA 4CMEA 3HA5A 4V2UA 2Y9MB 4QQ8A 4ZV7A 2VDKB 1QK4A 4PHFA 5CCDA 2PBZA 3DXZA 4XPIB 2VP3A 3R5FA 1RAGA 2OV3A 2HU7A 2VDRB 3AUUA 4R9SA 3B6EA 4XYGA 2BEUA 2Q49A 2HMVA 2V97A 3ACDA 3B5EA 1Q0QA 2UVQA 3QYEA 1TTTA 3ZH2A 2CXSA 3MS2A 2OCYC 2AOUA 3CVVA 2IYWA 2VF5X 3VNQA 1O6CA 1V1RB 1OJLA 2JAXA 5F5LA 2D7DA 3SX0A 4LXQA 1Z26A 2XNCA 3W7VA 3CMCO 2R45A 1QJ4A 3CLTC 3NNNA 4F9GA 1ZGGA 1G7SA 1E1YA 1VHQA 3DBRA 4RLHA 1DADA 1CT9A 1TC2A 5L7TA 2FDCA 1S1CA 5F3RA 1F1BA 3HYRA 2EGHA 4QEDA 1D7OA 4X6XA 4GHWA 2H1FA 1KAOA 2QRQA 4GSYA 3M49A 1FOEB 3H7IA 2OV1A 1EZ1A 4R9RA 1B7GO 2R18A 1EESA 4N7BA 1GG2A 2QVCA 3C3DA 2QNRA 2PUVA 5B37A 4R84A 2XA1A 1N2EA 5L53A 3VYTB 1GKYA 5CVVA 2OCXA 5DM2A 3TLYA 4RIGA 1H6CA 4J6FA 3QU9A 4ZKDA 4XM0A 3CUTA 4JLWA 1A1SA 1W1UA 3O4JA 2A1IA 1F0KA 3SHTA 1T8YA 2VLBA 4X7MA 3MJDA 1XMQM 3GFBA 1HSZA 3PPXA 4Y30A 3VDRA 5HGJA 3CUKA 1GUAA 2CL5A 2CVFA 1P2BA 5BSFA 1V37A 1NV8A 2A9OA 3L0ZA 3JAMA 1CQZA 1NVKA 4JR2A 1OHHD 4WZBA 2AFHB 1IEWA 1KC3A 2CZCA 3L4EA 5DIZA 1U9ZA 1GQQA 3FYHA 1IXSB 1K86A 2H2GA 2DWNA 1DUVG 4TSFA 5ALMA 3LT5A 3PLNA 1Y6JA 1AKUA 2DZOB 3I9KA 1J5PA 4DR3B 2FPMA 3ET4A 4C4OA 4WUTA 4US1R 2YY7A 4YVFA 2QX8A 5CA0B 2PX8A 4X66M 3J80A 4LJ9A 1KBZA 5J23A 2AJLI 1RJGA 3HCOA 4AMGA 3E8MA 3QHQA 2RHJA 2ZJAA 1JVNA 2JGIA 4YCAA 4KQHA 2YWXA 4D3SA 4LK3A 3PZRA 2R5FA 4NX2A 4MQFB 2ZVJA 2BFNA 4GNKA 4Y2XA 2WFLA 1AKWA 2OHXA 2LV8A 3DDSA 4KXLA 1QPZA 2EOAA 4P82A 2ZFUA 2H9YA 5K0EA 1WR8A 3B1KA 3AYZB 4LNHA 4HBGA 1QYRA 3A8TA 4KFCA 4HG2A 3MJVA 2OCIA 3NMUF 3GGSA 1VKJA 1V11B 3LYAA 4TYYA 5CYPA 4EQZA 3FHJA 1P6QA 1NRJB 3QM1A 2O5CA 2ONCA 5EJEA 2FZVA 2JGRA 4PWZA 3P9KA 3WZMA 1RHQA 4ZOBA 2AN5A 4EHNA 2XMBA 2SECE 3EWIA 3MOSA 1YB6A 