1SXJB

Crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
316
structure length
316
Chain Sequence
LQLPWVEKYRPQVLSDIVGNKETIDRLQQIAKDGNMPHMIISGMPGIGKTTSVHCLAHELLGRSYADGVLELNASDDRGIDVVRNQIKHFAQKKLHLPPGKHKIVILDEADSMTAGAQQALRRTMELYSNSTRFAFACNQSNKIIEPLQSQCAILRYSKLSDEDVLKRLLQIIKLEDVKYTNDGLEAIIFTAEGDMRQAINNLQSTVAGHGLVNADNVFKIVDSPHPLIVKKMLLASNLEDSIQILRTDLWKKGYSSIDIVTTSFRVTKNLAQVKESVRLEMIKEIGLTHMRILEGVGTYLQLASMLAKIHKLNNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a eukaryotic sliding DNA clamp-clamp loader complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
molecule keywords Activator 1 95 kDa subunit
total genus 110
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00004 AAA ATPase family associated with various cellular activities (AAA)
B PF08542 Rep_fac_C Replication factor C C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1sxjB02
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 1sxjB03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1sxjB01
3OF5A 3Q3JB 1DARA 3A4LA 2AN9A 1XTRA 4IW3B 2ZM5A 4TQUS 2O52A 3PUXA 2Z43A 2JAQA 4LV5B 2QROA 3DM9B 3Q85A 3CPEA 4P4TA 2R44A 4YMVA 2WBLC 1DEKA 3L0IB 2D62A 4JJKA 1RW4A 1J8MF 2GWHA 2H92A 2RGAA 3MGCA 4JLJA 4KFTA 5JRZA 3W6NA 3X1YA 2JLUA 1P60A 4G3XA 5J4LA 1KAOA 2EFEB 4IEIA 3AVVA 3EA0A 1BYUA 2VH5R 4MKHA 2VEDA 4B2IA 1YR8A 4TL8A 2GKSA 1XEXA 4LJ9A 1GFIA 1M2OB 4AKHA 3BK7A 1HT1E 4I99A 1Z07A 1LS6A 2WJIA 5FR2A 4TMZA 2OO7A 2Q9AA 4B2LA 2V1UA 4OI0A 4Q4JA 2HUPA 3VHXA 4BLQA 3EZ2A 3KFVA 3U6KA 4PPFA 2XXAB 1CJUC 2AK3A 1UKEA 2YWGA 4I1VA 4B33A 2Q21A 3TMKA 1KKMA 4LBVA 4RVCA 1W47A 1IN6A 3OHMA 3I62A 2BJWA 5C2JB 1X1SA 4N1AA 1G5PA 2RGCA 4JIMA 3GLGA 1G20E 4G1UC 1KDRA 4U5XA 4ZCLA 2KBFA 3OIWA 3SQWA 3QKUA 4WVFA 3ZLJA 3CB4A 1DO0A 1KNQA 3QVUA 2ORVA 1F2UA 1KI6B 2CCKA 4NYJR 5LPNA 3AVYA 2HT6A 2B92A 4MKGA 4E07A 2QL6A 1XMVA 3N2EA 3DKPA 4C2UA 4GOJA 3EC1A 1J99A 4BFWA 4KBFA 2B7CA 1XNJA 1N6KA 3LBHA 1SGWA 1EFHA 4JLOA 4M9ZA 3WMGA 3GEIA 2NZJA 3MFYA 2UZ3A 5FOXA 2RAPA 3WBJA 2I1QA 4K46A 5A0FA 1W5TA 2XXAA 3K0AB 4ITRC 3DEFA 1X8JA 3ZGXA 1NBMA 3D3QA 3AV0B 5JS7A 5CDFA 1FNMA 2RH5A 1FW6A 4KHZA 4BRWA 1FX0B 1D5CA 4Y0AA 4R9UC 3BC1A 4NU0A 3BS4A 3C8UA 3VNVA 1KDPA 1CULC 4AG6A 1MRSA 3QKTA 4DDWA 4NCIA 3AJIB 4FMDF 2O8EB 1LNZA 3RANA 4F93B 1O87A 1XMJA 2DFTA 3FHCB 1P9NA 1Z2AA 2O8BA 2OCYC 2HXSA 2BBTA 3B9QA 3PCRB 2VQSA 1NRJB 2ERYA 4XSGA 4DLSA 4BPBA 2CNWD 2WMOB 3Q7QA 5TARA 2IYWA 1U0HC 4CT4B 3OIUA 2MSDB 2K5UA 121PA 3IEUA 4RKEA 1XDBA 2ZROA 4DLWA 4GFDA 1JECA 1QDEA 1VMAA 3RS5A 1NP6A 5FOWA 3M6AA 4ERNA 2IBMA 2ZAMA 1KK0A 4Q47A 2VP5A 1WF3A 3BJIC 821PA 1TUIA 4B32A 4ESHA 1RYFA 4ZCMA 2O8FB 5FOTA 2C5LA 5FUWA 4NYMR 2WPDA 4L4UA 3H0KA 3FKSA 3AVWA 3K9GA 4A2PA 4GZLA 4FIDA 3KTAB 4MYHA 2FZLA 3CRVA 2OLKA 4EAQA 4JLNA 4EQ6B 3K09C 2R2AA 3I8SA 2VP4A 4HB2A 4MKIA 1KO1A 2D2EA 1U94A 3MUFA 5JSZB 5DO9A 3KKQA 4HB4A 2XNDD 4WXRA 2GBLC 3LQRA 3T5DA 2ZI9A 3GLIA 2ZRIA 3CRRA 2AWOA 3SC3A 1RFLA 2A3RA 2BVNA 1XTKA 4JLBA 3ICEA 2GAAA 4LYAA 4DUGD 1YZGA 4DSNA 2IUUA 2ZVPX 3TBKA 5EZ6B 2WMNB 4B74A 5CIQA 5FPKA 1EWQA 4US0R 3KQNA 1DAHA 3NKVA 4Q4AB 5JWRA 2LCFA 1KOFA 1KSHA 1XJ0A 3LA6A 4LRWA 1FOEB 5FTKA 4OHVA 5GJWC 3UATA 1P61B 1XTQA 2QTFA 4HAYA 4I81A 5SZJA 2IW3A 1JQLB 3GJ5A 1UFQA 2VHQA 3ETLA 2CLDX 3AB3A 4KCGA 4P32A 4ZDKA 2EWVA 5HKKA 2VF7A 3GLFE 3KQUA 1A2KC 1S1MA 2CK3A 1P7CA 2QP4A 1BMFD 3CNOA 4BFVA 1G9XA 3CBQA 5J4HA 1XZQA 1Z0AA 4QBHA 2G0TA 2OUKA 3BFXA 3EW9A 4V03A 1NLYA 4PO9A 1Z0KA 1NSFA 1E69A 1WMSA 4K81B 1ZU4A 1OKKD 2AKYA 3I73A 4DC9A 4MQBA 1W0KD 3FMPB 5HZKA 4Z51A 3KFXA 2FZ4A 2REXB 1P62B 2ZRCA 2ZU0C 3L8YA 1RC8A 1GRRA 2XZLA 5JHGB 4AURA 4AIIA 4JT4A 2V9PA 5DN6D 4KVAA 2P3SA 1WCV1 3O8RA 4RD1A 2ZAOA 2ZEJA 4F92B 1U8YA 2BCJQ 5TMPA 1KK2A 4A0FA 3I72A 4O0MA 4H1UA 2ZYUX 4DSOA 4LBYA 4N3NA 1F3OA 1Z0FA 4Q4HB 4Q7JB 3RS3A 4EPXA 5AK0A 2ZS7A 2O8CB 3BH6A 1G8FA 2R62A 2GVZC 4C4PA 3U2QA 2D4HA 2A5FA 5FOUA 6Q21A 1AN0A 3NBZC 5FPTA 3WNCA 1XTIA 3PUYA 4MUBA 4X8LA 4V0ME 5TV2A 4LPSA 2ZI3A 3B1VA 3BOSA 1JXOA 1NIJA 1UDWA 2YWFA 4C7OA 2IYLD 2VHTA 2VYFA 4M53A 4V02A 1IJFA 2H1LA 1ZNYA 2WTUA 1KI1A 2KBEA 4PZYA 4DCVA 1E9CA 1DOAA 1TU3A 2WWWA 2CNWA 4EPRA 1NN3A 2YHSA 1NIPA 1HQYE 2C78A 1RRGA 2QGZA 5H1YA 1CEEA 2F1HA 1NVVQ 1AS2A 4PHFA 3VKGA 3IPYA 1DAKA 4UXJA 1ONBA 2ZJZA 4IDQA 5BXQC 4Q1CA 3KQHA 4A4DA 1OHHA 4AKIA 2GK6A 5AWFC 4TLDA 3NHBA 2PCJA 2FEOA 3LY5A 4JKIA 5C1BA 1FFHA 2OBNA 1E1RA 4TYQA 2ZANA 1I4LD 3B1XA 4XIGS 3SJAA 2JDID 4RD0A 3O47A 3CPJB 2FFHA 3Q5EA 3B8HA 2XX3A 4YONB 5B64A 2HLDD 1UAAA 4NCKA 5EZ5A 3TLXA 2GZDA 2RHMA 4OI1A 4B47A 3W9YA 1FL9A 3HDTA 3B82A 2QAGA 1IJEA 4G01B 5CJ2A 3X1ZA 1UDXA 3K0SA 4B3BA 3CRQA 2GJAA 3AVQA 4RCZA 4BLSA 2GCOB 1U8AA 3A4NA 4XOIA 3QI2A 4BFTA 3EC2A 4QXAA 1XXHA 3PEWA 3QKRB 3P27A 4XD7A 1N6OA 4YDHB 1D8TA 1U2RA 1KJYA 3GEHA 4Q9JA 3BBPA 2ZQ5A 4BE7B 4DCUA 1RPZA 2BEJA 4I1OA 1Z47A 3I4LA 3FMIA 3SE0A 2YOGA 1JXMA 1TU4A 1E2GA 1UEIA 2QP9X 3U7HB 4B3GA 5TVKA 2MSCB 4Q21A 1VYTA 2DBYA 3KL4A 4P4SB 1T8UA 1U81A 4YXWA 2EWWA 1OV4A 1ZUNB 3JVVA 1E2KA 4TWZA 4PC6A 1IY1A 4LRTA 3W90A 1FP6A 1W4BA 1HY3A 2F6RA 1Q1ZA 1YRAA 4HEJA 3G82C 4Q18A 1MT0A 3OE7A 1NVUQ 4TZ0A 1E98A 2V55B 4LYHA 3WMFA 5L3SB 1F6BA 