1SXPA

Bgt in complex with a 13mer dna containing a central a:g mismatch
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
351
structure length
351
Chain Sequence
MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVDIISLKNGVYTKSFDEVDVNDYDRLIVVNSSINFFGGKPNLAILSAQKFMAKYKSKIYYLFTDIRLPFSQSWPNVKNRPWAYLYTEEELLIKSPIKVISQGINLDIAKAAHKKVDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQRESKMVEFLFDTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIGDKNYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKKAEWQDAFKKAIDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*A*AP*TP*AP*CP*TP*AP*AP*GP*AP*TP*AP*G)-3'
publication title Structural evidence of a passive base flipping mechanism for {beta}-Glucosyltransferase
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transferase/dna
total genus 115
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.4.1.27: DNA beta-glucosyltransferase.
pdb deposition date 2004-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09198 T4-Gluco-transf Bacteriophage T4 beta-glucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1sxpA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1sxpA02
1FA9A 4EKEA 3T7DA 1P4JA 1XV5A 3PE3A 4EL0A 4BFCA 2HY7A 1FTYA 2QLLA 4X7PA 2QLNA 2QN3A 1PN3A 1NZFA 3Q3IA 3TOVA 4HWGA 4YI5A 4F9FA 2SKEA 2AZDA 3T3EA 2C1XA 2QRPA 2BGUA 4RBNA 5ENZA 3T3DA 3NP9A 3E3LA 1FTQA 9GPBA 1JIUA 2FFRA 3H4IA 2GM9A 2GPBA 5I45A 1WUTA 4F97A 4WADA 3O3CA 5HXAA 2PYDA 1IXYA 1WW3A 2IEIA 2R60A 1QM5A 3QHPA 1K08A 3NCHA 1SXQA 3C48A 4HLNA 4RENA 3BEOA 2R4UA 5TMEA 3RT1A 3CX4A 3S2UA 3S29A 4CTOA 1NOKA 2C9ZA 1V4VA 3HBJA 4LDPA 2QRQA 3FROA 3UYKA 3DD1A 1GZ5A 3MT9A 4RIEA 3D0RA 4N3BA 4PQGA 3CUTA 4RIGA 1LWOA 2OFFA 1M5RA 3Q3HA 4FKZA 3MS7A 4NC9A 1F0KA 1Z6PA 1EM6A 2IV7A 2QN7A 5LQDA 2QRGA 2Q6VA 7GPBA 1RZUA 2H1FA 3MSCA 1Y8ZA 1GPAA 3CEJA 3AMVA 1L5WA 3PE4A 3G2JA 1BX3A 3OKCA 2AV6A 3GPBA 2XMPA 4G2TA 4EJ2A 2GPAA 3WAGA 5D00A 1FU4A 1FU7A 2C4MA 3RSCA 3D0QA 3BCRA 1NOIA 2XGOA 1WW2A 3DDSA 5BNWA 1YA6A 1EXVA 2JLBA 4KQ2A 3G2HA 3MQFA 4BQEA 4YUAA 2QN9A 2FETA 4N3AA 2X0DA 4CTNA 3BD6A 2R66A 2SKCA 3RHZA 1AHPA 3CUUA 1H5UA 4WHMA 2QN1A 3MS4A 2VSYA 2F3PA 3G2IA 1GPBA 3NP7A 5JTUA 2GEJA 2XGMA 3Q3EA 4MI9A 4YI3A 1LWNA 1C8KA 1L6IA 2IYAA 4MI3A 1P29A 5JTTA 2QN8A 2F9FA 1XL1A 3G2KA 2G9RA 4NEQA 1P2GA 2AMVA 5DU2A 2SKDA 1P2DA 3L7AA 3E3OA 2BFWA 2H1HA 1E4OA 3T3HA 5GPBA 1J39A 3S27A 3WADA 1ABBA 2G9QA 1PSWA 3EBPA 1GPYA 3CV3A 4GZ5A 4REMA 2QRMA 3BDAA 1JIVA 4BQIA 1FS4A 1A8IA 4GZ3A 4M60A 5IKOA 4XI9A 4RIFA 4CDRA 2X6QA 2G9UA 3H4TA 4MRAA 1UZUA 4AMBA 3SYRA 2GPNA 3G2LA 3CUWA 3G2NA 4AMGA 1NVKA 2X6RA 2AW3A 3NB0A 4N39A 1Z6QA 2GEKA 2JJMA 1VGVA 1C8LA 2ZB2A 3OTHA 1SXPA 3HBFA 2BGTA 3SYMA 5D01A 4KQ1A 4M83A 3ZCQA 1P4GA 1K06A 3BD7A 2WTXA 3ZCUA 4X6LA 1AXRA 3NAZA 2ACWA 2QZSA 2X0FA 1IIRA 2XCIA 2IUYA 2R4TA 3MRXA 1JIXA 4EKYA 3L79A 3S28A 2YJNA 2XGSA 1P4HA 4GYYA 3ZCRA 1JG7A 3BCUA 1GGNA 3VUFA 8GPBA 3HBMA 3MT7A 4WACA 2XA2A 1F6DA 1WV0A 3T5TA 6GPBA 4MHSA 1WUYA 2F3UA 3L7CA 3UYLA 2GT1A 2QNBA 2XCUA 2XA1A 2QLMA 3D1JA 1L7XA 2ATIA 2ECPA 2R68A 5C1DA 1Z62A 4X7RA 3L7BA 1L5VA 1PNVA 5TMDA 2JZCA 5IKPA 4GPBA 4XIFA 4GYWA 3OKAA 2VCHA 3ZCPA 2O6LA 1RRVA 3WC4A 4CTMA 2VCEA 3L01A 2QRHA 1C3JA 1NZDA 3CUYA 3EBOA 3VDNB 2FF5A 1NLMA 3IAAA 3OKPA 1O6CA 4L22A 3TSAA 4N9WA 1UQTA 4AY5A 3OY2A 2ASVA 4Z5XA 2IV3A 3C4VA 1UQUA 4QLBA 1GFZA 1HLFA 3BD8A 4W6QA 1L5QA 2IW1A 4GZ6A 4NESA 1KTIA 2X0EA 1GG8A 3CEHA 2KS6A 2ACVA 3L7DA 4LEIA 3ZCSA 3GUHA 4MICA 3MTAA 2PQ6A 3MRVA 1NOJA 1QKJA 1WV1A 3E3NA 3COPA 3ZCTA 1PYGA 2F3QA 5DLDA 4N3CA 4RELA 1XOIA 3OY7A 3CUVA 1C50A 3NPAA 1Y6GA 3HBNA 3MTBA 2GJ4A 3VUEA 4EL5A 3S0JA 1XL0A 4M7PA 2G9VA 5TVGA 3MBOA 1FTWA 1RZVA 1FU8A 2VSNA 1Y6FA 4X7MA 3OT5A 2P6PA 5DXFA 1FC0A 4AY6A 1E1YA 2IYFA 4RIIA 1Z8DA 2C1ZA 3BCSA 2VG8A 3DZCA 3MRTA 3NC4A 1YGPA 1JG6A 2BISA 3OTGA 1P2BA 3TAXA 3T3IA 4RIHA 3ZCVA 1L5SA 4MHOA 3QKWA 5TMBA 3T3GA 2F3SA 3RSZA 1L5RA 4MI6A 2PRIA 1XKXA 1JEJA 3MTDA 3C4QA 3CEMA 4KQMA 2PRJA 3VDMA 2PYIA 4F96A 1B4DA 3MS2A 3MT8A 2QN2A 4AN4A 3DDWA 1XC7A 2IEGA 4FZRA 3IA7A 4BQFA 2XA9A 3OTIA
chains in the Genus database with same CATH superfamily