4INAA 3Q6MA 2GEJA 2HPAA 1WOMA 5A6SA 2AEMA 2YN4A 3FH0A 2YS6A 4JD5A 1MHTA 3ZDQA 4BX3A 2FPLA 3MHTA 2BR5A 4LBWA 4G09A 1DGGA 1ZMOA 5ES4B 1AV7A 4Z0PA 1TJNA 3THWB 3HN2A 3W78A 2PMWB 4YJFA 3WLSA 1J0XO 1KSJA 2IC5A 4UXHA 3DW3X 5LXTA 4EFLA 1ZN9A 2I7XA 1L5FA 1G55A 2P1ZA 3ELBA 1RP1A 4E2YA 2DWOA 2VJBA 1PJ2A 3HY5A 1PR5A 3I6YA 5JMOA 1DUSA 1G8PA 16PKA 2YOFA 4JLPA 2POCA 4N41A 4M4SA 2O3JA 2JB9A 3TTUA 3IPAA 3MD0A 4JP2A 4NAUA 4OSOA 2BEUB 1CJSA 1ESMA 4P36A 4TQAA 3GEBA 4R2HA 3JXEA 4EB8A 5EXSA 1FUKA 2WYUA 2R3SA 4MIKA 4M1EA 2J45A 4ZVVA 2JC3A 3H42B 3KLOA 1VJGA 3E58A 3EBLA 3CPEA 3RROA 4GPTA 1JFTA 1SXGA 4CDGA 5T4EA 4FX5A 3ODPA 1X80A 5DHQA 1J5EM 3IV7A 3M33A 1W88A 3H2JA 5AVSA 3WC4A 4N7MA 1XZ8A 2XDYA 3C7CB 4LN1A 4XFDA 2QRNA 3KVYA 2W6IA 2GN2A 4F45A 2D2EA 3LT4A 3DBRB 3GL9A 4ZK2A 2ENUA 3MGGA 2ISSD 2W2LD 1Z83A 2QGNA 2PZ8A 3CKKA 4POAA 3EZFA 2GUGA 2PGLA 2DAEA 3HU1A 4FYMA 1EA5A 3X1JA 3G2LA 3U6OA 3HB0A 3QMWA 4EVRA 1TU3A 3B9PA 1R9JA 4UN2B 4YCJA 1U3CA 5ILQA 2KRUA 4GICA 5T41A 4H60A 1Z7WA 2J6BA 3UN1A 2UYYA 1CBUA 4W7SA 4H08A 3VFDA 1QHNA 4IILA 5I7RA 5CDGA 5B5SA 2G9ZA 3IJEB 3HO6A 2HBZA 4YDQA 3S29A 2V8OA 1UC8A 4C2BA 2XF3A 3ZK8A 4G1EB 1U0LA 4ZZ2A 4CGYA 3E15A 3SLGA 4RKWA 4MRPA 4X7BA 4UQOA 3HEMA 2HMTA 4HN2A 5KREA 4FMBB 4CF6A 1DEXA 4FBLA 2QD5A 1U3DA 3AHCA 1QYIA 4RD6A 1ISIA 5JJIA 1DHTA 1L7BA 5HW0A 2WSFF 3AESA 4Z4FA 1V35A 3EEBA 5K9ZA 5GIOE 3LY9A 1R5BA 4PG4A 4BN5A 4BUZA 2HXGA 5C5DA 3BHIA 3TPZA 1D6NA 5CVTA 1ONOA 2V1CA 3TSAA 3HBMA 1YHYA 4TYWA 1I3MA 1JG6A 3NGXA 4CR6A 4DA0A 5E7JA 4RQBA 3OZFA 2OBBA 3ZXSA 1TTEA 2ACVA 2CZGA 4CM8A 4NXMB 4RX1A 4RY9A 3H04A 3STWA 1KTIA 3ZQUA 2QM7A 4DIOA 4OHMA 4NAHA 1BTOA 5IUNC 4AJKA 2WFLB 