4CEHA 3GLGE 4GZMA 1OH5A 3ZQJA 1OIXA 3VR2A 1P3JA 4DZZA 5JLJA 2O8BB 1VHLA 3KXLA 5C46F 4GI7A 1JNYA 1TTTA 4QM6A 2ANBA 1XMSA 1T3LA 2WJJA 1NVXQ 4FWGA 4GITA 3EWSA 1XCMA 4LK2A 4GRAA 2G88A 3GLHA 4PAOA 3SBDA 4EDHA 2OESA 4D82A 2JCSA 1HA3A 1KKLA 5JI3E 4G5SA 1OSNA 5KSZA 1ZMXA 2DFKB 3RWMB 1KO4A 4M1YA 1JR6A 4BFXA 4F4JA 1PLKA 1CKEA 3RS2A 4EFMA 3TRFA 1E9FA 3K0AA 3QQ5A 3AKDA 1G8YA 3WP0A 5JSZA 1II8B 4KJZA 2P6RA 1II9A 2OCPA 1O3YA 5DI3A 4Q19A 2HF8A 3VHLB 3E2IA 4KAXA 3WY9A 1GZSA 1T5IA 2IYRA 4C0AC 4PC2A 3QF4B 3PUWA 4ZDJA 4BUJA 4GSYA 1E2MA 3AVPA 3FTQA 4ZIRB 1S3SA 1UADA 1DPFA 3BE4A 4US2R 1ZP6A 2VP6A 1S9HA 2GZHA 3C7KA 4TZ6A 2OXRA 1YKSA 4P3YA 5IHPA 1ZC4A 2QTHA 3NBFA 1P4SA 4IKEA 3BWDD 3I5YA 4RD4A 4QGFA 3H84A 1Z6AA 4C2TA 1K8RA 3QIAA 1V43A 2P5TB 1US8A 3Q8XB 4MGYR 3IDQA 5IDVA 1J8YF 2ZJ2A 2ZRKA 3MWLA 4MITA 3HU3A 4XWAA 4QJ5A 2WKRA 4RCYA 1FUKA 2MSEB 2CK3D 3L8ZA 3QG1A 4C0KA 1DTSA 1M1YE 3T61A 2V1XA 3CIOA 5FUXA 4HAZA 2CL6X 4DLTA 2NQ2C 1CR0A 1YHNA 3CRW1 4IDOA 2W2VA 4OQXA 1JR3E 1JJVA 5FPHA 1YJ5A 4PO1A 5D3QA 4AYXA 4DKXA 1SVWA 3CNNA 4MDEA 4LBWA 1E2FA 2AWNA 4BFUA 2HF9A 3UWOA 1GIAA 5FL7D 2R9GA 2FV8A 4IOMA 2EQBA 1QG2A 5DN6A 3J81k 4OHWA 2Q9BA 1G7SA 3MWJA 1PUIA 1W4RA 3QVVA 3D31A 4LC1A 4LYFA 1VECA 3B5JA 4M9SA 1Q44A 1YZNA 1WXQA 3SQXA 2FX3A 3VR4A 5C4MA 3PEYA 621PA 3GLIE 4A8JA 2J45A 2G1JA 2X19A 2B6HA 2NOAA 3SBEA 5L3SA 4OQMA 1GNQA 5DGXA 4KSBA 1N25A 2IYTA 4CGZA 1Q1QA 1QZXA 2AXNA 2BCGY 3H1TA 2PX0A 2WZQA 1NKSA 4U02A 3RNLA 1N2CE 4D81A 1ZD9A 3HYTA 4R71A 5B57C 5CYOA 1LY1A 2IUSA 3TAUA 1P6XA 3BGWA 4Z1MA 2H18A 1N6IA 2VPPA 4JBYA 1E0JA 3DOEA 4NYIR 3E5HA 3NEJA 1XD2B 3SR0A 5CIWA 2VP2A 3NDPA 1UBFA 3AQ4A 1CRPA 2VSXA 3NIBA 4TLAA 3KUDA 1CBUA 2JJ2D 2IWRA 5KPJA 1GUAA 1MOZA 1N0VC 5EE1A 4LPKA 4HLUA 2J3EA 3VLFB 2P2LA 1W36B 4MYUA 2JIZD 3KQLA 2IA5A 2RHDA 1G3QA 4EPTA 3U5ZB 3T5GA 2JDIA 1N5JA 4HAUA 5FH9A 1NNEA 3U4QA 4RSGA 3U6BA 4GNKA 1NSTA 2V3CC 3QPVA 3REGA 4FMDB 2WWIA 1EFRD 4HUQA 1HURA 2GJKA 1J7KA 2GTPA 2GXQA 4LI0A 3TW4A 3ZD6A 1KI2A 3EPJA 2IHBA 4YQFA 1PV4A 1L2TA 2DZNB 1KI9A 4U00A 2A5GA 3G5UA 1AQYA 4LHZA 5FI1B 4D2IA 4W9MC 3MWYW 4ESVA 3B1ZA 4E22A 2PX3A 4D4LA 2FN4A 3K8YA 3R7WA 2C77A 2J7KA 2Q9CA 2ZRNA 1C4OA 2RGXA 4F4CA 1BKDR 5F9HA 3UMSA 2F1RA 2XB4A 3C14C 3PENA 4YLGA 1XB2A 1CJKC 5FFMA 2C9OA 1VG1A 1U99A 1IQPA 3IIKA 1N0UA 2DWOA 4A2WA 3TUJC 4FCWA 1XFAA 3ASYA 1K5GA 3SZRA 3PIRA 3OEHA 2UVQA 3QNUA 3W5IA 2PZEA 4AI6A 2BHRA 1SVKA 1YU9A 4NCNA 4RZXA 5KDOA 1I4TD 2R6CA 4BLPA 2CL7X 4G5QA 2ZREA 3TQFA 2ZJAA 3S1AA 3SFZA 1CLUA 2E87A 1JEEA 1YR9A 4Z1MD 3BERA 1ANKA 1T8TA 4CF7A 1XCPA 2RMKA 4HZUA 2ZJ5A 1Q22A 2YV5A 4L9WA 3T1VA 2GDJA 4YMUA 4M1WA 4ABYA 4URVR 3SEAA 3PFIA 1D2MA 3IO5A 3AM1A 3OIVA 2O8CA 2ZRPA 4FCVA 2CL0X 4QGAA 2CXXA 5DHAA 2O8DA 2JIZA 1T91A 3LH5A 3PR1A 1W36C 2F43B 1XBTA 1E9AA 3PEUA 4EJSC 2GCOA 2GILA 2IS1A 4Q1DA 3HYRA 1HQCA 3WNBA 1KJWA 5FUVA 2A30A 3IIJA 4DCNA 1NG1A 4HLQB 2GCPA 2H16A 3AGQA 3LRPA 3THWB 1DBSA 1NLZA 1OW3B 2A5DA 3CRMA 4CZ2A 2QA5A 2R9VA 4DEXA 1JALA 1X8KA 4QRHA 1CJTC 5GADl 4M9QA 4C0HA 1SXJD 3BFKA 4RJLA 1Q20A 1VG8A 2OG2A 5J4KA 1QF9A 3REFA 2KRKA 221PA 3ND8A 4Q02A 4URXR 4OK5A 2A7QA 1W7AA 1S8FA 1OT3A 1ZYUA 2X1VA 3B2EA 4PFSA 2FU5C 1Z2CA 4MUAA 1G64A 2BWJA 3TSZA 3LD9A 2DWZB 3ADKA 1M8PA 4LY6A 3U61B 1NI3A 5FOVA 4DDTA 3GD7A 2QU8A 3OEHD 8OHMA 3JVUA 5E7JA 4NHOA 3AEZA 2L0XA 421PA 5JEEA 3E1SA 3AP1A 4BZQA 4WIAA 4J0QA 1HV8A 4MKFA 3FDIA 1PJRA 5IRCD 3DM5A 3QEOA 1AM4D 3GFOA 2AK2A 4ARZB 2I1VB 1DS6A 1LF0A 5JCZA 4PZZA 1OFUX 4Q1AA 2IXEA 3TGPA 2FSFA 1ZW6A 3RYTC 4BLRA 5FBRB 3FPAA 4OHYA 1CXZA 3FFAA 1R6BX 2TMKA 4D0GA 1R0ZA 1GTVA 3FVQA 2F3RA 3THYA 2KSQA 3QPUA 4PSKA 5B30A 4M8NE 2HYIC 4NYJQ 2FH5B 3LXRA 1IONA 4MGKR 3QF7A 3AVTA 3KJIA 3BFVA 1F60A 2FOLA 4MA4A 2ORIA 4B3XA 2QP3A 1A7JA 4HZUB 3RRMA 3QUSA 3QG5A 4IFBA 2VP9A 3BD9A 1W46A 4V0LA 2J7PD 1XMIA 1SQ5A 2JASA 4UNPA 5UKDA 4AY2A 1Z6YA 3VR6A 4C0LA 2IX3A 2IYVA 1WQ1R 3PITA 5FR1A 3I32A 1NJFA 1VDZA 1M7GA 2G6BA 3IILA 3EG5A 1VYUA 4TLEA 5EXSA 1NY5A 4OI2A 1YR6A 2BKEA 5EUMA 1X8LA 5CK4A 4ZV4A 1DVRA 3CWQA 3RS7A 5BYJA 3DMDA 3GJXC 3QXHA 2QE7D 1GVNB 3B78A 3MAAC 5B2ZA 4OBEA 1GL7A 2ZITA 2BMFA 2GAOA 4OI4A 3EIHA 1Z0DA 3R7WB 4B35A 1E0AA 1U9IC 2KJQA 4M4SA 1Z6TA 4NE2A 5J47A 1NVWQ 1N6NA 3AKCA 5AJWA 5DSZA 1P2UA 3QF4A 1ZJ6A 4IDHA 4Q7KA 4TSFD 2BOVA 5K8LA 4KXFB 4B43A 1QHSA 2IT1A 2GJ9A 2WJHA 2BBSA 2IF2A 2CMKA 3GMTA 4PQFA 1R5OA 3UXMA 4MYCA 4XWKA 2JLYA 1AS3A 1KK3A 3S1AB 3A36A 4R2HA 2HCBA 4B75A 2J59A 3VAAA 2NIPA 1JPNA 2N1BA 2PZFA 3VTKA 4IEEA 1OFTA 2ZJOA 1QHHA 3KDSE 1ZBDA 2C2HA 2H5EA 1JR3A 3L82B 2NPIA 4KLNA 1EFUA 3BRWD 1AKYA 2FWRA 5DISB 1XPRA 1IBRA 4ZCIA 4OQNA 1NG9A 1NBMD 1W36D 1FQKA 1VIYA 1TAGA 2FSIA 2VHUA 4ON9A 3GFTA 5A4JA 1A82A 1OE0A 4R7ZA 2YNMA 1CR1A 1ODFA 4BZXA 2KWIA 4TLCA 4H1VA 1VG0B 1WBDA 2VHJA 4IDNA 2IYSA 4LJ7A 1HEIA 3PG5A 2J7PA 1Q21A 3QEJA 3VU9B 5F9FA 5EE9A 2Z4SA 4G5RA 4E5UA 1YZQA 2BM0A 2J9RA 3U7GA 3THWA 5CB6A 2AHOA 4PXAA 4AD8A 4DJTA 2YJTD 4HUTA 3C15C 3AVUA 1H65A 3UG6A 5LBIA 4OQFA 4TL7A 2AKAB 2YZ2A 3U4QB 1N0WA 5KO2A 4FN5A 3AF1A 3Q7PA 4HI0E 5TDHA 5KHOC 4Q9KA 4A8JB 2EFDB 3K0CA 3VU9A 1E2NA 1EGAA 5DH9A 4AK9A 3WYAA 1TNDA 2OM2A 2EFGA 3DOFA 2NPFA 3LBIA 4B6EA 4WOPA 4PHTA 1N6PA 