3QV1A 3ZY3A 4QU9A 4BZWA 1EK2A 1PZXA 4BO1A 1Y33E 1DIGA 3COYA 4IXWA 4RFVA 3SOZA 5TQ0B 1O4WA 3V8NA 3D2AA 2PKRA 2FMUA 1RYFA 2P5TB 2QLNA 2WICA 3D6HA 3GLHB 4L4ZA 3SJBA 1Q0TA 4I5GA 1AU9A 1US8A 5HOEA 1CUBA 3VAYA 1XQWA 3LCJA 1KVUA 4DBLE 3PB3A 3T3EA 5FFNA 3IV6A 3SJCA 3SYLA 3PU6A 5D3KA 5H81A 3IOMA 4RBNA 3GRCA 1T4CA 5DHSA 2VT2A 4ID9A 4I3GA 4DXDA 3AM4A 4R0NA 3H75A 4M9XA 4Q9AA 4Z1OA 3AY0A 4B4VA 4OBWA 5FFMA 5HTOA 1QCYA 4KRYA 3ZVNA 4GUAA 3SP1A 1I6LA 3IOYA 1ISHA 5K6RA 3MNFA 1WUTA 1BU8A 4L4RA 4EY7A 2JK0A 2JKVA 2BEWA 3BXFA 2P2NA 2FKAA 5K6AC 1XG5A 2C9YA 5CMLA 3P96A 2XY4A 3LX5A 3OFSA 1RD4A 1U2DC 3IAS6 3BG5A 4C7KA 1DKMA 1E3WB 4P9NA 5GMOA 4CLXA 4G5OA 2ZJ6A 5TMPA 1JQJC 2RGYA 3UIEA 3AF5A 3B13B 3NM4A 4RMIA 1GL9B 1U2RA 1XLWA 4B2IA 3NEYA 3DEFA 1TQHA 4L8YA 2J30A 3KEQA 5CH5A 4AZVA 821PA 2RAVA 1EAYA 4RA9A 4PM4A 1H4QA 3D6UA 2V1UA 1BS2A 1G7CA 1QANA 3CXRA 4FHDA 4GMKA 3L1IA 2AN9A 4ZJZA 1EI9A 4IQFA 4C76A 1IAQA 2DQ4A 4G0YA 2IYNA 4GP9A 3BA6A 3TG2A 4D3XA 1IZZA 2Y68A 1CZHA 2W2PA 2XUHA 5K99A 3UYKA 3UMJA 1SQ0A 1S2DA 2O48X 3MCWA 2GPJA 3EW9A 4FX2A 1DIAA 3ZHZA 4CV2A 4GMGA 4OUDB 2WLTA 4RIEA 4ZCTA 3D0RA 3DO5A 2D2IA 3AYXB 3FAKA 5DNDA 4RVFA 1SRQA 1C0KA 1GSHA 3KV1A 3RVOA 1WDKA 5GJBA 1VJRA 1UMCA 1ZMTA 4YRFA 2YNMD 1ECGA 1P8JA 3FPBA 3OI7A 5AYVA 2X40A 2H5JA 3ONDA 4YWJA 5ITSA 1KDTA 2YNMA 4Z4EA 1W85A 1O9HA 3DONA 1OFTA 3LNTA 1TMKA 2IPMA 2WKRA 5CA1F 1SXIA 2M2IA 3IBFA 1ZMRA 2H85A 1G9XA 4IXTA 5EP3A 4YRKA 5LP1A 3T5AA 5JHHB 1PR3A 1BKYA 2JIRA 2PEYA 4OXXA 1RACA 4OUKX 1ZK2A 5I9NA 3D3WA 1M0TA 4IMIB 1TUBB 5KYWB 3QY0A 2ZI6A 4UHBA 1OR8A 1GRRA 4A73A 5L9AA 3JW8A 1KPGA 3L7NA 3EVDA 4L8WB 2XXAB 4DUYB 3BMCA 4EPWA 2Q6OA 1OLXB 3R20A 4XIJA 1AV6A 1T1EA 3OD5A 2P9QA 4FMDF 1CUDA 1R4MA 2YYAA 3R23A 4G2TA 1PYOA 3KZKA 4YK7A 5B3JC 1VP9A 1C7RA 1RJEA 1O7JA 2GBFA 4YP9A 4S1PA 1UKBA 2BHNA 3IEPA 3CKKA 3E27A 5KYUB 3NBMA 2QD1A 3Q7SA 3QW4B 2FOLA 3KSBC 1B8UA 1P73A 2VP9A 4O4IA 1GV0A 2JLBA 1G8FA 1TLFA 4ND3A 3DAGA 2GAAA 1PLJA 3NETA 3EMVA 4KDRA 3WSWA 4DN6A 3VZRA 1QK5A 2UZ3A 2L17A 1LVHA 2B0CA 2I4LA 5HK8A 5T3UA 3DFKA 1JUDA 2RCYA 4DLYA 5ABPA 2F4VB 1ZD4A 2OO5C 1I33A 5JLAA 1XD2A 3UMFA 1ZR4A 1OW3B 4IVRA 5TGTA 3VM6A 3LY7A 5MF6A 3TBFA 4CDGA 4ED9A 1H2XA 3QE0A 4FDAA 4RPHA 1N6HA 3MS4A 3UWOA 3MEQA 2YC2C 2YJGA 3UJNA 2BPOA 2ISQA 4CXMA 2AL7A 1FSFA 3LSYA 5AKYA 1G18A 4D4MA 5B7NA 1KIAA 2NTNA 2OAEA 1J0BA 4KEAA 3W1VA 1M76A 1WTCA 1XROA 1ZVMA 4TMVA 3SKXA 2PRZA 3QVGA 5G0SA 3BK7A 4DEXA 1O9GA 2Q1UA 3U6BA 3ISVA 1SC3A 3N3AC 4UTOA 3ROXA 3OZ7A 2VJQA 4A23A 4F9EA 1L4UA 1VL5A 1TIPA 3FZEA 4MJ7A 2WJWA 4WOJA 5EY5B 4Q4CA 2HR1A 1AKUA 1TKAA 4L76A 4JL5A 3A06A 1P29A 1USKA 3H86A 2PMBA 3JQFA 4D3YA 2G82A 3RUPA 1OLOA 5C8ZA 4ZU3A 2ONZA 3AVPA 4C05A 3OTOB 2UUOA 5TIIA 1VKNA 2QUJA 3A4NA 1M5UA 5IFKA 2L42A 3UTCA 3MILA 4PR3A 5LP6B 3A3YA 1HL7A 1P19A 1CY4A 2QRVA 3L7AA 3REQA 1XTZA 3DMDA 4W63A 1NN3A 2DUNA 2IS1A 3DP9A 3P32A 3T3HA 1VDMA 4MMZB 3TRHA 4ZHQA 1AF4A 3HWX1 3TKAA 2WNSA 4E30A 4DILA 3PGLA 4M1QA 1UZAA 2YWRA 1JLSA 3SYTA 2WF5A 4K7JA 1TQ8A 2I0FA 1C9DB 5AKZA 2HK8A 4NNOA 3VU9B 2C0CA 1E3MA 1NFQA 1P9RA 3UANA 4NULA 5TPWA 2X2EA 4L7VA 3RS8A 1WCXA 2V45A 4JYMA 5D85A 4JUDX 4MW5A 5HZKA 4ZT5A 4Z0TA 2QRUA 4Y6GB 5KNBH 4ESEA 3U4MA 4P3PA 1D0SA 3A28A 4A5SA 1LU9A 3VHRA 1EE2A 2EKQA 4JSTA 2F90A 3T7KA 2XEDA 3WQQA 3X1JA 1K7XB 2F8TA 4RIFA 2DTEA 3I8SA 4F3CA 2VAXA 1JPJA 4MUIA 2QM8A 2A0FA 3CINA 3FHOA 1W47A 4PFQA 4AM8A 4B84A 1QKIA 3IDFA 4HNTA 3A32A 4IOJA 3TZHA 3T3NA 3WNBA 1T3SA 1TU4A 2FPPB 4M8IA 3P9SA 1NLUA 4Z54A 2XCRB 1FLNA 3LW7A 4LOAA 3NDJA 5BQXA 3L4KA 1VM6A 1XZHA 1Z2EA 3GLQA 2XMQA 5LC1A 2XUPA 2G1JA 1P0PA 1WQ4A 3ZWDA 1I4TD 2K2QB 4KAXA 2HQBA 4N39A 4B44A 3H6HA 3DNPA 1CWUA 2DY0A 4G5RA 1YMQA 2PD4A 4K28A 3D3KA 3B51X 4CDNA 4MIEA 4YJ2B 2GSWA 2DGDA 4XWGA 4KIFA 1QNFA 2FRDA 3AWIA 3C8MA 1ONBA 1PGPA 1CC1S 1VBFA 3OZWA 4JEIA 4O4HB 4Y9SA 1NLZA 5B57C 3BXOA 1HGXA 4LGVA 4NZ9A 3WL3A 2JHCA 1GZ3A 4FGZA 4AI6A 1BQ3A 1JDVA 4FK8A 5K1ZA 2X23A 1UK8A 2BJVA 2PGOA 3BF7A 4JJGA 3J7AC 4UFNA 5FTJA 1Y3FE 3IAM1 5I7OA 3KOXA 2Y92A 1L8QA 4FGUA 3GROA 2C2ZA 3O4IA 4B6RA 4HDMA 4UUAA 5AW3A 5AI8A 4DSUA 3MWKA 4JLJA 4UXHA 2XCIA 4G0QA 1ISMA 3V5NA 5KYWA 3D7SA 1T9GR 4M8LA 1VMAA 4RVSA 4MA0A 4G07A 4UE6A 4UTVA 4QBTA 1YZQA 1Q1AA 2OD2A 1N4DA 3A14A 3N3BC 4U7JA 2VNJA 3F1KA 1ND5A 4H6WA 2F2TA 3FTCA 4EKYA 1G7TA 1ML4A 1T9AA 3A1CA 3LY8A 2YJNA 1YDWA 2X4DA 1BMDA 1KK2A 1I3MA 1T4DA 3ETDA 1QHEA 1PT5A 1CF4A 5I4KA 4GI3A 2QX6A 3F2IA 3M2TA 3IQGX 3ZCRA 1H66A 5B1HA 3HPQA 1JG7A 4PLTA 4FJ1A 3JVDA 2GLUA 3AKEA 3VKUA 5KINB 2O5VA 2O5RA 5CUQA 2GBCA 4L85A 5TSDA 2ZI9A 3M6AA 4E5PA 2DM6A 3E05A 1XZIA 1OX6A 3INNA 1GRCA 3LBHA 1DT5A 4OD0A 5GOZA 2UYYA 4I50B 4DDKA 1FDWA 4Y1RB 4BNXA 3A6EA 2AB0A 3G89A 3GLUA 1IU9A 1E7RA 1HI9A 1XRQA 3FPFA 4U2CA 1Y5NA 3GLFE 3HCBA 1QIIA 4Q3DA 2BC9A 1QWOA 3AR4A 2XA2A 2F7SA 4TL9A 2R7AA 4XFDA 2CL5A 1FP2A 2CDNA 4ZAFA 3DNMA 1TZCA 2WHPB 1VLLA 4MHSA 4P4TA 5SV2A 1ZC3A 5DT2A 5TJHA 2PSHA 4D9EA 3PFCA 5AIAA 3JAWA 4NJEB 1AZLA 2NPFA 1I2DA 1N2CA 4CM6A 1XZJA 4FHZA 2AF3C 1A71A 3L6CA 3S2ZA 4AO8A 1YO6A 2YVUA 2WAOA 1VMDA 4K6KA 1Z9BA 2F8LA 4ZOLF 4JC4A 1WCIA 4ZZ3A 2FWAA 1KZ4A 3A36A 1H2EA 2XNJA 1A8SA 3R5TA 4NDAA 1KO5A 3R5JA 5REQB 3RU2A 5TMDA 1U9ZA 5I4BA 1JAHA 2O8CB 1JECA 1NW4A 3PNSA 1KO8A 1E3JA 1DO2A 1C80A 1WVMA 1J33A 1GV1A 3RR2A 2V7QD 1U28C 3TW4A 1Z34A 1JAIA 3CU5A 1UMBA 5AUNB 1RKXA 4B9EA 4BC0A 1TGYA 4EO4A 5CCXA 2PVSA 2IWHA 1Z8HA 2GCIA 