2I9PA 4IXNA 1CU1A 2PRIA 2B36A 3KTAA 5CYFA 2EW8A 2H0QA 2F5QA 2JNHA 3F90A 2AC4A 1NBHA 3CXRA 1KA9H 3E1GA 2WIJA 2SHKA 5ALZA 1YO6A 5CLIA 2YVAA 4DHEA 5MN6A 3HJTA 3WHIA 2KNZA 3A6LA 3ID6C 3HDVA 4GX2A 5FA8A 1QRUA 4IEEA 3E7DA 5EE3A 4K6FA 4QFBA 2VEOA 5AI6A 3T7EA 3PITA 2IVFA 4C7VA 5A6SB 4QUAA 3NWBA 1MX0A 2GETA 3COJA 2A0WA 3RT7A 3PHJA 1DAKA 1CZOA 4XEHA 2XE7A 5KKNB 3FNHA 2HK6A 2A0XA 1RRVA 5BMVF 1T9HA 3CO5A 1VL8A 3IUMA 4HGZA 4CQLA 4YJFB 3VR6H 3OKAA 3VV2A 4V0LA 5LXTB 2ZAGA 5DX0A 3SJUA 4J90A 5CVUA 4RHEA 3GD7A 3L02A 4AZWA 1L1FA 5TEWA 2RH9B 1L5KA 2C29D 1MDFA 2YQ5A 4EK9A 4IHJF 5F7JA 2FHPA 1E3JA 5I5EA 3OZIA 4CIXA 3PDIA 4LIPD 3RADC 8ABPA 2ZCJA 3DBHA 5HCNA 2R2GA 1RLUA 3AR9A 2C5RA 3DEHA 1UDXA 2EBUA 3L8GA 3IPLA 3DULA 4P0QB 4JFAA 3GXBA 2XE6A 2HREA 2LR0A 1WZEA 4FMPA 1EE9A 2G1KA 2WRZA 4MQ6A 4NL4H 1UPBA 1N57A 4ESVA 7ADHA 3LA8A 1X80B 3ON5A 1Y8QA 2GYUA 1W88B 3KE9A 2AV6A 1E1CA 1JA9A 4H7KA 2RH5A 2VQFB 1VRWA 4CHTA 4C05A 3DP7A 5BWCA 2Q6LA 1QAMA 4BO4A 4UEJA 4UC0A 4PPFA 1CUSA 2GILA 2XPCA 2DPYA 4JMLA 2WTEA 2W90A 3GB9A 3OX4A 1YR9A 2QRGA 2NV0A 1KNQA 1YE3A 4OHCA 5CNKA 3N8IA 2BFAA 4MPDA 4JH0A 3G02A 2V54A 5HQ3A 4MV5A 1XDGA 4AY4A 3UMMA 5EJFA 3EVDA 1AK9A 1BEUB 4I9NA 1ZL0A 4LPKA 2H3EA 4FYVA 4CTJA 2VUHB 3IAS6 3BIFA 1QIEA 4D9HA 4K6HA 3K92A 3QLTA 3DXXA 2NWQA 5H70A 2C9MA 2OMEA 3K8OE 2QT9A 2HJSA 2LZ0A 5FEMA 1IL0A 2KHHA 2A84A 2NIPA 2PWBA 3C85A 2J3HA 4CGYB 5KX5F 4M2LA 3TJZA 1UPXA 4NDZA 2FEKA 4JB3A 3NLLA 4JWTA 3ENNA 2UVDA 2C9BA 3WFIA 3W8EA 1XC7A 3PFBA 1ZNYA 1RLTA 2VHVA 3ET5A 3NAQA 3KZCA 5FWAA 3AESB 5J58A 2ZBGA 4ER6A 3DZHA 2IIPA 4EMTA 2VT7A 3WXMA 3B1XA 4JLJA 5ITTA 2E37A 3ZV5A 2AWOA 2WIKA 3Q0EA 1XPJA 5LQSA 5BOVA 