5M04A 2ZRLA 2DY1A 1TX4B 4NKRA 4TMXA 2ZSBA 1MV5A 2VO1A 1E2QA 2QPTA 2R6DA 1M34E 1SKQA 1HTWA 3DKVA 4D0LB 4KITB 1ZIOA 3EARA 4L16A 1XD2A 1WA5A 3ONWA 5DI3B 4GL2A 4FWIB 1T5LA 5AUQA 3CR7A 1IXRC 1KNXA 3FKSD 3VMFA 1Z08A 1QHHB 4TMWA 3W34A 4GMXA 3MG9A 4CT5A 1Z6GA 4AKGA 1IHUA 4N0DA 3RRYA 4DSTA 1XWIA 2F1IA 5FL3A 1OH8A 3PUVA 3H2YA 2ANCA 3ZZUA 3PXGA 3N2IA 3R9XA 1RRPA 3VKWA 1W2HA 3MMPA 3KW6A 3OFNA 1ZNXA 1AZTA 4DT1B 1EX7A 4EFLA 5D3MA 1CIPA 2XNDA 2ZSFA 3BORA 4OL0A 2NZ8A 5J5CA 3AKYA 3CZQA 1NMYA 2WSMA 5L3RA 3X2SA 3WBKA 3CZPA 4Q5IA 3KZ1E 4S2EA 1H8ED 3LNCA 4A6PA 4M1KA 4A0HA 2GRJA 1J70A 521PA 1MABA 4C0BA 1AA9A 2YVUA 2KB0A 4BQSA 2XGJA 1G17A 4A92A 3AUYA 3LVQE 4DIDA 1S96A 1R8SA 1WP9A 1NN1A 2J41A 2QEQA 4JMPA 3CKLA 3TQCA 3M4YA 2V6ZM 3H4MA 1E2LA 1E99A 3CWZA 5DYGA 4CEIA 4FINA 4LHYA 4Q01A 5JS8A 3R8CA 3B6EA 4PZLA 2ORWA 5EE3A 2V8OA 4TMKA 5JMTA 2DCUA 4BWYA 1TEVA 1AZSC 4UNSA 1N5KA 4Q4JB 3RHFA 2BEKA 5KSYA 2IS4A 4HATA 2F7SA 4WBSA 3IHWA 1COWD 5H70A 3T15A 1UBEA 1R8QA 1VHTA 2QBYB 2ASEA 5G40A 1NJGA 1IN5A 2WKPA 2BMJA 3NVAA 2ZS9A 2F9LA 3BXZA 3IQWA 1EK0A 4HAWA 2Z5FA 5KNCA 3AUXA 1R5NA 1E32A 1OH7A 3T06B 2OE2A 1BH2A 4LRSA 2ZR9A 3QY0A 4P31A 1G16A 1WRBA 1E79D 1Z28A 1OXXK 1Q0UA 2O0HA 3HPRA 1S4QA 4M1OA 4QKQA 3WMEA 4ARZA 5JCPA 2QI9C 2GJ8A 2V7QA 2A2ZA 4MDFA 5HE8A 3VQTA 2J87A 4JVSB 4PC7A 4MGZR 2XOKA 4M1MA 1G8GA 1OPXA 4NDZA 4CVNA 2VHCA 4B34A 3U3RA 1KAGA 1W0JA 1Z0IA 2BKUA 4DXAA 2BMEA 1E96A 3RC3A 3SI7A 3R9IA 3GJ6A 5GJVC 2R65A 1D2EA 1G8HA 4XWOA 3TUZC 2RKOA 2ZRAA 4PC3A 2D7DA 1XEXB 4P4SA 3U7FB 2C95A 4A15A 2FGJA 3CUEF 4MRRA 2N46A 2OXCA 3RSOA 1W2GA 1G18A 4UXIA 2YC2C 2F3TA 2EU8A 1S3GA 3QXXA 1P9WA 4XH9B 3RAPR 3GLHB 3Q5DA 4C7OB 1A2BA 4KU4A 4DEYA 3DVLA 4DLUA 1KI7A 3KKOA 2QMUA 3TVDA 1IY2A 1GL6A 1GL9B 4NP6A 1E1QA 3ZVRA 721PA 1G3MA 3AF2A 5FBQB 1UF9A 2AXPA 1KDOA 2LKDA 2GXSA 1Z0JA 4V0NA 4AKEA 2DYKA 2R6GA 3Q72A 1R7RA 4MGIR 2JLQA 2ZR7A 3GJ3A 3O8BA 3L0SA 4RD2A 2QAGB 1ESNA 2VLIA 4TMTA 3FWYA 4RD3A 3GEEA 2OFWA 1U8ZA 3A58B 1ZM3A 2RCNA 2QM7A 4NMMA 1Z8FA 5L8VA 1Q1EA 1OYYA 2P67A 1YZUA 2ZRBA 3FFBA 3E70C 3KJEA 4PSAA 4OQLA 4ZIRA 2OSBA 1MR3F 5C18A 3HP1A 2QMEA 1XU4A 4D80A 1UM8A 2CCJA 1AK2A 1MKYA 1P9RA 1E2JA 4EUNA 1XRJA 4BECA 5KUTA 4I1UA 3I8XA 2V7QD 4W5JA 3UPUA 4GBMA 2OBLA 2RGGA 5A5GA 2HV8A 1DAFA 2KE5A 4V0MA 4XVUA 3K9NA 2WSSA 1M7BA 1AGPA 2QM8A 3TW8B 2D06A 3ADCA 1G6HA 1DAEA 4L8GA 1OB5A 4BEBA 2C03A 5EQTA 1T6NA 3EZ6A 5JFGA 3P1JA 1X1RA 4JVLA 2CLSA 4QM7A 2VL7A 5AUPB 1G5RA 1U0LA 3GJ8A 4JVMA 4FWTA 3TSOA 2V6IA 1X86B 2O8DB 1P2TA 1VIAA 3GLFB 3CX6A 1T0JB 2IEYA 2Q6TA 5FI0B 3WXMA 2IYZA 3CX7A 1RRFA 2BIFA 4HB0A 4A36A 2X2FA 4B3DA 1N6RA 1T0HB 5DYIA 5BYKA 2H8KA 4DHEA 2Z6VA 3U3KA 5CITA 4XJXA 2RGNC 3OEED 4O2RA 3RS0A 2R8RA 3CR8A 4CEHB 4DB4A 1E9EA 4D4MA 4CYMA 4DLVA 3C5CA 2LWIA 3T35A 4NBSA 1GITA 4L5BA 1PLLA 4FWDA 1FUUA 3GJ0A 2XB2A 3X1DA 2FSHA 2ZI5A 1NY6A 3KTAA 4ACBA 3BB3A 4N0EA 1CJVC 2QAGC 3KX2A 5IK2D 1ZNWA 2QQEA 1Q1BA 3A1UA 2YWEA 3THXB 2WAXA 2V6JA 1QHGA 3NBYC 5TB5A 2ZXUA 1V5WA 3SDZA 3LX5A 2DHRA 4OKSA 1DELA 3QXCA 3AF0A 2JATA 3MLEA 5BWMA 5ELXA 2FG5A 3BH7A 2ECKA 2FDCA 2IYXA 3PJRA 3LFUA 2HEIA 4JBWA 4Q4HA 4G0NA 1D2NA 4IVPA 3EPHA 5IF9A 3W5JA 4AG5A 1JJ7A 3X1WA 4F38A 4B73A 3ECCA 1HH4A 3W3ZB 1ESMA 5EP4A 5GJBA 1ZCBA 4JSTA 1GRNA 1W48A 3W8NA 3IO3A 4AWXA 4CEJB 2D74A 3AP2A 3AGPA 5FBLB 4KV9A 1OXVA 3SYLA 1QHIA 1ZU5A 3I61A 2BV3A 2GEVA 2OFOA 1ZINA 2W6JD 3PV0A 3W3AA 4PAMA 4TTRA 2QNRA 3U3JA 1Z06A 5ANRB 3UK6A 3ZS8A 1CU1A 3AVOA 3SFVA 4ZKEA 3TR0A 2FE4A 2AD1A 4O25A 4UXHA 2GHIA 4KO8A 1H8HA 1JBKA 4IJMA 4DCTA 2HDNB 1NLFA 2FFAA 2ZRGA 3IBYA 2OCBA 2PCLA 2XJ9A 3EWAA 1UKZA 4LGMA 3O8DA 4IXMA 1ZM9A 1SKYB 3RRNA 3LDAA 4POAA 3NWJA 3VR3A 1XPOA 4JBXA 1JB1A 2IK8A 5AJXA 4XVQA 5EP2A 1E1RD 3TVTA 4A0GA 3GLHE 3V00A 4EPWA 1R0WA 3KQKA 2FSGA 2WOJA 4Q7MB 4YC7A 2BBOA 5G3YA 4G5GA 1JAHA 3EASA 4Q4LA 2IYYA 5GJCA 1UBGA 3MSXA 1ZNZA 1N5IA 1SVLA 2WIAA 5JJLA 2ATXA 4LHWA 3VR1A 1E2PA 1QRAA 2OV2A 2R6AA 4Z8YA 2XAUA 4GMDA 3KUCA 2BC9A 3L0OA 5EE0A 2FEMA 5JJKA 4L9SA 3KKPA 4QC2A 1ZM7A 2VTKA 5F98A 4KYUA 3KXIA 1EX6A 3PUZA 3K70C 1LTQA 1II0A 1ZUHA 2CVFA 1X3SA 1KSGA 5KU1A 3HR8A 4QHSA 1AQUA 2AR7A 3IPXA 3IQXA 4AYTA 2DB3A 1TF2A 5CM8B 2AFIE 4QGGA 4HDQB 4OK3A 4UKDA 2W0MA 4URYR 1G4AE 4NCHA 1ZCAA 2GXUA 4GT1A 2GBLA 2PLFA 2QT1A 4EQ6A 1W0JD 3H86A 5F2EA 1Z83A 2IHYA 1BS1A 2Z83A 2JGNA 3AF4A 1KY2A 2W6JA 4GOKA 5JHHB 4KSCA 2OFXA 2ZSEA 2JLRA 1FX0A 4YMTA 2ZS8A 3A4MA 4A9AA 2E1RA 4DCSA 1RRCA 2XTMA 4LJ4A 3K70B 2IC5A 4MRSA 5JI2E 1W44A 2QSYA 2W6IA 4U7DA 3K70D 2JLWA 4Y0VA 4JLKA 4PSVA 3QPWA 2ZE6A 1XD8A 4II7A 4B3FX 4RFVA 3WHLA 1KMQA 4C9BA 2ZYVX 5LD2C 1US8B 5KNBA 2ZRMA 4JS0A 2ODBA 1OIWA 1HYQA 3NG1A 5GVSA 1RYHA 4IOJA 1KTVA 2QRZA 4X8HA 1RZ3A 1B0UA 1E9BA 4DLYA 5HTKA 1CTQA 3AF3A 1C1YA 3EX7C 2W0SA 5JBQA 5HCIA 2IXGA 2ODWA 4OHZA 3VR5A 2DFLA 4LJ8A 1C9KA 1YZTA 2P0EA 2NTYC 2F9MA 3AKEA 4IOKA 4JVNA 1UEJA 3WRYC 4DDVA 3HU2A 4QBFA 4GDFA 3GPLA 5D3MB 3FHTA 2C9CA 3OIYA 2ZYTX 2WWFA 4DT1A 2FF7A 5E7MA 3ASZA 1QG4A 3VX4A 2ZI4A 2WWYA 1W1WA 5P21A 2XNSA 1P5ZB 2EFCB 5AJVB 2ZE5A 3C41J 3B13B 4PHHA 2YYZA 2NGRA 1NKTA 2VRWA 4JLPA 1OXUA 1HT2E 4A8JC 1GKUB 2QORA 5JWHA 4LUCA 1PUJA 4AC9A 4IFEA 2GEDA 4A2QA 4W7SA 3WYFA 