2R6DA 2V7QA 4XIFA 2HEIA 1NPYA 5F78A 4JBGA 1KDYA 4CF5A 2NTJA 2NUBA 3BXGA 5DGIA 4QVGA 3U3KA 5ARBA 5JQGA 1L5KA 2H00A 4MPRA 1E3SA 5CM2Z 3V2GA 1KC1A 4BTLA 1BKSB 2FEMA 2PG3A 3BXPA 3SSMA 1FLVA 1W5EA 3LY5A 4U7HA 4D44A 3BCHA 1EX9A 1P1RA 2CK3D 2VPPA 4NCXA 1GPDG 4O3FA 3EZNA 2VCEA 5THKA 4Q4AA 1C9KA 5FEUA 2QX4A 2O0KA 4OQNA 4RMHA 2X4GA 2CK3A 3HZZA 1UH5A 3GI1A 4K86A 1NVDA 4GUDA 4L5YA 1XZGA 4R8MA 2DEUA 4F0JA 5CB0A 3V1LA 2J0SA 1H3FA 4EYEA 5BSWA 1BXZA 2FCRA 3E9EA 1W46A 4HQOA 1IHPA 4JJ6A 1NRXA 4AP5A 1VPWA 3NVAA 2RSLA 4CUJA 4WI1A 4D9IA 4DQXA 4KPYA 1QHFA 2P65A 4BEWA 1XI2A 3IODA 2R9VA 4H0FA 4RMNA 3NUGA 5JO0A 3R0VA 4MUEA 4LXTA 2NVOA 1Z6GA 3LKVA 4EW2A 2GCPA 5K0SA 3A9WA 5JXHA 2VWGA 1Z7YA 1YL5A 3W3AD 1Q3KA 3UHOA 4UU8A 3VGJA 5ALKA 2W6QA 5ALRA 3LLVA 4JP8A 4KGVA 5PGMA 3W3AA 4HVCA 4X54A 1JG4A 5DH9A 4DJJA 4UUMA 4QDOA 1G19A 2MSWA 2HMAA 2AC7A 4DDUA 1KH3A 1JIKA 3NTXA 2RHBA 2VDPB 1U31A 5DMXA 3STXA 3WWEA 4JHXA 5CIQA 1B14A 4IH9A 3FXAA 4NAHA 5JLJA 4J0GA 3KUKA 1R0BA 4RELA 4QXPA 1YVDA 2E85A 4TQAA 4CVNA 2G8LA 4R7TA 4UNNA 3TPZA 2Z4TA 5EE5B 4J6FA 3UK0A 3NNNA 3WA6A 3HA2A 2R751 2XCQA 4GWLA 4WKPA 4EY3A 3H11B 2D59A 3A3PA 1BX1A 4IFBA 4EOGA 1MJGM 5KQPA 1WMFA 1XFDA 1N5IA 3EZ7A 2ZETA 4IZOA 4OEHA 4V38A 1OXBB 4CKEB 3H5LA 3FKQA 1N32B 4HMOA 2Y0CA 4BNDA 3ZE9A 1Z5ZA 2DWCA 1JT9A 1WS6A 4F71A 3ROKA 3HQ4O 3QEMB 4LJ6A 4URXR 2IP1A 4RKRA 5T8KC 3PC4A 3ZS9A 3VV2A 1PQWA 4A8JC 3N7AA 2ERXA 1JILA 1XXHA 1YZUA 2JVJA 2OM2A 1V8OA 1DO8A 2XUGA 2R8OA 3G5AA 5AM4A 2JD0A 4KAAA 1NDQA 2I71A 2VIIA 2RBEA 4PR0A 3RREA 3HL4A 1I10A 4XSHA 2FSSA 4D9NA 1C9MA 3S8YA 1RXYA 1DINA 1V1JA 2WU1A 2K6GA 3N6RA 1W36C 2JH9A 3QNWA 1ZJ6A 1G17A 1AGNA 1QBGA 2F3SA 3TSZA 4URYR 1I2MA 1LQ2A 4NNJA 5CG2A 5CVTA 3HV0A 4PCVA 3SC3A 4IHAA 1YRQA 3CVWA 4E5SA 2CCKA 3I9FA 3KE9A 3RI3A 1G60A 4LISA 4MITA 3ZKWA 3H2ZA 3I52A 4DGSA 4JLDA 3UHAA 4RD2A 1E2GA 2Q2NA 2QTGA 5FI1B 4K3VA 1K4KA 3RKUA 3B6JA 1QF7A 3GLTA 3KYIB 1DFGA 1UT6A 4ENWA 3RDPA 3QVUA 1QP0A 5A04A 4Q1CA 3DMYA 3FNFA 2H1OA 1R74A 4Z4GA 4LBYA 4EGSA 3ZGVA 5HWSA 1Z15A 1M7GA 1SIWA 2CHVA 2QMHA 2NO4A 4PANA 4JDPA 3JD1A 1WB9A 3GX1A 3KG2A 3AERB 2DSTA 2F55A 5E3IA 1D03A 2QP4A 2OYRA 2H1IA 3ILXA 3EVBA 4EKEA 4XWKA 4R5MA 1P4JA 2ABWA 2OGZA 2EATA 2PMCA 3NAGA 1V5WA 4S1OA 1PGOA 4G1VA 4ARIA 1TZKA 5CVEA 2WF8A 4DT1B 1KK0A 3KKMA 2Z5GA 1PKEA 3DZIA 2VFAA 1U99A 4LSZA 4EB8A 4NE9A 1XLTA 2HSWA 3BEDA 1KXZA 4YCMA 2V4UA 1TD9A 3SMQA 1C7IA 4FT2A 2XLBA 3Q7RA 2IYUA 3LCUA 2JFHA 2C1XA 2OMEA 3M3PA 4YRCA 2NG1A 4KQ9A 4ID3A 4KQKA 4DVJA 1M8PA 4EVSA 2R62A 3KUDA 1F2DA 1XDDA 1YI8A 3PQCA 4FGKA 3ZHTA 2ZANA 2NSHA 4R41A 3HEAA 3UAZA 4YRZA 4KMSA 4AKSA 4NCAA 4HTFB 1RJDA 1U9YA 2I2AA 3CA8A 3H4IA 4TV8A 5DHTA 4TLDA 5F4BA 1FVHA 1MC4A 4NKRA 5K0CA 1C3OB 2YVAA 1Q92A 3VPCA 5E3JA 1JU9A 3HJHA 3K32A 3EHDA 1AK9A 4GE3A 4P8RA 2GA8A 1VI2A 4X63A 1RQLA 4GZMA 1MVNA 1N6RA 2X77A 1RJFA 1XRJA 3CKLA 4MPDA 3UK6A 4IVPA 1SA0A 3GLIB 1Y5IA 3FNRA 4EUKA 4PX9A 2NO7A 2VYCA 2ZM6B 4K9LA 4M49A 2VNHA 1R6DA 4FOLA 1FP4A 1NE7A 1PJQA 1TMYA 3IQIX 3QK7A 2J67A 2XZTA 1EFRD 4A7PA 4B2PA 4EKIA 2H2AA 4MQ6A 4OAQA 5LQKA 4LV8B 3V33A 1EFRA 3FKSD 2XR1A 1ZINA 3ET5A 2NYAA 3PHIA 2TECE 4V0KA 3FKSA 4E5UA 3K9QO 4RQTA 1Z39A 4R98A 3DQQA 1R0XA 2EFYA 1ORWA 5I51A 4EG6A 1YNOA 3O4JA 3RWOA 5JO9A 1F0YA 2YJ4A 2X8JA 2WJ4A 4NLLA 1ZM9A 2CWWA 3KOZA 3PUHA 4GR5A 4PAWA 4X6YA 3ND8A 4B6FA 1EWRA 3N86A 4P5PA 3GWGA 3I01A 4DOMA 3KDAA 3PC2A 5IC5A 1U3CA 1G8GA 3BFKA 3G2OA 2XCLA 4R8VA 1UANA 1P31A 4TKLA 4FFWA 2DTDA 5JSFA 3MT9A 4QUKA 4FW9A 1UXKA 2R2GA 3RIHA 3RS7A 2WD9A 4F21A 3F5DA 3IEKA 2PT7A 4X84A 3KE8A 1K8QA 1HA3A 5E1MA 5JFOA 3DT8A 3G59A 4LY9A 3B6MA 2Y9MB 4LQLA 3BBPA 2O0LA 1X7ZA 3L8GA 4AICA 5IJ9B 2O4CA 3NHRA 3EE6A 3DTVD 1MN6A 3H0KA 4KU4A 2H51A 2PX0A 4W9NC 3T06B 3TOCA 3ZE2B 3OZCA 2ICAA 4L0CA 1KI9A 2NTEA 1DJNA 1XTSA 2CNKA 2GKOA 3KOOA 3Q5GA 1WUHS 3DTVA 4PAMA 4NCHA 1EHIA 1ETHA 3B7PA 1KIMA 3ITEA 3U39A 3NHWA 5EE0A 3A31A 1NVFA 2KLBA 4O3MA 2ADOA 3WRVA 5JT1A 3STWA 1D7AA 1RWMA 4UHEA 1MAAA 3V46A 4DJEC 2GZRA 2WMYA 4PLFA 1IC6A 2I1QA 1ZK3A 5J2UB 1I3LA 5KDLA 3BGWA 3K8ZA 1DJQA 2GBLA 4MULA 3ZE7A 4B0OA 4AYWA 1L5WA 4D3SA 3M5PA 5E9AA 3G0HA 2H8KA 3PWSA 3Q7TA 2OBXA 2H1SA 3C3CA 2C00A 1LTQA 1WKVA 3KUXA 2AEMA 2JGDB 4CMEA 1I7SB 2JBAB 2QN6A 5AXBA 5E8RA 5JVDA 4QUGA 5E7QA 3LCCA 2HIAA 1Q7CA 1R9JA 3I73A 3FMVA 1I0ZA 1RT9A 3ZTYA 1UC4B 1JKFA 1VB3A 1YJ5A 4IEIA 3QPDA 4KMRA 4TYYA 4Q7QA 3K5IA 1CLEA 2OM6A 1A9XB 4BBPA 1WQ1R 5F21A 1XKLA 3EZGA 1MW8X 2WG2A 2QBYB 1Z4PX 2WTUA 3USES 4KQ2A 2IYOA 4K9RA 3V4RA 1BRMA 5DHFA 1NJ2A 5TQ2B 4OSEA 2Q2QA 4U9UA 2WTNA 4TMXA 3ZU3A 4R0MA 3R74A 3K53A 1A8HA 3ELDA 4MI1A 2XVMA 3EXG1 1X42A 2BEVB 3VNAA 2XQFA 1CD5A 3AGQA 2EXXA 3KBBA 4LCJA 4AS2A 3PQ5A 1W75A 1AHPA 5CIYA 4G5XA 5ILQA 3NO4A 1A5SB 4BMCA 2QDKA 1U0EA 1BCRB 2P2YA 4LQ4A 1IM5A 1ULBA 