2K87A 1BQ3A 4ZZ1A 2WNIA 4DNFA 1K6IA 5CHEA 3IQFA 4MVJH 4CM8B 5J4VA 1JB0F 3R6GA 2WU8A 2PMFA 5GV7A 5DT2A 3H2GA 2ZBEA 2QR5A 2AFVA 2GM5A 3E3OA 1QPBA 5CT6A 1HDOA 3HYCA 3OX2A 4CMCA 1CEEA 1GT6A 4JNKA 5KQLA 1KDOA 4IXWA 2X0NA 3KTAB 4OQ4A 1DJPA 3TOZA 5FYDA 3QFFA 4ZAZA 4NMXB 1R6XA 2YJ6A 2ODTX 4B2LA 1WPRA 4HXFB 1OZFA 3DHNA 3QXXA 4D9IA 3TBFA 4TWAA 2NT3A 3I30X 3Q9NA 3H6HA 1T8TA 2PY6A 3F3SA 3MFQA 5KWEA 1U8ZA 1FF9A 3LLVA 1M7BA 5M2QA 5DCYA 3K0BA 1G1AA 3BJIC 3GEPA 3PC6A 4DLTA 4MO2A 2PD6A 2WYHA 1HR0M 1YIOA 5EIHA 3IBTA 4N0EA 4YMUA 3V55A 3SMPA 1TOAA 1GFIA 4HLDA 4UD6A 5DOZA 4ALMA 3A31A 3CF6R 5IJ9A 4GX1A 5ADVA 4IOKA 1HG0A 4AJOA 4AXBA 1Z7BA 3LXRA 1O58A 4WUVA 3NBZC 4CQLB 5CD9A 3M3DA 2WE7A 1G5IA 1EJ2A 2DP4E 3A27A 1EUZA 4GO1A 1W4CA 1EI9A 4HAIA 4JR0A 3NT5A 1TM3E 3AR6A 1UF9A 3I2IA 1D4ZA 2VDPB 5ALIA 5HNKA 3VLFB 3F7NA 2QNJA 5F77A 3S1LA 5TRTA 3H7AA 3GLHA 1DB3A 3MNFA 3VOTA 4LVUA 1IY9A 1KYVA 1CUZA 1E2PA 3ZWCA 4WESA 3PDIB 3GCWA 3NKFA 5DLYA 2P0YA 2C9ZA 3IFSA 1MO3A 3WBJA 4G5HA 4RF1A 3KKNA 2PSEA 2P3QA 2P6PA 2GEDA 1Y8QB 1BMFA 4OIMA 2BVNA 4GWKA 1ZGAA 1E1CB 1TYZA 2WD8A 1CE8A 3MRTA 3GLKA 5LA6A 4CHTB 1NY6A 3ROPA 4IBKA 2QZSA 4N47A 1UMDB 2YWRA 1PLJA 3EVGA 1PL8A 2QSUA 1BS2A 1VLQA 2BMEA 4OI0A 1YAJA 4Y6GB 2B5OA 2YXNA 2VT3A 4Z4GA 1I7SB 5HQ3B 4D9EA 2ZBKB 2QN7A 4M0EA 1K7SN 1TH4A 4L8YA 1W0KA 2DY0A 3W5UA 1LSUA 2O6LA 4ZO6A 5DFAA 2P6UA 1K7YA 2EJCA 3H9EO 5FOTA 3M6LA 3NYWA 1LDEA 3V4LA 1HNZM 1NFQA 3PJDA 4QC2A 2MCFA 3GP1A 1TW3A 1RZ3A 3EDCA 4ER5A 3KTOA 1BFDA 3UMFA 5K0TA 3GNLA 1R0SA 3HZOA 4LF5M 4L73A 4K86A 1S3GA 3NHWA 3GDFA 2YV3A 3OIVA 4OH1A 1VSQA 3NBIA 5JECA 1J2RA 3F8WA 5B1HA 5EUBA 1XP5A 3S81A 4CEJA 3PXDA 1W87A 3MIZA 2OV2A 