3RC8A 4RFSA 5DI9A 1GOTA 3FGNA 2OAP1 2XEXA 1BYIA 4LJ6A 4IVQA 1W0KA 1CF4A 1IN7A 1C1KA 2ZE8A 2ZRFA 5HKKD 2GK7A 4HDOB 1RKBA 2NO7A 2ZPTX 1G19A 2W6ID 3QKRA 4LDJA 1EFCA 3QENA 1S2MA 1TF5A 1YZLA 2UKDA 3ZQ6A 2IEZA 3SYNA 2XZOA 1RJ9B 4XVRA 2Z4RA 1S0UA 1OFHA 5H68A 2ZSDA 3SJZA 4OK6A 1OB2A 3A1TA 1E9DA 1W5SA 1Z6XA 3KXKA 2J0UB 3TUIC 1N6HA 2PMDA 4B2PA 4P33A 3FYHA 3KB1A 1J90A 1TEXA 4PX9A 1TQ4A 4F4IA 2X2EA 2IYUA 1EESA 1D9ZA 2FMXA 4FMBB 4HAVA 3EPLA 2OAQ1 1FP7A 3BIFA 3L0PA 4RZ3A 3A8TA 1BO6A 1M74A 5AUNB 2JJ8A 4UJ5A 2ODEA 1HE1C 1KHTA 4Q9LA 4OYHA 1Z29A 4G5OA 3ZZ0A 2FFQA 3LW7A 3TK1A 4MRNA 4URZR 5DE3A 2IXFA 5AR1A 4PPQA 5BN5A 4B76A 3SJBA 4LCBA 2Q3FA 3LXXA 1II8A 3FB4A 3FKQA 3IUYA 3B7GA 4GOXA 1VCMA 4TN1A 4C0SA 3L43A 1IXSB 2ONKA 1DE0A 1GKYA 2P5SA 3JZMA 1OFIA 4A1FA 2VSFA 5JRJA 1MO3A 1X6VA 4HSEA 3LWNA 5KPDA 1U90A 3NTUA 1SVMA 3ZH9B 4PQRA 5AJZA 1LV7A 2F55A 3NC1C 1KYIA 3PVSA 3K0FA 1KI6A 3BAFA 5BN4A 4B3CA 5JEDA 2WV9A 1E94E 2WHXA 1EXMA 2VSOA 4JSYA 2JEOA 2C96A 1GNPA 2ZETA 4QHTA 1MO5A 4Q1EA 3T1TA 2ZIAA 4IHQA 4YMWA 3W8RA 1GAJA 3OFND 3IBGA 1KDTA 4M22A 3WRXC 3B1YA 4DLZA 3SYKA 2MMCA 5E7IA 1IXZA 2UZIR 3QE0A 4TTQA 4UQOA 5HE9A 2JLVA 3MHVC 2NO9A 4BRUA 4GP7A 1E79A 1XEWY 3K0EA 4IOLA 2QW6A 1S1CA 1LF5A 1Q3HA 1DO2A 1SHZA 1FPMA 1XEFA 2EVWX 2CJWB 2LKCA 1UPTA 1KIMA 2O0KA 2ZUCA 3P26A 3FOZA 5CJPA 3GJ7A 4Q00A 5J40A 1GILA 1ZM4A 3LBNA 1AGRA 2WAYA 3N5CA 2J1LA 1SHKA 1KSJA 4E03A 1G4UR 2H17A 4FXPA 1UKVY 4QL3A 2QMHA 3M1IA 4YXWD 1JAIA 2OLJA 2PT5A 1KZ7B 4KFRA 5KNDA 4CDGA 4MYTA 1DG3A 5KDLA 1KY3A 2XSZA 4TLBA 3SS8A 2QZ4A 3LQQA 5CM9C 3THYB 4MRPA 3CF6R 3NHAA 2ZYWX 4H9GA 1U98A 3T34A 5DNYB 2QE7A 4LJYA 1G3RA 1N6LA 1XP8A 2H7VA 1TMKA 5KOYA 1L8QA 1OHHD 1XTSA 4QGHA 2IWHA 1R5BA 4IRUB 4LSGA 3NC0C 1TADA 3NEYA 4HLCA 3QXJA 1VKJA 3P32A 4TYYA 4Q7LA 1G7CA 4R2IA 3GLIB 2GJSA 4TSFA 4CRWB 3U44B 2BDTA 5SZIA 4BEJA 1OKKA 5JECA 5LDDC 4AYWA 1WB9A 2D2FA 1ZIPA 5DIFA 5F3WB 3M0EA 4ZPXA 2QN6A 2Q0HA 4QHYA 3K9LA 3ZVNA 1G291 4LV8B 3F0TA 4M0LA 4NH0A 4Q48A 2OT3B 2A5JA 5GVRA 5LB2A 5KDDA 2DPXA 2VA8A 1L7VC 4URUR 3WP1B 2G3YA 2W2TA 4NONA 5FTNA 2FNAA 2ONJA 3ADBA 1TL7C 2QPAA 1GNRA 4PC1A 2HJGA 2ZJ8A 1NMZA 4JL8A 4DB2A 2XZPA 1EFTA 2XTZA 1FZQA 2QG6A 1OXSC 3TJZA 2QMOA 1TQ2A 2WM9B 1YRBA 3OAAA 3UIEA 1G7TA 3EIEA 1E9SA 3UKDA 5CLLA 1LVGA 5EXXA 2YOHA 4EFNA 1UJ2A 2PEZA 4Q9IA 1K6MA 2QGNA 4RZ2A 4TL6A 4DDUA 1G41A 2G0NA 2WOOA 3W6PA 3MRSA 2V54A 1LB1B 3EZ9A 3ZIAD 1TQDA 4X8MA 4DBLC 3KJHA 1U0JA 2B21A 2OHFA 2XJ4A 3Q9LA 5KSPA 4PO8A 1AJEA 5DLQC 2FGKA 3PQCA 5BW8A 2GNOA 4WW0A 1RE0A 3T1QA 4L15A 3LV8A 3GQBA 4WZ6A 4Q66C 1EWRA 2GXAA 2ATVA 1B23P 1ZD8A 3ND9A 3NXSA 3RLFA 5CLQA 2ZE7A 5SZHB 3UANA 2PLRA 2FA9A 4WXPA 2CBZA 4A82A 4JLVA 4LHXA 2AFHE 5EUQB 1R0XA 2GCNA 5TXGA 3IEVA 2REBA 4RD6A 5HR5A 4WA7A 3F5FA 4TQAA 1ELOA 3ZVLA 4TL9A 3A6PC 5TY0A 2GZAA 2G9NA 1G3UA 3I1FA 2ZI7A 5KTYA 1G21E 1T3HA 2FPKA 3KKNA 1X37A 3R9WA 1TUEA 1E4VA 2OZEA 3A37A 2HLDA 2BBWA 3I92A 4HZIA 4KI0A 4LOAA 4OJKA 3G0HA 1TF7A 1LS1A 4LZZA 1YE8A 2NO1A 1W4CA 1JR3D 2J0VA 1I4DD 2ZUBA 2EYUA 3IHLA 1XXHE 1R4AA 4WZBE 4YDSA 2DZOB 1SXJE 1R2QA 2D7CA 4BLOA 1J2JA 2DWPA 3DPUA 3LLUA 3OZXA 4M9XA 1T3SA 2PL3A 1F2UB 3NBXX 2GESA 2Q3HA 2ZI6A 2SHKA 2YOFA 3O8CA 2E9SA 1E2IA 5BN3A 4PTLA 3SN6A 3AH8A 4MRVA 4NZYA 1QHYA 3A1VA 2KI5A 3CW2A 4TT3A 4HUQB 4NTZA 3ZS9A 1NN0A 4ASUA 4CIDA 1ZAKA 3FMFA 2PJRA 1G3IA 1BIFA 4NPHA 2ZVQX 5HCNA 3V4RA 3LLMA 3F3YA 1DADA 3ZIAA 3CH5A 5JZVA 4I4LA 3P20A 4QJ3A 4PQYA 4BLTA 1D6JA 1MH1A 4EIWA 2J46A 1Y63A 2P6UA 3UMRA 4LHVA 4B48A 5HZHA 4IXNA 2PJZA 5SZKB 1VCOA 1HUQA 1KSFX 1SZPA 5CB8A 3JZAA 4W5WA 1YVDA 5J4VA 3P4YA 2CDNA 2NO6A 2QUZA 1TQ6A 1N3BA 2CHQA 1PZNA 4JLMA 4JL5A 2ZJBA 3ZVMA 1FTSA 4LYJA 4I1SA 2A9KA 2XTNA 3DDCA 4K8OA 3K0CC 3K9HA 2O8FA 1G6OA 2PBRA 2C04A 1Z3IX 5E3HA 2WJVA 3TKLA 1G7RA 3DMNA 5EP1A 3ZD7A 1MO4A 5EE5B 2PT7A 2Y8EA 1OYWA 2Q3MA 1FTNA 1RVDA 1K5DA 4FMCF 4RKFA 4BFSA 4M2LA 1VPLA 1EFRA 1VYVA 4M1SA 5EXTA 3WYGA 2J0UA 4ZO4A 4V0OA 2QAJA 1D9XA 2WIBA 3GJ4A 4Q4AA 3HU1A 2IS6A 4XD7D 3MJRA 2Z0MA 2JJ1D 5CYPA 2B7BA 4DWJA 2OBMA 2ZRJA 5FUYA 5HPYB 4R98A 4Q1BA 1VTKA 4LX0A 3ADDA 1A4RA 2CEAA 1I2DA 2CHGA 4PPNA 1XX6A 1CP2A 3CTDA 4RY2A 4DUGA 3QSYA 1QHXA 1GRQA 1IM2A 3UG7A 4HYYA 2NMVA 1CR2A 1M7HA 2EW1A 3THOA 1P73A 4ZI3A 3K1JA 1NMXA 3CLVA 4D4JA 3QKSA 1CR4A 3P4XA 1KO8A 4C0JA 5FBVB 3MD0A 5CK5A 4ZKDA 2IL1A 3RDPA 4KLZA 5G3ZA 1Z63A 4EPVA 4WAUA 4NYMQ 1KGDA 4XTCS 5K8UA 3GFPA 4XTRA 2NO0A 4FD2A 2MMGA 1L4UA 4PAQA 2IS2A 3ZZTA 1BMFA 3LX8A 4C30A 1KZGB 2FJUA 3SU8A 3V4FA 2VBCA 1E3MA 4QG7A 1NVMA 2I4IA 1E1QD 3N70A 3FMOB 1E9RA 5FBWB 1A1VA 4DLRA 2CVHA 3BGEA 2QENA 2I3BA 4HDCA 1IAQA 4JLDA 2HT1A 3C4JA 2NG1A 3TAHA 1NF3A 3AP3A 3OEEA 4V0KA 3VX3A 3RSLA 1W4AA 3VKHA 1DG1G 2V4ZA 3K09A 4LJAA 1TPZA 4JYBA 3THXA 1ZRHA 4D0NA 2EFHB 1R10A 2OEPA 5LB4A 3DZDA 4LV6A 1E0SA 1SKYE 4BFYA 2VP0A 3TH5A 3B60A 5FL7A 3RRZA 2ODNA 3HJNA 1XPUA 2O8EA 2QY9A 2B8WA 3CH4B 3U7EB 3UMFA 2JJ1A 4F7WA 4JKYA 1XJQA 3W6OA 4NYIQ 2HCJB 2IF0A 2GA8A 4GP6A 2WKQA 2XITA 4URWR 1NL3A 1F2TB 2BJVA 1G8PA 1PLJA 1YQTA 1IY0A 2PEYA 1GDDA 5FPYA 1H8EA 2RGNA 2HYDA 3B85A 2WSSD 2ZUDA 1XTJA 4Q03A 1AS0A 1KO7A 3K53A 2DWQA 3ICQB 3CNLA 1MRNA 3LAWA 1OLOA 4KFSA 5E95A 5FTLA 4LBZA 3RABA 