3U7FB 3DE6X 1XTQA 3HFGA 4NFLA 4H1HA 4E2ZA 3MTEA 1QZTA 1TPZA 1RJ9B 1EEHA 4FUQA 4UAJA 3VH3A 1SULA 2VWQA 4PRKA 1XU9A 4B46A 4DRXB 4E3ZA 1YT5A 4QWWA 2XGMA 4L95C 1UADA 3TQIA 2ZFUA 3F4BA 1KDVA 4BFWA 4FQ8A 1PTJA 3X44A 4BB0A 3L9WA 3UICA 5BN3B 3IPAA 4B7ZA 3AV0B 1KQFA 4DNXA 4FOTA 4DR2B 1N6LA 5T7BA 3ZK7A 1XE3A 4CKCA 4ZT7A 2WFMA 4A2CA 1AA9A 2K2WA 2YXEA 5DX8A 2QVLA 3UPTA 4NBTA 1VB5A 2B99A 4FMCF 4O1HA 5F3RA 1GUYA 2B8JA 1L1FA 4KR7A 3S7TA 4HMQA 4Y6QA 3KTDA 4Y6PA 1UOOA 1ZDMA 3JU3A 2JATA 2H1HA 1SEPA 4P80A 4D7AA 4EZIA 1F0PA 3CC8A 2YKGA 3HM9A 4PWYA 5LZ7A 1H1TA 2B37A 2TMDA 3WMGA 5B7PA 1KAGA 1DNPA 2G9QA 1WXEA 2B5VA 4TMFA 4ECAA 4HMPA 2IYRA 3EBPA 4ZO6A 4QM6A 1MCZA 3RFTA 1KI8A 1DJPA 4ANFA 2VRBA 4IOMA 4CCAA 4XGQA 5IM5A 2WJPA 3OZXA 4QOGA 1PV4A 4ZOCA 2IU4A 4B85A 4GOKA 4H7HA 3IAHA 4RK5A 1P9LA 1G42A 4HXEB 1CQIB 5FH9A 2I4IA 1VJTA 2DTXA 3RTAA 1V5GA 3QA9A 3WGHA 4MDHA 1KQOA 3OX2A 1RI1A 4RADA 3LW8A 2FZGA 1YQQA 3W9BA 2PTHA 3KX2A 3UMCA 4Z51A 4O08A 4FBMA 1JEDA 1M34A 1PD1A 1UZUA 1Y81A 3L93A 3NYRA 4MWGA 4MYHA 3S1AB 3T12A 4DYDA 3ZGOA 4GPD1 4B4DA 2CFSA 2A0UA 3X43A 1PUXA 4AMGA 3OPMA 3AONB 1YOBA 3H97A 4JFRA 4DARA 4HO1X 3KXIA 4HNAB 3QVLA 3H2HA 4N7RA 1F1BA 4MWBA 3M49A 4DDMA 4P38A 2OCKA 4UJ5A 4E70A 3DVRX 2ATXA 1G5TA 3K2IA 1KQNA 3ADBA 5CX1B 4EMSA 3P45A 2GEKA 4FS8A 1UPBA 3DVAA 4LY0A 5AK4A 1NRIA 1RI5A 3EXIA 2OLJA 4Y1GA 2QAGA 2QD5A 1E4EB 3MF4A 3HKCB 1COZA 4KQ1A 1O6ZA 3TTTA 1G16A 2NYRA 2PUEA 2YBDA 1Z0ZA 4KQFA 1YS2X 3DZFA 3HUEA 3DKKA 3LDHA 5JSUA 2BMEA 2H1CA 2E6UX 3RAEC 1KMQA 1F7VA 1CJCA 3LHDA 1KJJA 3VSCA 4FLMA 2IPLA 3NRCA 5BT9A 3BIOA 3TUIC 8MHTA 4REQB 3G23A 4RTNA 1A1VA 4CF4A 3TINA 2MIIA 1CZUA 2Q4BA 1E0KA 2TMYA 3PGVA 4XR9A 5FI5A 4NF2A 3WBFA 1HFKA 4HUQB 2RB5A 3B82A 5A3JA 4WBNA 2QPLA 1ECLA 2Y1DA 4DB2A 5CXSA 1O6FA 4IGFA 4KJZA 1WUJS 2J48A 5H7XA 3T52A 1YJCA 3G2QA 1JEEA 3IILA 4RCZA 4OMDA 2UVQA 3K0AA 4KE6A 3EGDA 4B43A 5K8UA 3M1AA 1KAHA 2YNMC 5HEKA 1CYEA 1GNQA 4GKKB 2BBSA 1DQPA 2YHUA 4C4SA 5LKAA 2NU9A 4K6HA 1G8SA 1YR8A 1NJ8A 2QY6A 1DBWA 4NXMB 1J8FA 3PEUA 4E2XA 5BSFA 3GDOA 2B9VA 3O74A 1IHDA 1OPRA 3GNLA 1XEAA 3MT7A 1E20A 5GV8A 4UCFA 5JV5A 3I5YA 3VYUB 4TX1A 5DISB 2WZBA 2CHUA 1FVXA 2HNKA 3UJBA 1C0IA 1JDZA 4DMMA 4NX2A 3O03A 2O5EA 3DMNA 5JNRA 3G88A 5JBQA 3VBEA 3W6OA 2Y1WA 4TQUS 2I3DA 4EF5A 2ZUEA 2I8AA 4RY2A 1NQVA 1JFRA 2C84A 3BB4A 3N70A 1YVRA 5DW0A 2JG3A 5A5DA 4CIBA 3BKWA 3OSUA 4P4SA 5DRYA 1G59A 2BR4A 3F9IA 3EPPA 3L7BA 4UE3S 5HG0A 2QL9A 4G5YA 3CZPA 1NXWA 4P5DA 1KJ9A 2FZLA 4JT4A 1ISRA 3HFSA 1ONNA 3P7MA 5HF6A 5U1PA 4G63A 1M72A 2JZCA 4MV7A 3STTA 1QHHA 2WSSD 3E84A 4LIPD 1PJ3A 2J8ZA 1R6AA 2ZYRA 1EZ1A 4F6RB 2XIQA 1A2QA 2WSSA 5IZCA 1QAMA 1TW3A 4IQGA 3TB6A 2NNLD 4KN6A 4P7JA 4GC9A 4FTWA 5E8JA 5ICEA 4C7BA 4BLSA 2HYIC 2GO1A 3BICA 3SQXA 2FRVA 4DDWA 5A4FS 5B30A 4Z4HA 10MHA 3E9CA 4ZOQI 2OR3A 5LDDC 4UCXA 3R5FA 3D7NA 5IKMA 1UFOA 1XELA 2FFAA 5AW5A 1XMOB 1MZVA 1ZUNB 3HVHA 4TKZA 1O87A 2LCQA 5ECDA 1TJ4A 1C3EA 1GXSA 4HATA 1YF3A 3UT5A 1WPXA 3ZJ4A 4BB5A 1HE8B 1XEWY 2GEDA 1GTJ1 1ISPA 3JQFC 4AKEA 3TLMA 1XQXA 3ONEA 3UXMA 1U4SA 3CUYA 4BU1A 1N5KA 2ZT7A 4G9EA 1X3SA 1RU3A 2BKEA 2BJWA 2VEOA 4NU0A 4S2UA 5FWXB 5L53A 3D4OA 1LQTA 1RPNA 2WNIA 4O4LF 3F6RA 3ISTA 4Z0PA 2NNWB 2QGFA 2XRMA 4K8RB 5M29A 1QRDA 1T2AA 1Z4OA 2AJLI 4AO6A 4CR6A 1GARA 4N9WA 1HH4A 1FSZA 2CFRA 5JSQA 1UQTA 2AWOA 5LZ2A 3HHEA 2DB3A 3GLFA 2QLTA 1A4XA 3KRTA 3CRQA 4GF5A 2Q4EA 2ZYWX 3LC7O 3EIEA 2OVFA 2SNIE 1T9HA 2IV3A 2Y93A 3U1BA 2R47A 3Q3VA 1Z5VA 4ZREA 4S35A 4C03A 2YMQA 3H9BA 3S2YA 1ENZA 3IR5A 2WIDA 1GGFA 4N7BA 3TD2A 5KOJA 2C4UA 1II9A 2WJYA 2VTBB 1T43A 2QMEA 2ACVA 4TZ0A 4N1AA 3DMFA 4EBBA 2YQZA 4N7JA 4B75A 3EOZA 4I9GA 2ODWA 3ZWVA 1A5BB 2D3TA 1U04A 1KEPA 1FFWA 1C1HA 3UV3A 1SUIA 4OHPA 2FX5A 3ZCTA 1LH0A 3Q4GA 4CM9D 1A88A 4GPAA 4D45A 3OIYA 4AL4A 3I1YA 4PICA 5C46F 1IAVA 3KOYA 3OY7A 3QMWA 1LDNA 2QTLA 3R3VA 3QG1A 1H2AS 4ND8B 3DAYA 4BP9A 1ADJA 3TVTA 4U7FA 1PK9A 2MINB 3EZLA 2XUDA 1F5SA 3B9RA 3I4LA 1CP2A 4E5KA 2IUSA 4WY8A 1WY7A 2Z98A 1ZHOA 1ZVQA 5A4KA 3ZHCA 5C7YA 4PAOA 5E6UA 3CRNA 3PPXA 1RZRD 2P4HX 3IUQA 5HHTA 4IFIA 1DP4A 3RVMA 5F2NA 1HOTA 2MYPA 1RZRA 2COEA 3FLMA 1UWLA 2FRDC 5B1EA 1K9SA 1F2TB 3ICVA 4K88A 2DBQA 3MTQA 2NADA 1ECJA 2EGUA 4DLBA 2NU8A 1IULA 3R8CA 4CGYA 3NOQA 4ZMSA 1Z8DA 4D8XA 1CYDA 5FWYB 1LFDB 4WE3A 4A0QA 1RRCA 2CNLA 4W7SA 1N5MA 2HF7A 4AKTA 5LQAA 5EMHA 3NQ41 4KHZA 1XYVA 1P2BA 4B74A 3TAXA 1PKXA 2GN8A 1E4VA 1TZ2A 2C96A 2VH5R 4N7MA 3QKWA 4H4DA 4IOKA 5KREA 1N3LA 2Q3EA 1UODA 5KSZA 4B8ZA 1U9JA 5JS8A 2VK8A 5BVGA 4NJOA 2Q5OA 2Q3MA 3ENKA 3HEMA 1C1XB 3WKBA 3I2YX 1M5TA 3UWMA 5F73A 1JEJA 1VCMA 3CH7A 3KZCA 3PITA 2SCUA 1E3LA 2Q62A 3QE3A 4GQIA 4MS1B 4Q18A 5B7QA 2ZIEA 2Q46A 5IN4A 1UBSB 3AESA 1S3SA 4R9VA 5EYPB 2FMXA 3PV0A 4MV1A 1WMEA 4RHTA 1SOUA 2X0RA 5HQJA 4W9MC 4R31A 3A3NA 