1G16A 2WMDA 2PBRA 4R41A 5ALRA 4LHVA 3GRZA 3VKVA 2C4VA 4N5DA 2PUAA 4DXDA 2OZPA 2GCNA 3QTBA 1YDWA 2M32A 4FD2A 3WAKA 2IE0A 4PBSA 4AS2A 2QUAA 2ZJFA 1IVSA 3RNLA 1ATIA 3C3PA 5FQNA 5HJ7A 2JBWA 1Q21A 4DQ0A 2HK8A 3CX4A 1P0CA 4WOKA 1JHRA 1RWOA 1JQBA 4FYXA 1JU9A 4NBSA 1OXXK 3Q9UA 3TZKA 3JQCA 2O4UX 5ENVA 5KPRA 5F2EA 1GGHA 1LNSA 1WZUA 1T2EA 1I6MA 2OYCA 3NFRA 1DAHA 3K5HA 4AROA 2O9JA 4Q9DA 1T15A 2VDJA 1SHUX 3BCSA 3FPEA 4F71A 4LJYA 3P2EA 4RUKA 3P5SA 5CLQA 4GPD1 4QNRA 3H8WA 5GVRA 1TVMA 1B23P 3QUCA 4GKJB 4EB0A 4CV0A 2RGYA 1P0IA 4CEIA 1C8VB 3I0NA 4WBSA 4DR1B 1NHWC 2JHAA 4OM7A 1E3WA 4F85A 4PGAA 4IP0A 4R7TA 1VLZA 3WO0A 3OAAA 1Y0BA 1Q1QA 1LPOA 1HE2A 4FWDA 2EWMA 2PZAA 4M0MA 4QLAA 1ZNXA 2KJQA 3BXGA 2YCLA 1AMOA 3TXAA 5IJ9B 2HJWA 3WL7A 4XYEA 2QR3A 4C4PA 1GDTA 3E46A 4GC9A 3OLVA 3Q8KA 3RYIA 3SKYA 1ZZGA 5FBZA 1IN7A 3HGMA 2OORC 3KT8A 3MZ0A 1GGFA 3IIJA 4NV3A 5C32A 5LMNB 2WU1A 3CWCA 1PWEA 1FJXA 3P9XA 4EKNB 1EK1A 4CT0A 2HWXA 2YHUA 2EQAA 3S1AA 4IL5A 1NNJA 4OI1A 1XTKA 3EMBA 3GLHB 2HPZA 2FMTA 5GJCA 4LY9A 4NH0A 1ZA1A 3QNUA 1X86B 4Y9SA 1GFWA 2VJMA 2PGXA 5FBHA 2KX7A 2G82A 3IO3A 4PPNA 2PZBA 3VPFA 4LE0A 4WESB 4FKBA 5GPBA 2W2KA 1GNSA 4U63A 5HOEA 1Z34A 4PYKA 1NXXA 1N0IA 4EUFA 5J43A 1TB4A 1PUIA 2OMKA 4NABA 5CCBA 4WY2A 2NZ8A 3LDUA 1O95C 4FFNA 4GMQA 4W9NC 2W48A 3GJRA 3LV8A 1HFKA 1GTVA 2LPMA 5HUQA 1CE8B 5ESWA 3PYMA 5LA6B 2A86A 1EFKA 3DS8A 3R8FA 3H97A 4BMZA 3RSQA 1FSZA 1DKUA 3RUAA 4TUYF 4B3SM 1K8YB 5KIAA 1AKNA 3WR5A 1ZRSA 2G3YA 5FH9A 4QVIA 2ACEA 3HYSA 4MYTA 4PIPA 1KHHA 1GITA 2FW0A 4B1FA 3W2TA 4LRTA 2B34A 1GYRA 1WG8A 2UVPA 5IWAB 4MW4A 4RTKA 3BXFA 1QLJA 4K9LA 5IVPA 4RTSA 5FD8A 2RGNC 1OC4A 3C3YA 4G4GA 4RTOA 