5K8IA 4IDPA 1XJCA 2QRNA 4ILEA 4HB3A 5G53C 2AD5A 4D6PA 1GKIA 2HXYA 4HLUC 4PPGA 5FPSA 5JWOA 1RIFA 3DL0A 3MJHA 3NH9A 5AUOB 3U60B 4CW7A 3EPKA 3EXAA 3GCGA 1KI3A 2QQ0A 5AJYA 2W2XA 5EP3A 3CF0A 1H8HD 2QPOA 4M1TA 4US1R 1P2VA 4JJZA 2RGEA 4DRZA 1GG2A 3HWSA 4LC0A 4QBIA 2ZRHA 5E4FA 3GLGB 4A3VB 1COWA 3D7MA 1NBME 3TNFA 5KSOA 3KB2A 2AL7A 2GVDC 2CCGA 2WICA 2P6NA 2YWHA 2YKGA 1E2HA 5CDFE 5L3QB 2C98A 3OESA 1OXTA 3EZ7A 3I3SR 4NCJA 1ZM2A 2DR3A 3TR5A 5K8TA 1GP2A 1SULA 2OCAA 3AVXA 2DFNA 1E0KA 4MH0R 3TE6A 3OAAD 1KI8A 4EJSB 1KMHB 5IK2A 1YZKA 1DAIA 1OIVA 1YR7A 3D8BA 4YMSA 2X8AA 4KYIB 1E6CA 1IN4A 3CONA 3HPQA 3QJYA 1F5NA 3BB4A 4E09A 4BASA 4C3ZA 2ZJYA 1SXJB 2IUTA 4Z54A 3CO5A 1XXHB 3RS4A 3I5XA 3LVRE 4P0TA 2ZR0A 3EAQA 4UNQA 3WNDA 2G1KA 4XSHA 4F91B 4JN6A 4IVRA 4JYCA 4TTPA 5FTMA 2XOKD 4BGDA 2D3WA 5FOSA 4EKDA 2VF8A 4D4KA 5B58C 2JLXA 4LJ5A 1LW7A 3B1WA 3EIQA 4CEJA 3IIMA 1FNNA 4C0QC 1GSIA 4FI3C 3NH6A 1P72A 2AX4A 1JI0A 5G41A 1IOZA 4DLXA 2FPMA 2RGBA 1Z22A 3OE7D 2W00A 1DAMA 3FHOA 3MCAA 2W58A 3FE2A 1HE8B 3LO5A 1Q12A 4FWHA 4O2LA 4Z8XA 2FFBA 2WPDD 2JJ2A 2QT0A 3GP8A 2QSZA 3VFDA 2EYQA 2RB4A 5DHFA 3T1OA 3ZDQA 1KMHA 1QVAA 4LWZA 1DAGA 1ZD1A 2OILA 3SHWA 1ZVQA 1SVOA 2O0JA 3V9PA 3CF2A 4TYWA 2F1JA 3U44A 1CRQA 5H8WA 4KFUA 1ZUIA 1JPJA 1KI4A 1S9DA 3LW8A 1IN8A 1XF9A 4DSUA 2QTVB 1JQJC 3U3MA 1E2DA 1OH6A 3QBVA 4WZAE 1OF1A 4D26A 4QBGB 2J0QA 2WWHA 1ETUA 3QOFA 3SHFA 4JT2A 2J5XA 2F43A 4ASUD 3R8FA 3A1WA 3MWKA 4B71A 4A0RA 5BQ5A 1SXJA 1FQJA 2CLCX 3K0FB 3DZ8A 3RVBA 3QXSA 3SNHA 4X8OA 2QBYA 2R6FA 2X77A 2C8VA 4EPYA 4BFZA 1ZC3A 4O3MA 1PVOA 3X1XA 1G1MA 4DIEA 2GF0A 3L2OB 4RFSB 1WE2A 1GWNA 2C99A 4FW9A 3GLFA 1UBCA 4TT3D 4BZPA 3VNUA 1E2EA 2WVJA 3BH0A 4TMVA 3B9PA 2DVWB 3DHWC 4QFMA 2CE7A 3UWKA 2GEUA 1AIPA 1XD9A 4HAXA 2BMDA 1R0YA 5L3QA 1BOFA 2PZGA 1FMLA 1P2SA 4P4UA 2JA1A 1NN5A 2G77B 2P65A 5KYKA 1N5LA 3U3OA 1E4YA 2N42A 2G83A 3KJGA 1OJLA 1F2TA 1NVVR 1U9IA 4QNRA 3CM0A 3A1SA 4TYNA 1L4YA 5C4GB 4PHGA 1GM5A 2YINC 3C16C 4M21A 1M6NA 1WBBA 1Q3TA 1QBKC 1KK1A 1UKYA 1MO6A 2C9YA 3BB1A 4JLAA 4Q1FA 1KO5A 1VG9B 1G5TA 4NL4H 3TIFA 1MABB 2BM1A 1SVSA 5IT5A 1T4GA 3DO6A 3PEVA 2B8TA 2WWGA 1CJMA 3T12A 4D25A 4UNRA 5LD2B 3IGFA 4ZDIA 3WHKA 2GF9A 1KJZA 2ZRDA 4KBGA 1I2MA 4OHXA 2IYQA 3C5HA 4ZDWA 2WJGA 2O5VA 4FCTA 4DVGA 1Z5ZA 3RWOA 2JLZA 2CHVA 2H57A 1W49A 3EZFA 3NDBB 3KKMA 1WDTA 4S35A 4KVGA 4PR0A 4UJ3A 2ZTSA 2J0SA 1RJ9A 4TQ9A 1XEWX 1Y3AA 2ERXA 1F48A 3IKJA 5J4YA 1T9HA 2ZSAA 5EJEA 4QOSA 3HR7A 3QBTA 4QJ4A 2YC4C 4W5HA 4FMCB 3ZYCA 5JJIA 1SVIA 2GETA 1LFDB 2W83A 2XSZD 2CE2X 2A78A 2WJYA 2JLSA 4UNNA 3CPHA 2CJWA 2FPLA 4ZI2A 3CX8A 4JL6A 4JZKA 1VCIA 4OJQA 4ACAA 1QVRA 4A6XA 1QZMA 4QNMA 4EJSA 2WWXA 3D6TB 1SXJC 2HJVA 1Q57A 4RZUA 3F8TA 4PANA 1QHNA 1EG7A 3QKSB 3SOPA 1FMJA 4CEIB 1XCGB 1XZPA 1P75A 4Q9HA 2ZU6A 4B6FA 5EXPA 1VCNA 4HLDA 3R20A 3EA5A 5FTJA 1AKEA 2PMKA 1CS4C 1A5TA 2VIIA 2A5YB 2PH1A 1JEDA 2REOA 5L3VA 3ZJYA 4GPTA 4TYPA 3SJCA 4B44A 3TSWA 4KODA 2RGDA
chains in the Genus database with same CATH superfamily
2PU5A 3Q3JB 2CGEA 1F1BA 2IOHA 1YL5A 3SSMA 3UGKA 3CIFA 3CZ4A 3FF4A 2DAIA 1WJ7A 2G3QA 2FMFA 4QBGB 1TD9A 2Q1WA 3HCNA 4ER7A 2XY4A 2OGTA 1WZIA 1AKWA 5TPWB 2DERA 2C31A 2FSVC 3EPRA 3FCYA 1QGYA 1F4PA 1UBOS 2I6XA 2J6CA 2X5XA 3L0IB 4JJKA 2JJQA 1J8MF 2GWHA 3MGCA 5DSTA 5HGXA 5HZMA 5FJJA 1HR0M 2VJMA 4F4DA 3M5PA 3FYDA 3EVNA 2H48A 3HE3A 4CM9A 4ENVA 1C7IA 4DSZA 4IEIA 2YHIB 3NJRA 2P8SA 3TLMA 3UWMA 1VKHA 1BYUA 2I7TA 2WJWA 3BE6A 4MKHA 4IMPA 2VEDA 3QYAA 5CLGA 3U6EA 4HVCA 2PIDA 4AN1A 2GKSA 4LJ9A 1Y8QA 1GFIA 3A32A 1M2OB 2SECE 3G9UA 3KEFA 4GO1A 1NW8A 4Z3DA 3FUTA 3V34A 1G2PA 3DCYA 4PDIA 4B4UA 3DBOB 5IT9A 4KR7A 1GZVA 2WJIA 3D9QX 2R96A 4FYMA 2Z2ZA 4R2MA 4TMZA 5CDSA 2RJNA 1GLVA 5IABA 4QFDA 1M5UA 2GAFA 2IELA 1KEPA 4Y28F 2XF8A 3H4TA 1X7ZB 5EKSA 3GT7A 5AXBA 1O0CA 1ZMWA 2O2HA 4I6GA 2HUPA 3VHXA 1WLYA 3LY7A 2HO4A 3KFVA 1OZ0A 2XXAB 4PPFA 4D9BA 1CJUC 1IBMM 1PJ4A 2A59A 1W93A 4E08A 4AF7A 3NTOA 3H2GA 4D9IA 3PQDA 4UMVA 1IN6A 4Z3OA 2BJWA 4RDHA 1TW3A 2B3DA 4IGIA 1GPAA 2XCUA 4B6PA 1X1SA 3GLGA 1MX0A 2XNHA 1K6EA 3BL8A 3NAGA 2UXDM 1NW9B 2JCYA 3L0ZA 3HABA 1WDWB 3G1UA 1G20E 3QYFA 4P86A 5T67A 5JXGA 1E61A 3QSYA 4P83A 4TWRA 4CKXA 2KBFA 4Y6QA 5JTTA 3HA7A 3KT6A 3LT1A 2GH1A 1F2UA 2PAFA 4E94A 1EFPB 4ZEVA 5B3JA 4GKKM 1BU5A 3JAKA 5HJ5A 1DU4A 4XLZA 4E07A 3IT3A 3RSHA 4F9TA 1SZDA 4GOJA 4CM8B 3I12A 2N47A 3UA3A 4PYRA 4BC0A 2QNJA 4KBFA 4EUHA 1JIXA 1XNJA 1UJMA 3F7TA 2X23A 1IUPA 1EFHA 2V8BA 4CMIA 1RWWA 3O8OA 1T1EA 2VQDA 5FWYB 1JH8A 9ATCA 5FOXA 2GQFA 3WBJA 1OVMA 2I1QA 3ZK9A 3GRKA 5A0FA 2RE8A 1TKCA 4YRSA 1YIDA 5K5EA 1OWNA 4NNOA 2HIGA 1QTIA 5H9VA 2YWJA 3C7AA 5G1OA 3ORHA 3QEAZ 3AV0B 2R8OA 3Q2OA 4IVNA 3I83A 5CDFA 5GTDA 1RQPA 2QLJA 1FNMA 3D7LA 4PBTA 3JYQA 4XJTA 3MOSA 4U2CA 2YJ5A 3D6NB 4B79A 3PD7A 3QJ5A 1ISRA 3BS4A 3C8UA 3KOOA 1CULC 1UC8A 1YH3A 2A1UB 4V1CI 3ELBA 3MJ4A 3V4VB 4BC1A 3LWZA 5I9SA 4A8PA 4NCIA 3AJIB 3LECA 4FMDF 4UBNA 4DDWA 4Z54A 4LF6M 2VWHA 1J00A 1Z73A 1ACLA 1QPZA 5ES3A 1O87A 2IU6A 4LX8A 4L72A 1P0FA 5KNDD 5AM1A 8ADHA 3ED5A 2OCYC 2HXSA 3KEMA 2X15A 4EG5A 5B7NA 4MLCA 4DLSA 1X9HA 2A0UA 3PU6A 1V45E 2ACKA 2EBFX 1BHQ1 3B53X 4WFQA 4EG0A 3IXLA 5CVEA 3NEAA 1JDSA 2R5NA 