2BR5A 1JEQA 3DUFB 3H2KA 4AZ0B 3V97A 4BTEA 3S6JA 4KO1S 1CCWA 5FKJA 3RYHB 1QH8A 3D6VA 4GLLA 4I2NA 1C0EA 3ACCA 2VSOA 1SBQA 2DQSA 4KV9A 1RNLA 1XCOA 3D8TA 5BYKA 2V6FA 4EPRA 4TUYF 4QT4A 3NEPX 3NS7A 4LF6B 1FYVA 1HEUA 4OAPA 4RM3A 5AK3A 2WINI 1NYRA 2Q7XA 1X7WB 3FB4A 4NHOA 4B73A 5A3RA 4I36A 2JI9A 1XCBA 4WZBB 1J9EA 1KJ8A 2ZROA 4H17A 1R4NA 4KIWA 1CHNA 4R1OA 1WEHA 4TMZA 1AHNA 1U1CA 1RHQA 4B6GA 1Z33A 4Q4HA 4GXTA 3EAQA 2AOWA 2AJBA 1ML3A 1GG5A 5I45A 1TRKA 5KSPA 4MCHA 1VSUA 1UMKA 3TI7A 5HKKD 4A2WA 5KYXB 3UA3A 1NJ5A 1X9GA 2ZS7A 3GN1A 4RHYA 3ZWOA 5ULLA 3JYOA 3DAFA 5BY2A 5HKKA 2R60A 2IYXA 1WSWA 4LGCA 1ODTC 3TTXA 2PGIA 1OILA 5T4HA 3QHPA 5LBUA 5A9SB 4D4GA 1XMXA 5EVJA 4B3MB 2A1UB 3L0ZA 5FI3A 4LZOA 5DZSA 3KWMA 4NOMA 5TX7A 3L0PA 4BRUA 4ZDJA 2J3HA 3M89A 3DL0A 4E3WA 1TE2A 3RTGA 4PHFA 1Y9DA 5BN5A 1JG3A 3UFXA 3RHFA 1ORTA 2J9YB 2I34A 1EK5A 5FCDA 4MEAA 1ZOPA 2ZAMA 4PYJA 2VJYA 1WL8A 3C15C 3V32A 4F93B 1Y7HA 3Q9LA 5K3OA 2JIQA 2GF0A 1YFKA 4K26A 4IYRA 3B3FA 1H65A 1WA5A 3JQQA 3EWIA 1JHUA 1KVTA 4XD7D 4N0QA 4LPSA 1IBSA 3KXPA 4KRXA 4JGGA 1EG7A 3C14C 3N8IA 4XD7A 2QQGA 5F5NA 3TQCA 1SKYB 3SVZA 1OAOC 2XQVA 1FS6A 3T5GA 4DC1A 1AGRA 1FRZA 2IIPA 4O0LA 3S2EA 2G36A 1Z7EA 4UARA 5HPYB 3FPKA 5BR8B 4O2AB 4PZ9A 4WGGA 2VI5A 4UUQA 3BRCA 4CMHA 1Y0BA 2G4CA 4P33A 3GLHE 1B0PA 4UBNA 3OPYB 1VSVA 2J3KA 3O9VA 5AH0A 3VOAA 5KQLA 2BFAA 4R68A 4IUYA 2Z2JA 3KV3O 4GVLA 2P4UA 2FN8A 4KI0A 4ENUA 2I6TA 3OJLA 3QVTA 3TRKA 4A82A 2GN6A 2JHAA 3ZD7A 3N5CA 3CNNA 1Z6PA 2FPGA 2OHHA 2P6OA 4GSKA 3EA5A 1KZ1A 3FH0A 2R3SA 4PYLA 1X8XA 1N57A 1QPGA 1EXMA 1WHTB 4F9GA 1GZUA 4DZZA 2W90A 2Q6LA 4DQKA 4CRWB 1RM5A 5BSEA 2HQSA 1Z38A 4KRFA 2H2WA 2R8PA 2QRGA 3UUEA 3PFFA 5LUAA 3KYBA 4GOOD 5HM6A 2O8BA 1I2CA 3PUVA 5CTAA 3ZW8A 1SVWA 3TR0A 1Y8ZA 3FF4A 4Q02A 3T5PA 4LYYA 4PN7A 1ZIPA 2OKGA 1YFZA 4AW9A 1WUIS 5BORA 1CUWA 3MFQA 5F2EA 1U0JA 3GPBA 1TVKA 2QYHA 3DDHA 1G6OA 1KOJA 4YQEA 2BMWA 1RXCA 2OXRA 1ODLA 2HCJB 2QRLA 2X3FA 3C6MA 4AF8A 3ZHSA 2AQ8A 2C3MA 2QYTA 3WLNA 3IP7A 3V34A 1FDUA 4JQCA 4O4JA 1DVRA 3DEAA 1WG8A 1G41A 3JALB 4UMEA 4GYKA 4YH1A 2DT5A 2XUQA 5BNWA 3ORYA 1QPBA 2EJCA 4TRJA 2CE7A 1V1MB 4RPGA 3V1KA 2PJRA 2DMRA 4RE6A 4HVTA 2IHUA 4TZKA 4OYYA 3Q2OA 4CTNA 4LXGA 3OOEA 2Z1DA 3A1TA 3BFPA 4MQEA 3DW1X 3H3XA 2WM2A 1T2CA 5C3UA 2VDJA 1J99A 3B3QA 1Y8QB 1R0YA 1QBKC 2NU7A 2QN1A 3PJFA 1K0UA 4KYUA 2I3AA 3HLKA 2G0AA 4PRYA 4ZC8A 3U9LA 3C97A 1E69A 2YDYA 3WB0A 5JU6A 2EEZA 4WUTA 4EIWA 1NJ1A 3PNYA 2GM3A 5J23A 4I19A 2P9JA 4A1OA 4MI9A 1UC8A 1Y3AA 2E4WA 5B58T 1SHUX 1DB3A 4N54A 4EARA 5LIPA 3EASA 4UU7A 4DG9A 2IPXA 3CMMA 2B36A 2CMHA 1U0RA 1C3LA 2JHGA 4LWZA 1M2OB 1UDRA 1RLMA 1PR9A 4MPPA 1VFPA 3ORSA 5ITZB 1EP1B 2QMQA 5DWDA 2V9ZA 2D1SA 1M6VB 3I9V6 5KEIA 1DUSA 1OI4A 4M1KA 1MX3A 3RC7A 4LOHA 2RHGB 4XJXA 4E5NA 2VHZA 1BHO1 2J6IA 4FHCA 2C77A 1A96A 1E6WA 6ADHA 3FUVA 4JVSB 3RODA 1A5ZA 1TM5E 5KX5A 3EFHA 3IT2A 2FFHA 2A0XA 4JP5A 4F2HA 3C8HA 5KTRA 1X87A 1FYXA 3C1TA 1N7GA 2MSNA 2W6CX 2REQA 3KR0A 1XLTC 1XYYA 2I65A 4HDKB 1QP7A 1XK6A 4F4IA 4M1MA 4RY0A 4BMVA 2AJCA 3KKKA 4N40A 2WMOB 2H4WA 4XRRA 3SYNA 4TVSA 1JIVA 2HCTA 2P9FA 3N7TA 4NRDA 2MSLA 1K7CA 1O0SA 2CNOA 2Z1NA 2WV7A 3U44A 3JWGA 2J1LA 1V43A 3QSGA 5DGTA 4B8YA 3C1UA 4X8MA 5AJYA 1Y1QA 2MYTA 2YHIA 3PRKE 4AWAA 2LR0A 1ABFA 3KM0A 1X7XB 2O2SA 2QTRA 2VDWB 4UNIA 2YV2A 4H31A 4MV3A 4MP8A 4ZU1X 3FWNA 4XDHA 3V6LA 3DL4A 4KK4A 3ABRB 2BGGA 3C6QA 3JRXA 2AK3A 2PJUA 3L6UA 1Z5PA 5KAPA 2OB2A 3IE1A 1ZNQO 1YOVB 3KEMA 5IU6A 2PL5A 3NUZA 4C2TA 1QV9A 5I4IA 3RVQA 2FVXA 3PE6A 1E1QD 3UJDA 4JR2A 5G02A 3R3UA 4ZO8A 1OLUB 5I4CA 2G3YA 1FP6A 3E18A 4X92A 2HQ1A 4CLDA 3GP8A 1ZPDA 1V7CA 1E1QA 3ZTWA 1Q50A 2DJIA 3PVSA 2WJJA 1HSZA 1SR8A 3VR5D 3X1ZA 3H5NA 2HA0A 2QF7A 4MGYR 5AOVA 4BFUA 1X77A 5CNIA 3G82C 5C7OO 4YCNA 4MUKA 3VR5A 3SHFA 1W0JD 4M83A 3PGJA 2NVWA 3PIIA 1LLQA 4LC9A 3RT7A 5F7XA 2YX1A 4AJIA 3RU7A 1T9DA 1HURA 1W0JA 1E64A 3BWXA 4O33A 2NIPA 3SAJA 5LM3A 3DR5A 3LKZA 4OYRA 4W5OA 3FOFC 1RCUA 4K5QA 2WZDA 3WDMA 1LDGA 2FUKA 3DT6A 1D6JA 4YT2A 4KK3A 3IKMB 5H9VA 3BGIA 2Y27A 1ADFA 8ATCA 1EK0A 1EFLA 3ST7A 5FO0A 4MAMA 3ZDCA 2A0YA 4Q7KA 2OO3A 2NXWA 1M1ZA 1VG1A 3N0TA 4Q05A 4TTVA 5SYMA 4D81A 1W29A 4D8YA 1G2QA 4U3JA 2BYTA 2VC2B 2GCOB 2AZTA 1P4HA 2JLCA 3O4GA 5E4FA 3F9RA 2M1ZA 2OWEA 5AHRA 5BSMA 4EYSA 1E94E 1QIDA 4YROA 1R6VA 5BN4B 2DWPA 5EFZA 2C7GA 1B6SA 3AHFA 5GZ1A 3NVDA 1AUPA 5K0GA 4GPEA 4I6EA 3BJMA 3FNIA 2O54A 1Y3IA 5C35A 1HE5A 1N5OX 2ODPA 1RYHA 2RI1A 2YWGA 4ARUA 5BMVF 2XWJI 3S1SA 1O8CA 4KR2A 4KDCA 1W4LA 3IRUA 4CMKA 4GIBA 8GPBA 3HBMA 4EFLA 5DCUA 4DHWA 1FYEA 4HPJB 2NZWA 2Y4OA 3G0OA 2GBLC 4HB2A 4GD3Q 5CAEB 1FNSA 1AKMA 4O8CA 6GPBA 3GAMA 3PFBA 2LIVA 3B36A 4WFKA 3NIWA 4F7WA 2YFYA 4CM8A 5FPKA 1LBEA 3OZVA 1RRGA 3INYA 2R6AA 3PQ7A 1V16B 4JJ4A 4MYSA 3IVRA 4CMEC 1QV6A 4L28A 3Q0EA 4YJKA 