1HM5A 4CWAA 4JI6M 1YOVA 2XFTA 1J2JA 1A5AB 1WPQA 2OEPA 4PYQA 1FX1A 2GBCA 5C8YA 2QMHA 1CUDA 2AQKA 2DWZB 3H4VA 4D3XA 1T4CA 4DY4A 4YT2A 1B4DA 5CLFA 4U02A 1LD3A 3VTAA 4CEJB 1EUCA 2PUCA 1NXSA 3B1JA 4C22A 2QROA 3ITDA 4LY6A 4GMKA 3KS8A 2VHZA 4M54A 2FQYA 3CTDA 1T1RA 1SEVA 4MKFA 1DBIA 1CLEA 3FAKA 3WFZA 2PKQO 4MINA 1GEGA 3RUDA 2YNMD 1CC1S 3AY7A 2ZQZA 1F12A 1P5JA 1CCWA 2VDLB 2F3UA 7GPBA 2ZRQA 2J5KA 1SA0A 1DAFA 1L6IA 3INNA 2C2KA 4HUTA 4JLMA 4PBRA 1LBHA 2PL1A 3P0IA 5TARA 2GN6A 3FROA 4X8OA 1YVPA 5TGTA 5JCOC 721PA 4GLLA 1OC2A 2IOFK 2NVOA 3SICE 3CF4A 5JI3E 2KBFA 3HB5X 2LWXA 5K8CA 1Q95A 1E60A 5EZYA 4YRSA 2YZ2A 1A5ZA 1G63A 4BFWA 1N2CA 1Y6FA 4JJGA 1PEAA 4IDNA 3A98B 2BHSA 4BCCA 3DOJA 1YGPA 1QHSA 1R0BA 3PFKA 4ETWA 2Y0BA 1WUKS 4AIRA 2ZJ4A 5CA1A 1UJCA 3KVWA 3O31A 1N1DA 3A58B 3RYCA 1V2HE 4LYGA 5LMZA 2FWNA 1E3WB 4GL2A 5JCXA 3R9XB 3T1NA 1AA9A 1ODSA 3W0LB 2Y1FA 2IYEA 4KAFA 5BUSA 1X1QA 2VUSA 5GZ6A 1P39A 4QLBA 3ESAA 1LQTA 4G84A 1T8RA 2TMGA 4DBVO 4KKVA 2YJ5A 3OQPA 2HF8A 2WZBA 1RRMA 4P3YA 2FH5B 4TL7A 5DYGA 2XOKA 4PINA 1YA4A 4O2AF 4UTPA 1L8LA 1LSJA 3T3OA 3QW4B 2QDKA 4A82A 3ST7A 2JFOA 1BMDA 4PHCA 1H42A 3V2UA 4D02A 4HTAA 3MYRA 5ALTA 2YR0A 4HN9A 2AKAB 4Q66C 4YV0A 2EDAA 2NTNA 3RVJA 1LDBA 2XMSA 1YRYE 3HUTA 1VMIA 3ESYA 4DG5A 1OBOA 3DOCA 2NQ2C 3SYMA 1GTMA 4IJQA 4LV5B 1JWLA 2VJMB 3I12A 3MLBA 4N9WA 3CLSD 4DBLC 3PT5A 1DU4A 1U2RA 3OEED 2W2KB 4A8JB 2BN4A 1NGSA 1WJ7A 1TECE 3D02A 3LSTA 3OHMA 1SOMA 4YECA 4DZRA 2GAJA 3AB8A 3UHPA 2FCRA 4F86A 3RUIA 1BN6A 4GGMX 2V7QA 1XNRM 3JRXA 3C7AA 3J7BA 2A5LA 4HDCA 3EX7C 3NDPA 4EYKA 3KSRA 3LWDA 3WLAA 3D6TB 3L7BA 1UUFA 4HRXA 4CL2A 4TQGA 5AW2A 5KVSA 4XIYA 2DGDA 4RE5A 3NBKA 