5A2QA 2XZTA 3RTCA 3C3MA 4CT4B 4RKQA 5A9SA 1K8QA 121PA 1EE2A 4RKEA 3ZK7A 5JSFA 1XDBA 4JUAA 2CJXA 3NUQA 1JECA 2E4ZA 3RS5A 2R66A 4WCDA 2ZAMA 1JHZA 3AHDA 1EFVB 5EFOA 4YUVA 5HFAA 1TUIA 2DBZA 1LSJA 2NZYA 2VDQB 3R0JA 2XQGA 4ZQFA 4ESHA 3Q2IA 1C4WA 3LVFO 3U19A 2O8FB 1W9MA 5LUBA 2BEUA 3DBRA 1XTBA 5U4XA 4HS9A 4F5EA 4N49A 4GH5A 3B1FA 2ZUUA 1IIRA 4ZVNA 4ZHQB 3OFVA 4Y8VA 2H1VA 4GZLA 3KTAB 4MHOA 3ROFA 2CFIA 3TQSA 1LLUA 3A6DA 3KZMA 4PG5A 4S1TA 1IBCA 2QM3A 4EQ6B 5AVYA 3KU1A 4NDAA 2IZ6A 4F1IA 3TYXA 3K5HA 1XLVA 4LOIA 5CFMA 1XRSB 3I2FA 3LKBA 1FFCA 2J9FA 4RZHA 2D2EA 4J0FA 3NXKA 4MLPA 5DOZA 1DKPA 5JSZB 5DO9A 5JVDF 3MJVA 1V7CA 3RGPA 2O3RA 5DM2A 4CTOA 3GDOA 3LQRA 4DLNA 4KREA 4B4KA 1DGQA 3KTDA 2HIMA 3CRRA 2AWOA 2C2YA 1NI4B 4F86A 2XCLA 2BGWA 2JXNA 4JLBA 3OEYA 4JDUA 3ZI4A 2PSEA 4ALJA 1YBMA 3ICVA 4IUBS 1M0WA 4LZLA 1GEGA 1NYTA 4B74A 5EZ6B 5GINE 1EWQA 2RGHA 1DMRA 4IIYA 4US0R 1DAHA 3GEBA 3NKVA 1I7LA 3BTSA 3BVPA 1KSHA 1QIJA 3F73A 4X1IA 1AUXA 3JSAA 3TTWA 1SBQA 3UATA 1P61B 4PBSA 3LYUA 4WHMA 2RBEA 1W59A 1TYDE 1O5TA 3H0EA 4I36A 1IXYA 3A1FA 3WLOA 5SZJA 2WU3A 2PRSA 3OOJA 2Q3JA 1LJ8A 4D96A 1OXBB 1TF0B 1P29A 2QU7A 2VHQA 4OFXA 4KCGA 3UH0A 2A14A 5HKKA 1M34B 2AOXA 1C0LA 3CNOA 2E5LB 3NBAA 3OPXA 1KH2A 1W1IA 2V59A 3FCAA 3GGPA 3PFFA 4QBHA 3VHRA 2C5FA 2QX6A 4UFPA 3Q3HA 5DIZA 4CM1A 2BFCB 3SMPA 3L18A 4X66M 1H69A 1ZU4A 4K81B 1L2CA 4DC9A 2IP2A 1BFUA 4I19A 3QI7A 3MGGA 3PF8A 3KSXA 1KAQA 1PFQA 1WIWA 2IY7A 2JGKA 1EP9A 2UYQA 2Z1NA 1P62B 2ZU0C 3L8YA 4ZQEA 1ISGA 4TKZA 1KVTA 1RNLA 1Z12A 1RC8A 3C6MA 4R6XA 5E4JA 1SOVA 4LF6B 1MEJA 1JHAA 4LRSB 3QFSA 1WDMA 2QZPA 3R5KA 4RUKA 4AURA 4KVAA 5ESXA 3THRA 3AUAA 1WCV1 4L02A 4RD1A 4CV1A 4E13A 3P9PA 4YYEA 3O8RA 4DA4A 4A1OA 2JB9A 2HLNA 5TMPA 1KK2A 4FSHA 4CR6A 3SLGA 3CEPB 4GI5A 4NMLA 3RAEC 3RTDA 2QGFA 3WVNA 3ZHRA 3FR7A 4Y18A 4LBYA 4MVJE 3UOAB 4XGRA 3SIPA 5I4CA 3JWGA 4YV0A 4Q4HB 3STTA 4GXNA 4YJ3F 1FFXA 5AK0A 4C03A 1GLNA 4GZ5A 2VJPA 2R00A 3RU2A 2F2TA 3U2QA 1DDGA 3PGXA 4C4PA 2XFSA 4MW2A 1AN0A 2UU9B 1XTIA 1ZD4A 3H18A 2BUBA 3CNHA 1JKJB 1YOVA 3GEMA 5TQ2B 4LPSA 4G97A 4XZ3A 1D5WA 2LXNA 3L01A 3TIXB 4JI8M 3FTDA 2YWFA 4C7OA 2VYFA 1HK7A 2Y1XA 2ZSUA 1FVHA 4ZJYA 2DTEA 2H1LA 5FH9A 3SS9X 1KI1A 2KBEA 3AFNA 3LC2O 4PZYA 1DBIA 4UUQA 4DCVA 1E9CA 3W2HA 1YA8A 5ENDA 1JEOA 1TU3A 2C0CA 1BE6A 2PBFA 3CEJA 4FE7A 4JB2A 4UHKA 1P7WA 5BN5B 3MTIA 5ILGA 1PJ2A 4J1TA 1NN3A 2R6HA 2FPGA 2OG1A 1Z18A 2D00A 2YHSA 2RJ3A 3HUDA 5H1YA 5B4VA 6LDHA 4PHFA 1NVVQ 5FOQA 5I45A 1LDBA 4G36A 2FPOA 5MN4A 5CD1A 1DAKA 4UXJA 2Q6VA 2ZJZA 3F6RA 3GT0A 4ZJUA 3BTVA 3TLCA 2QLBA 4GM0A 3RF7A 4A4DA 5KC8A 1OHHA 2ZZNA 4AKIA 1VEJA 2GK6A 2P4QA 4PQEA 1E3WA 1L4NA 3RIGA 2P62A 1WMBA 3EXFA 3TTSA 1FFHA 2VNJA 1ODSA 5LLSA 3QVLA 4I14A 1Q92A 5KI6A 5HS6A 3DOIA 4ZMSA 2VXBA 3SJAA 1FJGB 5EJGA 5EJ2A 3GP3A 2YXDA 3CPJB 4OMFG 1MQ9A 4HCJA 5JCXA 3B8HA 2XX3A 5CHYA 3MIZA 4OFWA 4EDFA 4JI5B 2HLDD 1ZHFA 2REQA 4NCKA 3WWDA 2DWMA 4OJTA 5HA5A 1E7QA 1FL9A 4LRUA 5DX8A 2YHBA 1DEXA 2QAGA 5CJ2A 3O3NB 3MJDA 5BWCA 3RAFC 3DH0A 5DNYA 1NF2A 1UOEA 3AVQA 3EZGA 4AZVA 3MRTA 4BLSA 4CQJA 3A4NA 5BQPA 3LF2A 3GDGA 2ZIUB 4WZBA 5M7EA 4MB6A 2LIVA 2WTAA 4MR7A 5AM2A 4BE7B 1D8TA 4B3RB 1RPZA 3E1KA 3ZHVA 4ZAVA 4RTLA 1JQ3A 3KOUA 3IYLW 2NVOA 4R3WA 4D41A 4ZGBA 3SE0A 2HPHA 3IQZA 3P2OA 3HCRA 2D8AA 1UEIA 1UMBB 4HHEA 1CQJB 3A98B 5E2IA 2PX4A 2DBYA 4DJJA 1U81A 3ISVA 1VP9A 1X2EA 1VRCA 2EWWA 3BQMB 3OG9A 4NE7A 1EFVA 5H5JA 1NXWA 2AX3A 4GS5A 2BFPA 2EX4A 1ZUNB 1DZ3A 1IB0A 1E2KA 1ECBA 1SBHA 3HDHA 3I9JA 3EUFA 4P22A 1Y4ZA 5HIMA 1LX6A 3O3OB 4NV3A 3UXEA 3C39A 3X1KA 2YIJA 4KX3A 4HEJA 4YRZA 5FUQA 1MT0A 1WHCA 1WMEA 5C5CA 1F17A 1J9EA 1FBTA 4OXRA 5I7VA 3U6SA 1J2TA 4LYHA 1JEQA 3D7KA 3WRWA 2Q07A 2HRZA 3VC7A 9GPBA 2DX7A 3TZCA 2INGX 3GLGE 3WOHA 3HKPA 5L8RF 1JR4A 1OLXA 4EB0A 3A28A 3DBIA 3H17A 4O63O 1BXRB 1G20A 3CEMA 2I65A 2PV0A 1ID1A 4RDXA 3A04A 3KXLA 3RH0A 4CKYA 5C46F 1KYYA 1P18A 2ANBA 1NVAA 1XQXA 4EI9A 1MX9A 1T3LA 2WJJA 3KD2A 4RIFA 4FWGA 3T9CA 3QXGA 3HA3A 1XMXA 4YT2A 4XPIB 4O8CA 2G88A 4V2UA 5HK9A 3GLHA 4HPJB 1HL7A 1SURA 5IC6A 1XAJA 5AVXA 4WESA 4D82A 1WZEA 4GWGA 1KKLA 1YC2A 3KQSA 3Q6NA 4QUJA 4MKRA 1XHLA 2Y1DA 3ESDA 3NDRA 3PXDA 2D1QA 2H8GA 2ZYDA 1JJBA 1ZMXA 3Q4GA 1L5KA 5KSZA 2V7WA 2Q50A 4UW9A 1DC6A 4ZAGA 4M1YA 5F64A 5AW0A 3IAHA 5DTJA 2HF7A 4WNAB 3Q98A 2AJBA 2X9LA 3H6GA 3MCVA 4N18A 2ZYGA 5GMOA 3EGVA 4D4HA 4DS3A 4F2GA 4RCVA 1II9A 1CUDA 2I4LA 1VL5A 2P2DA 2GN2A 3COVA 3MMNA 1O3YA 4O2AA 1EX9A 4R8VA 2C4TA 2QTAA 4XCXA 5AT1A 3ZJTA 1HNXM 3WY9A 4OATA 3NATA 3ZZNA 3G2MA 3GV0A 3IALA 3QF4B 2BFNA 9LDBA 5GGYA 2J4FA 5T3UA 4QT0A 4J2TA 1O08A 3TPFA 5L9AA 4OMDA 5EZYB 4GSYA 2Y0TA 1E58A 3Q7RA 3AVPA 1EBFA 2EBHX 1KEVA 3A2MA 3FTQA 3I52A 1ZRNA 3GEDA 1ZBQA 4NAUA 5ALSA 1WY7A 5GZ1A 3L6RA 5TEVA 1F38A 1X7XA 4ESOA 2C5BA 2OBXA 3FIJA 2VP6A 2OP1A 1T6YA 4GSKA 4P2BA 3RSCA 4P3YA 1ABEA 3D1JA 5LN1A 2QTHA 3GJQA 3BWDD 3PA8A 3X2FA 4AWAA 5K3SA 4JQZA 1SBYA 1Z6AA 1K2WA 4KK4A 3VJRA 2VZEA 1UINA 2P5TB 1X1DA 3KSDO 3NANA 4KW7A 4B4VA 3AI3A 2AOUA 5IDVA 2NUTB 4D3SA 3K70B 2ZRKA 4CLXA 3F6YA 5F12A 4BNVA 1ESZA 4XWAA 1VPWA 3C6XA 2RGYA 3WV4A 2IU3A 3OPMA 4O4IF 2BHTA 4IQ8A 2WUVA 4P7KA 3WL8A 1KY4A 3AR2A 2L7HA 2V1XA 5FUXA 