1QIMA 2HJRA 4RC9A 4XPIA 2RGAA 4NCIA 1BO6A 3TR6A 5L7YA 1OJ7A 1QC5A 3LWZA 4C3VA 4A5OA 3TOZA 4YO7A 4N8SA 2HCRA 2GHIA 4M53A 4ND5A 3E5RA 3KLBA 4RL6A 2YICA 1J7JA 4OIMA 2BCJQ 3SIPA 1Q6ZA 5HYVA 3IKLA 3RE1A 3BTVA 2F1IA 1UPCA 2ZIXB 3OECA 3HKEA 1P1FA 1ZUWA 5EERA 2IQ5A 5JEDA 1NBMD 3PUJA 4ZOAA 4EQZA 2JVKA 1IZ7A 5LYJB 1NBMA 2DFDA 3D54D 3DPIA 1W8IA 1K3FA 4ARSA 3LK7A 1O3YA 4I4LA 2XWQA 3QLVA 1NVVQ 4WZAB 1X7HA 4WKOA 3ZDFA 1DEHA 5CNMA 3GFTA 4YRTA 4DC0A 2ZG6A 5IXSA 3T7EA 1YZNA 1RRPA 4QJ4A 4RV5A 3CR3C 2H2DA 3C70A 5HVNA 2IS4A 1E2JA 4GW3A 1Y7PA 1GAJA 1Y80A 2BM9A 3JARA 1EFAA 3EGOA 3RSLA 2GZAA 1T4BA 2I33A 4JASB 1W59A 2YXLA 1PTJC 1BAPA 4IIYA 4XM1A 1FFHA 3AY7A 3LI2A 4XSGA 4YECA 3HKBB 3UHPA 5IUNC 1KE1A 1JB1A 2RK6A 1DS6A 3WZLA 1C3JA 4WOBA 3QRWA 3U80A 4LV5B 2QXUA 3KNZA 3FYUA 3W5UA 2QM7A 3VPDA 1WVIA 1T2FA 5FNVA 1GUDA 2IQIA 1NT2A 2ZJOA 4HZUA 2B8EA 4RHEA 2H0RA 4BY9E 4Y2UA 3VDRA 1YJBA 1ZH4A 1QG4A 1NLMA 1XMJA 4OATA 4Q6BA 4WLUA 1CXZA 1QB8A 5EJEA 3IJPA 1O6CA 3PSAA 1Z5OA 1EZZA 3IC5A 1BCSA 3VGPA 3OLQA 5J4LA 3SE0A 3IJRA 5AMXA 3CVOA 5EHIA 3T94A 5F7ZA 5E0OA 2TYSB 3GG2A 3GWZA 4LXQA 3RSQA 2PZ8A 2DZDA 3AJRA 3ND7A 3O5AA 2X8WA 4CLRA 1G7SA 1C0LA 4OQPA 2GVNA 5L3VA 3KALA 4QO8A 5ALWA 4KW7A 2WHEA 2AD5A 1M7BA 3EQ8A 2HW8A 4HGRA 4L1KA 3RD5A 3M5CA 3SZRA 3VVMA 3DL2A 4MUGA 3CEHA 4OI4A 3D9QX 2KS6A 3EHEA 3L7DA 3MHPA 1DCKA 3PDWA 4LEIA 3ROFA 1MV8A 4Y8VA 2DOKA 4DM4A 4M9ZA 1HY3A 1K8YB 3O1JC 4INPA 5A4AA 4B3FX 5HF8A 5J63A 3RSGA 4ZO9A 2O2YA 4JLPA 1WV1A 2HXGA 2WEKA 2YFQA 4BV2A 1MBZA 2HSJA 2K87A 1YMUA 1JQKA 1PFUA 2G06A 3KDPA 3Q3CA 4IAOA 5DLDA 4N3CA 3JATA 1KSGA 3AFIA 3D7KA 4HAVA 3TAHA 3ZWKA 2IHTA 4WX2B 3KLOA 4X1KB 5T3YA 3WWPA 3IPLA 2X19A 1KEWA 2P2DA 3NPAA 2XMGA 4OQZA 4UQPA 1JBQA 2FGJA 2WTEA 1HDOA 3T95A 5JNTA 4C6TB 1L5HB 2WWVD 2GN1A 4DSOA 2C2MA 1U0HC 5I5GA 4MW4A 1Q74A 1RLUA 1BTOA 1ODSA 2VHTA 3C3EA 2B2NA 2UVPB 2Y1KA 4XWAA 3WOVA 4GKJB 1AXEA 2PPVA 2XJ9A 4FWIB 4X7MA 2IWRA 3OLWA 3LLUA 1EVIA 3M6IA 3QU4A 1WP4A 2CN1A 2O1EA 4E5MA 4ZRMA 2ZAIA 3UJCA 2AJ8A 4O2BF 3K6SB 1YFJA 2ZRNA 1WJGA 3CLSD 3DZCA 4S1WA 1YGPA 3O4FA 4EUFA 4MVXA 2DQYA 3ZVLA 3EXEA 1E1LA 3IUPA 4M0DA 3AHDA 4HLUA 1XDGA 4OB7A 2AHRA 5EXPA 4FNOA 4BUZA 2X9QA 5BYAA 2GNAA 4JX9A 4QIHA 3JVVA 3DFZA 4QBGB 1V3VA 4QTYA 2UZ0A 4ALJA 2PGJA 3JTEA 3T3GA 3QBTA 3CSSA 4O8ZA 1XQ6A 2A9VA 1C29B 3LK6A 2XLCA 5F5LA 2BKUA 1TA4A 4KMMA 3H9EO 2QX9A 5EJ4A 3CW2A 2AVNA 1U2PA 1HX7A 4WEOA 3LL4A 4EECA 3T1TA 3D2BA 3WGMA 2Z6AA 2P2ZA 2QE6A 3A9VA 1NE2A 4JLMA 2ZPAA 3RJTA 2BMVA 1B4DA 3MS2A 4H6XA 2H92A 1RAHA 3EISA 4PZDA 4YAFA 4CE6A 1NN5A 1U11A 3I6BA 1I4LD 3QY9A 3QUAA 4G5HA 4PC1A 2AE1A 3AF3A 1XA0A 1YB5A 4OXKA 4RULA 3T99A 2J6CA 1FSPA 1HPLA 2JKYA 2H1LA 4KPUB 3HKDB 4G09A 3CZ9A 3R4CA 3T7DA 1RM3A 4PXSA 2O8FA 3QKUA 4X7PA 4L9AA 4EJFA 1E5TA 2F1OA 2JH8A 4BNYA 5AVQA 4QYTA 5JJCA 2MDTA 1YGYA 3DV2A 3GEIA 3OZIA 3WMWA 1GAEO 2FW8A 1VHTA 5DNVA 3OP4A 3DBLA 4D9JA 2IYQA 4XM0A 2ZUSA 1RAFA 5K05A 3AWDA 3HSKA 2BGUA 4HAIA 3AL3A 5AJWA 3SJZA 2QD3A 3EGIA 1LLUA 5BSKA 1KWKA 4P36A 1LNQA 4C5CA 2XKJE 5CXUA 1DLIA 2O23A 1MNAA 4JB8A 4W8GA 5JMOA 3OPYI 5G1OA 3HYLA 1TAQA 3DC7A 1ZD2P 3OQHA 2AFHB 2JFQA 3ZZ0A 4LRWA 4PLVA 1VMEA 2XX3A 1ISJA 1WO8A 4EWLA 1EUDB 1XCGB 1IVYA 2YVQA 1FPQA 4B4OA 3QU2A 4MR7A 5K3FA 3SXJA 4BAUA 2CZQA 3DOFA 3A4YA 4OSOA 4UEOA 3ZDXB 2CVHA 1W5SA 2CD7A 1D2HA 5IZCC 4QODA 5CP8A 3RC3A 2EJBA 3HUTA 1R6BX 2C3OA 2Q8PA 3KP1A 1JLHA 3NCHA 5AVTA 1TAHA 1I8TA 4HGNA 3AIIA 4K2AA 2IPNA 1ULHA 2EYUA 3MJHA 3PUIA 4OHWA 4D9MA 1MVLA 1IPEA 1QH0A 3TD6A 1G5FA 3GCWA 3U40A 3TL3A 3PI7A 3T4PA 4DA7A 4EENA 3I6IA 4YJHA 3F3MA 1I5OA 1OB2A 1EQUA 4JENA 1XCPA 4L08A 4BN0A 1KU0A 3UEOA 4B1FA 1MNQA 4DYHA 1AB6A 5IJ0B 5JHGB 1D0VA 3NOOA 5EZSA 3CX4A 5DNCA 1GPLA 2XDQB 2MSEB 3EDMA 3EZYA 4MQFA 4NZMA 3SKVA 3TCKA 9ATCA 2J3DA 2ZBPA 3FI0A 2W2VA 3JWJA 1WR8A 1BXGA 1V4VA 2CXQA 2I80A 3JQ9A 3W9YA 3WX0A 1SZPA 1JALA 3O1IC 1NV9A 5D5PA 1GEGA 4JLUA 2QRQA 3SBOA 5A2GA 1YZFA 5DGHA 3SFTA 3FM9A 1PWXA 1ZVJA 1QZUA 3L40A 5F9HA 4JOCA 1XEXA 5ICGA 4YQZA 1XPRA 4C88A 1MTOA 4HQRA 4G5SA 2IEAA 1ADGA 4YAOA 4OFXA 1X1AA 4MV9A 1J1UA 5HJ2A 2QVXX 2C95A 1A98A 3F97A 3LXRA 4P84A 3EBLA 3O47A 3RV3A 3Q3HA 3QNUA 1ONPA 3ZHBA 4C0LA 2R0QC 2GN9A 5PNTA 4JSRA 5KDDA 1C1DB 5CA1B 2HNBA 4FZJA 3I2JA 4ME6A 3R7AA 3PVCA 5LLTA 1BEZA 2ZE6A 3JS5A 1LXCA 1FDVA 3OZUA 1CEYA 3VFDA 3I6QA 3PQ6A 2H65A 4ZVPA 3F78A 2X5JO 4UEWA 4E22A 3NV9A 4QXMA 1E1RD 1S0UA 1DWOA 2G04A 4RACA 4WCDA 2CJYA 4Y2RA 2QTMA 4BKOA 5KO2A 4FE3A 1E1RA 3CEJA 1IXZA 5JC8A 5KVSA 2A0KA 2FFJA 3P0IA 4C0SA 1LJLA 3L3BA 4FB5A 3GLIE 5HTKA 4FMDB 1DKLA 3ECSA 2W37A 3R3WA 1BX3A 2UDPA 3N2GB 4MUMA 3H7IA 2PD6A 2X1LA 3ZV6A 3ER8A 4JAVC 3LGAA 3ZXYA 1Q57A 1UIRA 4EPXA 4O4IF 1QSGA 1AKEA 5KCZA 3S5UA 1JNYA 2DHRA 2O3TA 4HAUA 4OIFA 1KY3A 4LZWA 1WB4A 2PU7A 1JR4A 4QBIA 2PGLA 4BNMA 