3NDIA 2UZIR 1BRTA 1Z08A 1C7RA 1LJUA 3CLHA 4YCLA 1I0ZA 4F3CA 2QAGC 4NARA 2EKQA 3CF4G 4KBYA 3TZLA 1MNAA 1K3WA 2XTNA 3PICA 1V48A 4ZVLA 1GAJA 4ERXA 5K05A 2EP8A 5PNTA 3GFGA 4LRTB 4DV3B 4I1PA 1R9MA 4AB1A 2UVPB 2LWIA 3L8ZA 5BOSA 2JIBA 4IBCA 4YMWA 1G6OA 3QG1A 2CXXA 1M2OA 4S1VA 3GV0A 5HQTA 3U39A 1YOVB 2WJ6A 5ADHA 2QD3A 4XJSA 2IOYA 4WK6A 4OHWA 3U6MA 2EHDA 2VVTA 3UPDA 2L17A 5K6TA 1XCOA 1WB6A 5C8YB 1H0SA 3VZRA 3BB4A 1T4CB 2G1JA 2DNAA 4QOIA 5JAQA 2ENWA 1PWZA 4QJBA 2WJWA 1RWMA 1EUCB 4IDCA 1U2SA 1K97A 5C7YA 1ESDA 5ESXA 5B7GA 1A2OA 1YR1A 3PCRB 4LY0A 2QLBA 3LLUA 1QIHA 2FP3A 5JWOA 4L15A 4HFMA 3UAWA 4DEVA 1T4MA 1W59A 5FQOA 1Q39A 5JPDA 5D6NA 3VOBA 2EZTA 2XQFA 1C3OB 4ARCA 3SIWA 5H9WA 1XTPA 4D9JA 2C4HA 4D9CA 1N3YA 1FVOA 5LNK6 1SA0B 2GNAA 5AVUA 1GKKA 1NQTA 5IZ7D 3KXPA 1SG6A 3M0EA 2YJ4A 5EJGA 3PJRA 1ZJWA 3HGTA 1TEHA 1SUFA 3KZ1E 1LFDB 5K8VA 4PQEA 4HR7A 4P54A 4QOEA 3D9QX 2BFPA 1FTSA 3VSCA 5EZYB 3FHOA 2YXPX 1N2CB 4KOEC 1RZUA 3K1AA 1DQNA 2JDID 4E2FA 5F7OA 1C8KA 2HMAA 2PKYX 3OEHA 3FLAA 5CCEA 2RFLA 1KJQA 1JIXA 3VMFA 3RYCB 4X41A 5SY9A 2C3YA 3I5UA 1E66A 4NY1A 1OTXA 1CY7A 1I2CA 5D7NA 1U6KA 4CQMA 3IVGA 4KDEA 5G1PA 2JIZA 2XUAA 4Q1FA 2YHSA 3EOZA 4U5XA 4JP3A 1HRDA 4HZGA 1P2FA 5HF8A 3O75A 4E14A 4XIGS 1B43A 1MOSA 3SFZA 3SHOA 1Q57A 1RJFA 5FULA 4PYJA 2W6OA 3OP4A 3ZW7A 1ADBA 1QU3A 1ORDA 4X8HA 1XKQA 2JVKA 1F6BA 1F20A 2R79A 4B6FA 4XPIA 4X3PA 1VE1A 2FHSA 2XWJI 2MYPA 5K99A 1Z36A 3U6PA 2FQXA 5F4BA 2E85A 1OVGA 1L3BA 5EGSA 3I28A 3NEPX 3MIIA 2PLFA 1MORA 4A1FA 1JQKA 4ND1A 4LK2A 2XGSA 2ZSIA 2OLJA 1W5BA 2ID4A 1A95A 3H1TA 3UMGA 5ENDA 1N7IA 3RHSA 4Q3BA 1OJ7A 4FGJA 4H3HB 1V1RA 3VUFA 4CKYA 4GAEA 5JLAA 2VTVA 4ECAA 3EMKA 