5IJ0B 1ZH8A 2Z1MA 2C2GA 2NQ2C 1TM4E 1YHNA 3CRW1 2W2VA 4JI2B 3D4OA 3INRA 4OQXA 5H37D 4IX1A 4R5HA 2LTAA 1JJVA 1VPVA 1YJ5A 2IHNA 4W9NC 4L1KA 2IDMA 4AYXA 4DKXA 1CP3A 3PNYA 1SVWA 2C42A 4Y6SA 5BSVA 5K0FA 3OE4A 1TZ2A 5A02A 1E2FA 3W2FA 3ZEAA 5E9AA 4BFUA 1C0EA 1W76A 2PWAA 4LHEA 1TH2A 1PIWA 4IOMA 1MXFA 5FL7D 2YFKA 3B1KA 2KPOA 4ZCSA 2BEWB 3NHLA 4FJ0A 4OHWA 4JXZA 4FDVA 1QH1B 2PRZA 4DIKA 1RJFA 5EYPB 3WTBA 1UOPA 1YQWA 2P69A 2X6RA 2HWJA 1MO2A 2XKJE 1LQUA 3A6FA 1XLUA 4YFVA 5ESDA 4QUKA 4ZHQF 5KSWB 3JATA 5KWEA 3R9XA 4TMYA 4QQNA 4LC1A 2YJZA 1ZHHA 2ZBVA 2B37A 1BHJA 1Q44A 3B5JA 1I5RA 3RPEA 4BNZA 1PT6A 2UYHA 4UDNA 3ZUGA 4F4FA 2JFNA 3IHPA 2XD4A 4RHFA 4ZP1A 1UJ6A 3ZLUA 3FMGA 3IAM1 3B89A 4PXYA 3VR4A 1FX1A 4CL0A 4A8JA 2J45A 2VPWA 3E53A 5IZ7D 4GZ6A 3PFNA 2F62A 3RRJA 1SK9A 4RABA 4Y6GB 4PRLA 4HGRA 4DRXA 3FPBA 1GFSA 3VJKA 1S2NA 5FUBA 1LSOA 1Q1QA 2BHSA 2TMYA 5A3VA 3UWPA 2GZ2A 2PX0A 3RIHA 3RNLA 2RRUA 1E6LA 2GB4A 2Q4TA 3QVXA 1P80A 4R71A 4D81A 2QYTA 3HYTA 1DQRA 3G2QA 1ATZA 2WG0A 1HXHA 3CISA 4G8CA 1E0JA 1I13A 1WG8A 3DOEA 4NYIR 4PLPA 4AW9A 4E5NA 4KPUA 1BNCA 1KAHA 5KYUB 5CT4A 3ZK8A 1N7GA 4B7GA 1VEKA 1XLWA 3SOZA 3KQWA 3MCZA 4Q9AA 4Y2XA 2VPIA 2AH5A 4TXMA 3VSBA 3BSSA 2JJ2D 4L8RC 1N0VC 2Y0CA 3S2ZA 2QRVB 3KUKA 2GOYA 3JZDA 1E62A 1VA4A 2ZTCA 3KWFA 4L22A 1FQOA 2PO7A 1BN6A 3E9DA 3VLFB 4CLOB 3UHFA 2CKMA 3B5IA 4XIIA 1W36B 5IKOA 2JIZD 3HY4A 3I01A 2IA5A 1WY5A 3P0EA 1YFJA 3K9FC 1MB2A 4EPTA 3U5ZB 3VR5H 1D7AA 2F59A 3RD5A 4IJ5A 2JDIA 4HAUA 4L8WB 4LY9A 1OR8A 3SKYA 1NASA 4RSGA 2O2JA 4C4AA 2H7CA 3LU1A 3NHUA 4G09A 2V3CC 1GZ7A 1EFRD 4B85A 3EXEB 4KUHA 2AR0A 1HG0A 2BTQA 3HNPA 4BNDB 2XECA 3CUSA 2CUKA 3H5NA 1L2TA 2DZNB 2XYHA 4YRKA 4UN2B 2NTJA 1Y9EA 2GCGA 4MEJA 2AV6A 1AQYA 3EF3A 3ILSA 3KV1A 3TS1A 1E3TA 1REQB 1CUUA 3I64A 3IP6A 4MVJA 4HDSB 4W8GA 5JSYA 1QQTA 2DQKA 3B1ZA 5D5PA 3BWMA 4RW0A 2OB2A 2AS0A 2VYQA 2XDAA 3DE2X 2FN4A 4P58A 4D4LA 2C77A 3M1YA 4F4CA 2W22A 5F9HA 1I7DA 2OPFA 5IKXA 2HKIA 2UUCB 2XB4A 4ZEMA 1CJKC 3G7UA 2C9OA 4DR3M 3OUUA 5G0WA 5TVGA 1IQPA 1QO7A 5HUHA 4A10A 4FCWA 1GZ6A 1DKUA 1JQDA 2AXEA 2NZVG 2W2LD 2UV8A 3ZDZB 4E2WA 3UJPA 4LF4B 3GJRA 3QNUA 4MV0A 2UVQA 2ASVA 2BHRA 4RZXA 4BQOA 3CLUD 3T9EA 1ECLA 1O4WA 2XOXA 2YZNA 4G5QA 4C22A 5KWIA 1AOXA 2MR5A 2VHWA 2FKNA 2YQ5A 4FYYA 3TQFA 4YT8A 1V1MB 3JALA 2HMAA 3SFZA 1UCFA 2R7KA 1QUFA 5L6LB 3NPMA 3DZHA 2VQEM 2RMKA 1OLSA 1QTQA 2GD6A 1T9ZA 3HGMA 1ZV1A 2FK8A 3ZDEA 1ZL2A 4UU0A 2VWQA 1GL3A 3VH2A 1YB7A 2GZ1A 5CG1A 4LF9B 4PM4A 3OIVA 2ZRPA 4JBIA 4BFCA 1FLDA 4QGAA 4ZI5A 1NMEA 2FZEA 2L17A 5DHAA 4ZZIA 5DHSA 3LH5A 1DCFA 2BP7A 4RTOA 2G36A 2F43B 1W87A 3VR3D 4EA6A 3H4VA 4A16A 4I1PA 3W2TA 2IIQA 2UXCB 2WJ6A 4MQLA 3GG9A 2F17A 3HYRA 1MH9A 4UAGA 2D1RA 3VAZA 1LI5A 3IIJA 3HKEB 5DNUA 3DBHB 4MVXA 3GA0A 5I9LA 4F85A 4JFRA 1Y80A 2ZLBA 1MOPA 3RADC 3WGHA 3U1TA 1C3OB 4BBZA 3AGQA 2R4EA 3LHSA 1I4OA 3T0IA 3THWB 1NLZA 4CZ2A 2QA5A 5AKXA 2Z2YA 2VQFB 5CYFA 1X8KA 5A06A 3E9MA 4EBFA 5GADl 1O8CA 1VI6A 1JXQA 5E1OA 1XMQB 3EXFB 1NDUA 1AURA 4GG1A 2H06A 1AY0A 1ZVMA 2A0YA 3ROTA 4EL5A 5MGBA 3SLRA 3HX3A 3ND8A 3DBRB 3LVVA 5DX1A 4URXR 1V2GA 2R25B 5C52B 3LXMA 3EGXA 5LYJF 2FEWB 4Q4CA 2V6GA 1W7AA 4B6JA 5JAHA 1QMPA 4K6OA 4M9UA 4PFSA 5C8DA 3CX3A 1VJCA 4Q05A 5IJAA 3LQ1A 1P1KA 4IDEA 1O6FA 1NOIA 4MI9A 3MTGA 1M8PA 4OGWA 3U61B 1NI3A 5FOVA 1UFZA 3MWGA 5KKAA 1L5NA 3OFSA 1TT7A 4DCJA 4V24A 5IASA 1KVQA 4TTTS 3JVUA 3V7FA 5KX5A 5E7JA 1SN7A 5DYTA 3EOZA 4C14A 4DRXB 3AUKA 4X61A 1Z35A 4J0QA 4FC6A 4MMXB 3QWIA 4MKFA 2VJDA 2P4SA 2AK2A 1RWPA 1I7SB 3TMYA 3CVVA 1C9EA 1DS6A 1LF0A 1PM5A 3HSSA 1Y6FA 3MRXA 1CQZA 1LPSA 1RFGE 5J1TB 3S27A 5K0JA 2C83A 3Q0IA 4LN1A 3V8EA 4BLRA 5GONF 1L5HB 1OC4A 2PUTA 3E58A 3P9RA 4JB3A 1XZNA 4BVLA 3H1EA 3FFAA 1R6BX 4DCGA 2X3YA 1MQSA 3G23A 4J75A 5ERXA 4B3JA 2JNHA 4D0GA 3EQZA 4EY8A 1A76A 4UVDA 4F96A 1U6IA 3KDAA 3CN7A 2HSEA 1F12A 2GFQA 2X7JA 3FVQA 2H1SA 3ON5A 4KACA 1G5HA 2KSQA 4LGVA 2O2IA 2P3QA 1U02A 4M8NE 4PSKA 5DVZA 3SZUA 2ATIA 2YNMC 3LXRA 4NYJQ 2VJKA 5LQRA 3HV2A 4UEWA 3DV0B 1IONA 4UD6A 2AZDA 4XGKA 4RO0A 1FFDA 2CDBA 4PLGA 1NR5A 4NWIA 4HH3C 3NHYA 1VGVA 1JFRA 4EB8A 4YCMA 1JL3A 5C3UA 1W25A 5TF4A 4IJEA 1Q11A 1Q77A 2ORIA 3QYJA 4UUMA 3ELDA 4BYGA 1LQ2A 1RBQA 3H1PA 1DQZA 3QG5A 5CAEB 3TRKA 4MX8A 1SCJA 2NSDA 3QITA 3VO9A 1I5OA 4DNPA 5JH7F 1IQRA 1O94C 4KXLA 5SYMA 3FOFC 1KBOA 3JAMA 3DA8A 1KERA 1L6IA 1C14A 1PFGA 3DTVD 1T24A 2E5WA 4FVTA 4BUZA 4C0LA 1GYRA 3PD0A 4K6MA 4IWNA 3U7QA 3ZH2A 1U3CA 3DE5X 1DO8A 1U3VA 3QELA 4J0JA 3IILA 3STHA 1VYUA 5JDIA 1W5EA 3AHGA 1RM0A 4FDAA 1JAYA 3OTWA 4OI2A 4X5OA 5T6MA 1CY8A 3SC2A 1L5SA 1PR5A 3TWLA 2VI5A 2VKTA 2GVNA 3KYJB 4HN9A 4MVJG 1GVNB 5BYJA 3B78A 3RGGA 4NABA 1K66A 3DPIA 3SKXA 2YR0A 3WFIA 3O6VA 2ZITA 2BMFA 1UBUS 2GAOA 3W5VA 5A4MS 5BVGB 4II3A 1FK8A 1Q0RA 3EH1A 5H16A 2AFIB 3TJMA 2KJQA 4B84A 1TM5E 3GJYA 5CFOA 4DV6B 4ANRA 1NVWQ 3E9YA 1NV9A 4Y6PA 1N2CB 1J25A 3QFHA 5AJWA 3KCNA 3SHQA 1QTRA 2VUIB 3RG8A 3RQSA 5KC9A 1MXHA 1TAQA 2VCEA 1ES9A 2R46A 1P2UA 3QF4A 4IDHA 2L6OA 3KHUA 3WL5A 5KJ1A 1PWHA 4AICA 4KXFB 4AO8A 2Z6QA 2WJHA 2HA6A 4KH1A 2BBSA 7GPBA 1ZD3A 3UXMA 4XWKA 1LLCA 4AO6A 4R2HA 4QICA 2HCBA 5EYPA 4EHKA 2J59A 5LIPA 13PKA 2N1BA 4MVYA 3QPDA 2PZFA 3BDVA 