5FUWA 4EEZA 3SLKA 2VZ8A 1ZO8A 2RGGA 3DLCA 2GZ3A 2XQJA 5DI9A 4K6CA 3EXHA 3CH5A 2VPXA 5IYZA 1G8PA 4A03A 3PA6A 3HS3A 5EZYB 3VAAA 4C0JA 2LRHA 4LX8A 2QN9A 1IRXA 4FXPA 4MJXA 4N3AA 1DEXA 4NHEA 1GWNA 2J33A 4BVFA 2I2CA 1P1KA 1XTIA 3PS9A 2IUEA 4BB9A 3WKDA 4TLMB 2HWYA 3CLUD 1A8UA 1XYGA 3ENZA 2O7SA 1DO0A 2CDRA 1MC5A 1V45E 4A2PA 2IBTA 3IULA 3WK8A 5TPZD 1Z0KA 2Q50A 5JTUA 2DRIA 3OICA 5TXGA 3U16A 2Q41A 3H9GA 3KZ1E 1OBVA 4NG5A 3ZD8A 5HIIA 3TBKA 4Q4JB 4DNQA 2JIBA 5DE3A 3R7LA 1GR0A 1RXUA 2HHCA 4PHTA 4WY2A 5DRTA 3WLLA 3JRNA 2Y4NA 5JXGA 1GQYA 1R0RE 1M0WA 1GT91 2AE2A 5TQ0A 4XVRA 3WIUA 2BRUA 2C4VA 4PS1A 4KLCA 5H4GA 1RQGA 2QN8A 1IK6A 2ZIFA 3QXGA 2WQZA 3ZW7A 3QKSA 2UUPA 1NULA 5ILGA 2YUTA 4ZHQF 4YCJA 5K2OA 4ERXA 2RI6A 3EGWA 4G01B 3BDVA 4OY3A 3JWHA 3DDZX 4LJ9A 1IN1A 5KMGA 5B3KA 4LXUA 2BSAA 5EMMA 2RGUA 4IW3B 3L0BA 5EN4A 1Z36A 1W93A 2Q3FA 3S27A 1M67A 4OFWA 4Y7DA 3RARA 1Y8RA 5CLLA 1KMCA 1NXVA 2DH6A 4KLAA 5K0LA 1ID8A 1PYDA 2XYVA 2B6NA 3PCXA 1TO6A 3VX4A 1CW2B 3PEVA 4D99A 4F5YA 1YZ3A 3HU5A 4MO9A 1UT5A 3HXTA 3QUBA 5DYGA 4A3SA 2Z57A 4TLEA 4QGSA 2W6NA 2A78A 3V3KA 4LI3X 4J16A 1YTLA 2WAAA 1GA1A 3JQAB 4FFBB 3QG5A 4PSUA 4U6NA 5G40A 3EDRA 4B6OA 1EESA 4GBGA 4OREX 5EJGA 3GK3A 4O2RA 1M83A 2C2OA 4TXHA 4N4AA 4HPWA 1FCJA 2V7VA 4M7WA 3UC5A 1XN1A 1N25A 1PO7A 5AOBA 3ZHOA 4KPGA 1QYRA 3HPRA 3F90A 4LXHA 2DHEA 2PKQO 2ZTSA 3ETHA 4GT1A 5HCUA 3TXYA 3Q10A 1KO7A 5WRFA 1XO1A 1UWVA 1NMSA 4L5JA 2HIHA 3IE2A 3SZOA 2YRFA 1Q19A 2QV0A 4OP2A 5MN4A 3QEBZ 3LT1A 1EXDA 1O5TA 1SBZA 3BTUA 1SQFA 3ID6C 5ER6A 4YR9A 3LX4A 1IUKA 3PQ3A 4TXMA 1XDWA 5JDIA 4M89A 2NV0A 3D8BA 4QE3A 4UPDA 3X3HA 4EI7A 1OFIA 1HNZB 3ROQA 1Z6ZA 1JIQA 4MW7A 4M1WA 4JITA 5KOYA 1DDIA 1RVV1 1AKYA 1GILA 2IHVA 3CX6A 1SIOA 4QUBA 5DHUA 1RKQA 1Z6QA 3VNVA 2KLHA 1H3EA 1AQJA 3ZBQA 4G4GA 2OC4A 4OUDA 4WZZA 3UJ8A 1C8LA 1PIWA 2V7XA 3IDQA 1VE3A 3F0TA 4H60A 4KVGA 1VKZA 4LZPA 4F4UA 1N0VC 1JKJB 2OZLA 3L8YA 2MYUA 3ONVA 3ZNNA 3QUSA 4X6LA 1NXPA 1IXRC 3IDOA 3TLAA 2NXJA 4TM7A 1I7QB 2Z6QA 4ZKEA 4RJTA 1G21B 3NJ8A 2WF7A 4BO9A 1IZYA 3BWMA 2OZEA 4LNUB 4PVCA 2XRFA 1EA7A 3GZ4A 1U3UA 1E2DA 3FFTA 3LUCA 1OX4A 2CUZA 3OO0A 1NNLA 3E0QA 3UAWA 2D4AA 1QFJA 2V1XA 3MMNA 3ZBPA 1VIVA 3GZJA 3PSHA 4KG7A 3T7IA 4PNEA 5HFAA 2NX2A 2B92A 1TZMA 2ZIZA 2NP7A 4DHEA 1O2DA 3TUZC 3U56A 2QTTA 5F1YA 1Q77A 3R0IA 3WP0A 2I91A 2XXAA 1U8AA 3KQNA 3LG2A 2GD0A 3W8RA 3SDBA 4UVDA 2FOXA 3KLNA 2B20A 3E7FA 4M9CA 1X19A 3QUCA 4F5DA 4GX1A 4QGBA 2GN4A 2WU8A 4Q21A 1NQTA 3TO5A 4ZZ0A 4PZYA 4DEVA 4CL2A 2WD7B 2IU6A 5LQUA 4LG1A 2OGSA 3B1FA 1YR7A 3A3OA 4HYTA 2O0MA 4RQUA 1UXGA 5I7UA 1Z6XA 1GFWA 3GDWA 3P9ZA 4R6WA 3ZHUA 5B6PA 1QHNA 3WQBA 1YKFA 1OLSA 3PRJA 3VOBA 4KUGA 2FY8A 1QRSA 3IE0A 5E9JA 5CBKA 4L5AA 1Q0SA 1H0SA 3Q6MA 3KLPX 4IDAA 1QQ5A 3UH0A 2WWGA 3RTEA 1ODIA 5CB4B 1D6MA 2AFIB 2BKVA 3ILSA 4ND7A 1II0A 1OXVA 3LZDA 1V6AA 1XRRA 2WP0A 1CQJB 3I3OA 4AS3A 1OBCA 3C6YA 3KSDO 3QI2A 3AHHA 1HT2E 1BA3A 3O3OB 1A95A 1KJNA 2WOJA 3AP2A 4XXHA 5KTPA 2I4TA 1PEAA 4ZOLB 1XQ9A 1GRVA 1ZKDA 2I2DA 4M9SA 4Q82A 1T1RA 2IDJA 4M54A 4LMRA 2AUNA 3T38A 4AO7A 5JZVA 2OFXA 2G28A 3IXQA 3FRHA 4MS4A 4QULA 5FOWA 3CW8X 3ZU2A 3HLYA 2IGTA 2IHYA 2ZSAA 5GONA 2P6NA 5JQGF 1ESEA 5GIPE 4NPCA 1B15A 4YMGA 2UUAB 4RHCA 1CUAA 1M1YB 4MKRA 4ABTA 1RAIA 1RWQA 2ZVQX 3FMFA 4F4FA 1JA9A 3F2VA 3DNFA 4ZCLA 1A04A 1YXMA 3KEOA 2VCHA 2WIAA 3MLAA 1EJ2A 2ODTX 3ZW9A 4XIYA 4IXNA 3FWZA 2HOQA 4FFDA 3EEYA 8AT1A 5LP6A 1KI6A 1CULC 2IIVA 2R65A 5EWJB 4P34A 4YDHB 3AY6A 3FTNA 2FZKA 1EP3B 1V7ZA 2J85A 2G76A 3IAUA 3QE4A 4XGIA 3RYFB 3Q7IA 1AH2A 5GY7A 1VG0B 3DTTA 4JJKA 4FD3A 4JLVA 4MYRA 4G36A 5FNZA 3GXOA 2WJIA 1FUYB 1NZDA 3E48A 4KLZA 3T1YB 5CT6A 5IAKA 4B87A 2JAOA 4HWRA 2C5GA 2P6UA 3L41A 3PKJA 4H3SA 3RTCA 2Q29A 4E15A 4Q3LA 2NN3C 4ZKDA 1JJ7A 2WU4A 4X9XA 2JGLA 4TYPA 2NAFA 3IAAA 2J9GA 4TYQA 2VQDA 3DBRB 3CJQA 3HO8A 3LV8A 2IXFA 4KGXA 4Z86A 4UXIA 1KVQA 4I4TA 3E8MA 1E5XA 2GERA 1FJXA 4OXQA 4DMGA 1BW9A 2AOTB 1X7YA 5K0FA 1V6CA 3DDNA 2C3YA 1SHTX 1R6XA 2X7HA 3GELA 1VPVA 4AD8A 2IP2A 1XEFA 2JCYA 3WKAA 5CNKA 5F77A 3DHVA 4N6OA 4EYGA 3H05A 2J4DA 5ALMA 4HLDA 4BFLA 5COQA 2RHHA 1HLFA 1Y89A 3NNDA 2QAIA 5UKDA 2OORA 2WKSA 3IMEA 1JHQA 4NESA 2IBSA 2C8KA 2X0EA 1J49A 3M3HA 5TEWA 4QHTA 3UUWA 4UAVA 1KY4A 3WNCA 3K6RA 1GPJA 1W9HA 2GJAA 1KOFA 5B58C 2WIFA 4YCDA 4MICA 3MTAA 5JJBA 1U5BB 3WQHA 5C1PA 3P94A 2C7VA 1WB6A 3NTQA 1YQDA 3MCAA 3UKJA 1FNNA 3VKFA 2EF1A 3IIIA 5FOSA 4UBIA 5BQFA 1B23P 2C97A 5IT0A 3ZNPA 3BGSA 3GRPA 4O4HA 2Q3LA 4GECA 5A9RA 4IIBA 5KAMA 2GYVA 4US2R 1BWPA 3CUVA 3QLJA 1N0WA 3A8TA 4QXOA 4M0LA 4IGAA 4UVGA 2GCNA 2NXCA 2BUCA 3DE4X 3DE2X 4CM9A 3KQUA 3DE7X 1I6MA 4LYEA 3TZBA 3JD3A 3NDBB 4B34A 5ALVA 1A2OA 1IN8A 1EA5A 3H2BA 1LBQA 4WOPA 4ZP1A 1QFSA 1XP8A 1DC3A 4KVZA 2QU8A 3L0DA 1QMPA 1Y6FA 2RH8A 3LP8A 4QL3A 1FFDA 4LDQA 4J4BA 