3A6HA 2J08A 3F47A 3TLMA 2C2ZA 5I9BA 2J5QA 2B2NA 1L8AA 4DLNA 2IUTA 2NUTA 4P86A 3E48A 3NCHA 5CAEA 2W2NA 2PX0A 2RCNA 4LRQA 3NAGA 3IKVA 4II3A 4X24A 3V6MA 1A98A 3OX3A 2NQTA 2PU7A 3KWJA 1VL5A 4OMUA 4QOGA 4U00A 3O2JA 4HD8A 1HFJA 2C83A 4F4HA 5TQ0A 4K6GA 5C7IO 1YZGA 3FCOA 4JL8A 5ITRA 3OOWA 1Z47A 3P9PA 2BONA 4P4GA 1NMXA 4BLVA 3PSAA 3LUKA 1K63A 4ZANA 3DMYA 3BX1A 4FSXA 3T41A 5HFNA 3I3OA 3W5HA 3MERA 2YASA 4DA8A 3IH5A 4MRAA 1ODKA 2VK2A 2WIFA 4RYDA 4BFVA 5ALUA 4DBZA 1N2ZA 3BB3A 3FE2A 1B41A 1M2OB 4ZZ3A 3EGEA 3A04A 4UFPA 1AKYA 4AJ2A 1CETA 4B3CA 2ANBA 2IODA 4GL4A 1E1QD 1X9GA 4ZJPA 4ZEMA 3Q1KA 2WWHA 3L7IA 1YU6A 1VE7A 4YAEA 4URFA 1CULC 1IUNA 2I55A 2WTUA 5A03A 2IEBA 4AJ1A 4NXNB 3W6OA 3ZK9A 2DFVA 3AR7A 3L7KA 4PY2A 4TZKA 4UTRA 2ZRBA 4RVDA 2YVKA 5EE9A 1AU9A 2UYGA 4G8BA 1PNRA 2UAGA 3LQFA 3UY4A 1QQBA 1USGA 1JDTA 4Z2AA 3C43A 3SS8A 3WMGA 4XRRA 3KSDO 3E03A 3V46A 4ZICA 1NV9A 4ZCLA 4NYMQ 4R16A 5EXDA 4GRIA 1GL9B 4XUCA 2H4FA 3MWFA 1F7UA 3DQPA 3RT1A 5H83A 3UXMA 3DMFA 3ZQJA 2EX1A 3QLJA 5EEHA 3UK2A 4X62M 1OXSC 5CBPA 5FOSA 2VP9A 2P9FA 3CX3A 5FBQB 2I78A 1WUHS 1E79A 2C4KA 2IXEA 3IVRA 1WEHA 3K0EA 4QODA 4AURA 1M54A 5LP1A 1ZSVA 2AC7A 4LZPA 4U7WA 5E0KB 1FTWA 1T4BA 3HWX1 3EEIA 4FWGA 1MV5A 2G88A 3CC8A 4G5QA 1W76A 4OXIA 1RAAA 1KO8A 2PH3A 3QIAA 3K1AB 3QTLA 5FWNA 2X13A 3KR0A 1ZK0A 1OQYA 4QDJA 4WPGA 3EVZA 1G6Q1 4FDUA 1DFGA 3QOXA 3JCZA 2XE4A 5JALA 3G8AA 3AF3A 3Q2KA 3O83A 1TZKA 4FDAA 1LXCA 4FTWA 2M6LA 1DDOA 3OOSA 2HDOA 1YONA 3C5CA 4URVR 4HL6A 1OH8A 4XASA 3RTGA 2P27A 5EERA 3F0TA 5AH0A 2GEVA 4KE6A 2I4RA 1UKEA 4FINA 2ZJ0A 3BMQB 1S2OA 4IS2A 3GWZA 3R0QA 3AV3A 3R7NA 3VUEA 2XZTA 3H5AA 1M6YA 1OXKB 3ZDCA 4EMSA 1OAKA