4MWDA 2QUKA 5EMNA 5F7ZA 1L7AA 1QHHA 4G4SO 3IJRA 5KQLA 3SWWA 1E7RA 4J0IA 4UAJA 1AQLA 3QVGB 2Z1DA 3NCHA 4QVKA 1P9OA 2DOKA 2Q49A 5DNCA 4MIKA 4KLNA 1EFUA 1LX7A 1AKYA 2B9EA 2FWRA 2WKWA 3BRWD 1R9GA 4OSOA 4YJGB 5DISB 1ZITA 1NG9A 1QHFA 3NHMA 3VNAA 2GO1A 5IU6A 1FQKA 1VIYA 3Q41A 4ZOQI 8ATCA 1C30B 2XRYA 4XX0B 2EJUA 2Q29A 2CZCA 1NQUA 5MFPA 1OE0A 4J03A 4AG3A 4YAGA 1CR1A 4X62B 1F3LA 2O1WA 4PX5A 4AUKA 1AQ6A 4H1VA 2JIQA 4FOOA 1DC3A 5PGMA 1ADGA 1HEIA 4LQCA 2AN4A 3N86A 5F9FA 4XUEA 4AZ0A 4G5RA 4RVNA 1E5DA 1YZQA 2YFYA 2J9RA 4E6EA 3OZIA 3OF3A 5CB6A 2GK3A 1V1RB 4IO0A 1YBHA 4MS1A 4AD8A 3TTTA 1M1YB 1IJKA 4BZWA 3LYLA 4A8HA 2L4EA 3R9XB 1J1ZA 3FSGD 3LBYA 4RK5A 4LXIA 3U4QB 2LV8A 1Y5RA 4PGMA 4PX2A 4TOIA 4R05A 1ZRMA 4HI0E 4EA8A 4Q9KA 1UQTA 2IUEA 2J85A 3QK7A 3T7TA 4AP5A 1E2NA 1EGAA 2JFOA 4R1TA 1NOJA 3KYCA 2E2WA 5DU2A 3VK7A 2BP7B 4NEGA 3A1EA 3LHFA 1ZA2A 1JEAA 4I4NA 3L7IA 1NC1A 3SVLA 4LCEA 4DLAA 3BAZA 5A7GA 3LX6A 2ZRLA 1QYWA 2VXOA 3JYOA 3RIXA 2LD4A 2V65A 4EGFA 1Z5GA 4IDAA 3ZY6A 3BGDA 1UDBA 3LK6A 5JVDB 2QPTA 1NHWC 1NURA 3C87A 1F6WA 3GIWA 4KITB 2XVXA 1K3TA 1V26A 1G0OA 5AVQA 1RBZA 1V1MA 3JALB 1KNXA 1F1JA 1CY7A 1PR9A 1CY0A 1Z37A 4UNIA 4GMXA 4CT5A 3RT7A 3GW8A 2KQUA 2OO5A 2FAXA 3H5OA 5KJEA 4C2BA 2LP4Y 2F1IA 1P31A 2QTTA 2VQFM 3QP9A 2MT9A 2HA7A 3BZUA 3PXGA 3ESCA 4FFBA 3ZZUA 4CODB 4U2FA 3VKWA 3FYTA 4BVKA 2B0JA 2BZGA 1ZNXA 5F77A 1DC7A 4JR1A 2AOTB 1D2RA 4EFLA 1FP4B 1DQSA 3BRCA 2H4JA 3P9QA 1Z62A 4FB5A 2WU4A 1NMYA 1U2SA 2HW8A 1QV7A 3KOYA 3X2SA 3GEGA 3DDOA 5DYYA 1Z88A 2DJIA 3WQRA 4Q5IA 4S2EA 3BG5A 3KZ1E 4DMRA 2A9OA 1L5VA 2ILVA 1UKCA 1Z5UA 2EARA 1NA5A 4A0HA 5D2CA 521PA 1EK6A 2WD9A 4LTNA 4BQSA 2O3QA 1G17A 2CNOA 3L07A 4OVZB 2WMYA 3WL3A 4O6VA 1JHRA 1OAOC 3I2KA 1R8SA 4PVCA 2X40A 1P4AA 2J41A 5ICMA 4OG2A 4OH1A 2JZNA 3VDQA 1KEUA 1AV7A 4N41A 5K4AA 3M4YA 3H4MA 3URMA 4JKOA 2X1HA 3W5HA 1RM3A 2W2QA 3FLBA 3WJ1A 1IXKA 1GR1A 1XNRB 2GRUA 2Q1YA 4Q01A 3QJGA 3R8CA 2JGRA 4IS3A 3FPHA 4PZLA 4NOMA 4FGZA 1DX6A 1NATA 1V3VA 2ZB8A 3IH5A 3GQ5A 2DCUA 4J2OA 1WX1A 4WPGA 3U7RA 3USCS 3HGIA 1V96A 2QXYA 2VNIA 1TEVA 4OX9M 3L46A 4G1EB 2IS4A 2BEKA 2F9FA 4GMKA 3VH4A 2R0QC 3N76A 3N2YA 2AHRA 1I9GA 4UCWA 4WBSA 3IHWA 4DQLA 1COWD 1VP3A 3UMCA 1A8PA 2XMDA 3GLUA 2J5BA 3BMOA 1STOA 1UBEA 1VHTA 2ASEA 2JGJA 3BKXA 4XW2A 4NMXB 2HSGA 1NJGA 4YJ3B 3CEAA 2HMTA 5G40A 5IF3A 1LRLA 2F9LA 2YZKA 2XRFA 1J0BA 2ATEA 3OBIA 3QEMA 4YBZA 3TXAA 3AOEA 4F7DA 1GTMA 1UPAA 4OKIA 1VMDA 4HYQA 2KXEA 3NLLA 4X44A 2RG7A 1CVIA 3ORSA 3IC5A 4YECA 1UUFA 1O54A 1HEUA 3BHJA 1OH7A 3T06B 2MIIA 3D8TA 4HV4A 4M0EA 3PLNA 1U3GA 2VZ8A 3QELB 4WOJA 1BH2A 3QY0A 2HFJA 1USUA 3T9FA 3K92A 1HKHA 1EJ6A 4RWZA 1UMDA 4M1OA 3A1CA 2EO2A 3U7QB 1EEHA 5LQMA 4ARZA 4RF5A 4KHPM 1PO7A 5KQDA 1XYGA 4Z4IA 5HYVA 2V7QA 1B8OA 1V3QE 2J87A 4JVSB 3LYAA 2V98A 4MGZR 4S0XA 4OQYA 1EAYA 1W4ZA 1G8GA 2KHZA 3U81A 1CUGA 3HHWA 4WTOA 1AF7A 4RIHA 1KC3A 1KS9A 2ZUSA 3HB9A 1K97A 5EHQA 1HYEA 1X7HA 5U4QA 1E96A 2FXVA 2HQRA 1TZMA 5FEMA 3RIEA 3SI7A 4CCSA 3PLAE 4CHTB 1TE2A 3PGKA 1G8HA 2WRZA 4U9UA 3TUZC 1EVQA 1DRWA 4RULA 3I9V6 1U4NA 1XEXB 2FEKA 4JJ8A 4RK7A 2AOWA 4E7PA 3CUEF 3GH1A 2OXCA 3PZBA 1W2GA 1G18A 3QEKA 2ZJ4A 1XMQM 1RQXA 1S3GA 4FILA 4BKRA 3L8FA 2YXPX 4QOHA 3SF8A 1TM7E 2YXEA 4DEYA 3DVLA 3CMMA 3PFWO 4DLUA 2GZSA 4R3DA 1IY2A 2PH7A 2HIHA 3I45A 4HDKA 1GL9B 4WADA 2I7VA 2JHGA 4X6UA 5BOSA 5IJ0A 5LOVB 4NCAA 4QJBA 1HO3A 1KDOA 5FSWA 3KYCB 2GXSA 4V0NA 5DEIA 2DYKA 4H4EA 4G0YA 1R7RA 1GA6A 1U2EA 4ZJZA 2AI2A 3PKJA 2F64A 4M6WB 4RD2A 4RZSA 3ZCUA 2XCIA 3M82A 2ONYA 2R1VA 1G2QA 4HSGA 4RD3A 3GEEA 1U8ZA 1VJ5A 1WXXA 1IMOA 1ZM3A 2B4AA 2VHYA 3MCWA 4I0WB 4QYIA 3AJAA 2DPMA 3E48A 3GFVA 1SQ0A 2FPGB 3RASA 4A6DA 1R0LA 2ISCA 3RTGA 4X1YB 1U2ZA 3QBJA 1FUEA 3E70C 3BWCA 4S1PA 5IAKA 5IKEA 3P2JA 4KEAA 5DX0A 2OO3A 4OQLA 3V4OA 5JMOA 3JWEA 1GGEA 1QCYA 3R3VA 3HP1A 4R0NA 4CT0A 4D80A 2C2KA 1QZEA 1GU1A 2JFFA 1UM8A 2CCJA 2XQFA 1O97D 1VDLA 2PUFA 2WT9A 3EEIA 1XRJA 4FQ8A 1A8SA 2C00A 4I1UA 3U56A 5ER9A 3UPUA 3PDHA 1WZ2A 4MW0A 4GGMX 1SPBS 3UJAA 2RGGA 4CCYA 3FTPA 4QD3A 1VHWA 4HLQA 4M0FA 4C7BA 2WSSA 4KLCA 4XD2A 3HXPA 1W5AA 4XVUA 1YFLA 1WW8A 4EO4A 2D06A 4C04A 2V5VA 4L8GA 1DAEA 5KTSA 3DV0A 3HM9A 4HPXB 4XB1A 3SDBA 1C1XB 4Y1RB 3W5AA 1PAUA 1DDOA 2YJ6A 1X1RA 3HY5A 2KZUA 1BVRA 2CLSA 2PFKA 1ORTA 1PFWA 3EDRA 1G5RA 1U0LA 4URHA 5GV7A 5F7XA 1JG1A 3MLBA 5IVHA 1XZLA 3N2GB 1YO6A 4HFMA 4W9NA 4EGQA 4X1IB 4C07A 3BHIA 2PT9A 4UVHA 4FHFA 2Q6TA 4ND3A 1ZAEA 4O8ZA 1HTBA 3FI9A 3PDWA 5L7TA 2CDRA 4BL5A 2P41A 4KQMA 4WBNB 4QARA 3WK8A 1N6RA 2EXXA 4JI3M 2NNLD 1OLSB 2NAPA 3EQ6A 3ESZA 1CUKA 3TLBA 3BK1A 5B1EA 4R69A 5TGDA 3TQTA 4LRXA 5CITA 3OEED 1RLUA 3N6VA 1RPAA 3U31A 3O4RA 3O9VA 4GR4A 5FA8A 1YGPA 3A6JA 4JJIA 4OPMA 4KQCA 4QAJA 4RQAA 2Q2EB 5YASA 1ODIA 1T5TA 2XWJI 3IAXA 4EO7A 3T35A 4NBSA 1GITA 6YASA 1TGVA 1OU0A 5JSQA 4C0WA 4FWDA 1FUUA 5INTA 1T9DA 1TRKA 4WGFA 5FNZA 1K9VF 2PWPA 2WILA 5CXUA 3PI7A 1K06A 4RORA 2FSHA 3FD9A 3KTAA 1T3GA 3BB3A 4G4IA 2I03A 4RHEA 4ZOLA 4EKIA 5IK2D 3PT5A 3X1JA 3NB0A 3WHPA 1P4RA 4BX9A 4XBOA 2QQEA 3A1UA 2ONCA 2YWEA 4YUWA 3I42A 2V6JA 3NBYC 1QYRA 1EGMB 1RWBA 1V16A 2DECA 2J48A 2P7HA 3MS4A 1PG2A 1B43A 4ZV7A 2JIRA 3RVMA 1EFPA 4RHCA 1NQAO