1E92A 1LS1A 3RAGA 1HLDA 3Q0IA 3QU7A 4J6EA 4DE5A 4MDYA 5C8VA 1WZIA 3MBIA 4CQLA 1XCMA 2BI8A 3KQHA 3E82A 3LPCA 3A11A 2PO5A 2GD6A 1ZW1A 3JX9A 3BMQB 4C0KA 2G1AA 1LI5A 1JG6A 3CT6A 3QWBA 2R8RA 3FRIA 3TLJA 3X0DA 5F98A 2ZJAA 3FYSA 3OU7A 1T8WA 3OFKA 3W3AH 1FJGB 1UQRA 4PHHA 3B8EA 4JZKA 1SCJA 2V6GA 4CQJA 1TEVA 1M3SA 2WT9A 3B1ZA 1VJ1A 3FYHA 3KQWA 4UCWA 5DI3B 3GZNB 1WRBA 1MX9A 2C0QA 2FFQA 1JAXA 1C9YA 3IUSA 3CBGA 4EMBA 5D3MB 1D7OA 2D5LA 1B73A 1TUIA 3BC1A 3ZC3A 2B2CA 2ZJFA 4YIHA 4CKYA 1TYDE 1JHYA 1VJ0A 2ET6A 4PCUA 2G9NA 5ITVA 5LD2B 2NQTA 3C4QA 3KQSA 1T8YA 4IJVA 1VFNA 3CEMA 1JLRA 1MVOA 2Q4RA 3EXFA 4GNKA 4N5DA 4ZGBA 1Z0FA 1O89A 3L8MA 1CUCA 4C21A 2BONA 2C42A 1RP1A 2Z2YA 2ZYTX 1HOXA 1KZGB 2NM0A 2QW0X 4IIJA 1SGWA 4GM1A 5EKSA 3MUFA 4PZCA 4BLVA 1AG9A 4BNIA 1Q1NA 1WVGA 3UAGA 1PR2A 3I5MA 3GA5A 3L6EA 1HYEA 1UZMA 1Z22A 2GSDA 3MBKA 4IYJA 1GUAA 4CG2A 4BEBA 4EG5A 4DLRA 3LXUX 1ZD1A 1QE0A 1DWUA 5JC1A 1EH5A 3WTCA 5EPUA 1SXJB 2IRWA 2HT1A 1XKQA 1FTYA 4ML3A 4AUEA 1F8UA 2O2XA 3SC2B 1KS2A 5F33A 4F60A 3K70B 1PQYA 1DPGA 4B3IA 2Q9AA 3CZRA 5EIAA 4YP1A 4WUVA 4NWIA 4F9FA 3O3MB 1HEYA 2IXBA 2R7NA 3GU3A 2EGHA 3CG4A 4TV8F 3CIOA 2FXVA 3N8NA 5ES4B 3TIVA 2XT6A 3WO1A 1M6HA 2V3VA 4ZA2A 1FP7A 1BE1A 1GYQA 4BAGA 2WY2D 2FQQA 2ZT6A 5DX1A 5HZMA 1FNMA 1HETA 2FZCA 3MJDA 3OZTA 3OTQA 1I7DA 3RIGA 2DECA 1NKSA 4LMBA 4MIYA 1VG8A 1D8AA 2PYDA 1BJKA 3BIWA 1NC3A 3CEPB 3DOJA 3QP9A 4J2OA 3NBUA 2X5XA 3RS4A 1WW3A 4TMYA 1CE8A 2BE9A 3I01M 1KL7A 2PNFA 2X8AA 3IQZA 1MOQA 4Q1DA 4J0CA 1BQ4A 5GINE 3BREA 4OJQA 3NUQA 4AK9A 3T1QA 5HKOA 1XMIA 4LZJA 5JS7A 4S05A 1DFIA 1R6TA 4ZV9A 1PW5A 2H4JA 3QLVC 1YS7A 3U1VA 2ZB4A 4KQHA 4IF6A 1GQRA 5I7EA 2B1IA 3WLHA 4OPMA 3NXSA 4I9NA 2F1JA 1N7IA 3RFCA 5JNLA 2ZJ8A 4LHXA 1NWHA 4FVTA 3RWMB 3UJHA 1G6Q1 3IBYA 4C29A 1C14A 2PY6A 1P5RA 1TJPB 3FMGA 4DCSA 1V6SA 1BJTA 5TT0A 4BEVA 3FUWA 2EWMA 5A7HA 3T7CA 3F6BX 4WH0A 2OGTA 1L5OA 3TZKA 4B40A 5KYYB 3P9NA 1DAKA 5DK4A 2EQ5A 4AMVA 1NOKA 4PW0A 4AY2A 4HFRA 4QJIA 1L4MA 1KF0A 3SZMA 3FYUC 3HR7A 2Q99A 2FR0A 3DS8A 2PMWB 2W00A 5AM1A 3RT9A 3B53X 1AMUA 3GQBA 2RC6A 1SRRA 5AJZA 5EP1A 3CGGA 4UTRA 1TL7C 1J42A 3DZBA 4P2BA 4GL2A 4WPGA 4ZQGA 1Q15A 4MB6A 3IIMA 4QWMA 4Q47A 4RJLA 2NV6A 2W0MA 2J3JA 1FP1D 3LHSA 3FPJA 4CFSA 4Q1EA 3P9YA 1U3GA 1GNPA 1GCGA 1SCDA 3DOOA 1VHLA 1YVEI 1NVMB 1JHMA 1WWKA 2AXQA 2IZ6A 3GDGA 1UJMA 3PC8A 4U7GA 4DIBA 1Q2UA 5CJ2A 4DPMA 3L7YA 3AQ4A 1QF9A 1Z6AA 2GARA 2CNDA 2ORVA 3NU1A 4WZBE 2IV7A 3UATA 1N34B 1V26A 2IS2A 1OT5A 4DPLA 2HZBA 4GRDA 1B26A 2X0IA 1A2KC 1DELA 2FSPA 2B61A 2XVZA 3OC6A 4DBZA 3NYQA 4MGZR 1TJNA 1NDUA 2G70A 1YK0A 4X1YA 3WHKA 1U2SA 1GPAA 4EJ6A 3HJCA 5EJ2A 5TEVA 5JVDF 1ORVA 3T1HB 4IH1A 1F14A 4GMFA 1L1EA 4M7RA 2PLFA 4TRNA 4DR5B 5LVAA 3VJMA 4CKBA 4D6XA 2HA2A 1D09A 4DPKA 3CUEF 2I87A 1LDMA 2HMUA 4EI8A 3WLOA 2GKGA 1H05A 3L1JA 3L0SA 5EIBD 4QYSA 4RVCA 5L40A 2O0JA 4D8WA 2AOUB 1SB9A 3G0CA 3I32A 3NBXX 3D0QA 2XXBA 4D3DA 3BQMB 3ZWWA 1A9TA 3LGSA 3IEIA 4DSAA 4B3RB 2QJTA 5CM9C 1J23A 2GAJA 4QTTB 3ER6A 1MT0A 3LUBA 1UFKA 1UBTS 5BT8A 4MUBA 3IQXA 4U2FA 1WULS 4ENRA 3KBOA 3T9AA 2J0QA 3MWFA 4BV3A 1VIDA 1YA4A 2JIOA 3O4RA 2QQ0A 5P21A 4BQEA 3HCRA 3WGYA 2FP4A 3M4XA 3UUGA 3W7AA 1WXDA 2RHMA 3BWCA 1U7OA 4J0FA 3QF4B 4UXJA 3WWCA 5ESWA 4FYMA 2GDZA 5FOTA 1IDN1 4D5GA 3R0JA 4NAUA 1QQAA 2G72A 2FH5B 1R6UA 4HLUC 3CLSC 2PMFA 3QQPA 1SKYE 2NP6A 2HN9A 2CDBA 4JOBA 4A6DA 1CTQA 1T1GA 3HU2A 4PPNA 4NOKA 3E4CA 3GT0A 3I42A 4MVCA 3KQLA 1HTBA 1ZU4A 221PA 2XYHA 4UQOA 2I9KA 1M9NA 4OQLA 2VJLA 3AERA 1HFJA 2X58A 4EVIA 1JU3A 3K9WA 1RLOA 3O8BA 1R88A 1UKVY 2HMTA 3AG6A 3TLKA 3KOWA 1PZGA 1F2UB 3CKMA 4BKMA 4BKPA 4EG1A 4TLAA 4DT1A 5A02A 1EQAA 3SNHA 3WMEA 5ADVA 4W1PA 5KJEA 2X22A 4JEUA 1KBOA 1NF2A 4MVJI 3QEOA 1N75A 1HM5A 2I99A 4LHEA 4Y2HA 3AKYA 5EMNA 1NI5A 5K4GA 1P2GA 4OLBA 3OMLA 2C5BA 1PHPA 4EPYA 4C4YA 6NULA 2QWXA 2BEKA 2K4MA 2G1PA 2SKDA 4NMXB 2YV1A 1GNTA 1Z07A 2BFWA 3GEPA 5MGBA 1T2DA 1YBVA 4I3HA 2FPIA 4BOYA 4Q4LA 4HTFA 1QTRA 1IWBB 2BP7B 3TDNA 1PWHA 4RSGA 1Y1RA 2J9FA 2V58A 4F12A 4WNCA 5KJFA 2FCAA 3DHWC 4I66A 1HDCA 3AF0A 2BKLA 4GGPA 4LDNA 3NHSA 2JGIA 4FFPA 2ZW9A 3V4SA 4GOND 4A6PA 3FAZA 4BP8A 2QDXA 1HQCA 3ZH2A 1IXKA 5EUMA 3P19A 3AETB 1HZJA 2Y76A 4GZ5A 3L82B 1RWBA 4KN8A 1RE0A 2CLOB 3I9OA 5CVDA 2Q2OA 3K0HA 2FMTA 4AWBA 3W5IA 3V7FA 2J0UA 4LXIA 3O8QA 1IN7A 4IIGA 5IKOA 4F4JA 1KC3A 2NO6A 4GNRA 2JGNA 3K2EA 4HH1A 5J4KA 5BSHA 2X6QA 2C2GA 1UUFA 4FWTA 1NXTA 1Q7BA 3CISA 3VVBA 1QYIA 3IQFA 3WHPA 4GOXA 1R66A 4PAGA 1K4YA 5FBLB 4PSKA 5KTTA 5IKXA 1POXA 4BZZA 3OTWA 1G20B 2AG1A 3W5AA 3CZCA 2WHQA 1Y4SA 3KVVA 3N2YA 3EIQA 1FDTA 3G2NA 1SG6A 1UBMS 1OQAA 4JU8A 4KR9A 2BMJA 1F20A 4X64B 1T29A 3C16C 2QJOA 4TV9A 2DYKA 2I29A 5FWNA 5CA0A 5GVSA 5KS2A 1JJBA 1YV9A 2PX2A 3I9LA 1ZONA 4IX9A 2Q7DA 3TJRA 3V2HA 2VF7A 3JR7A 3AUYA 2BV3A 4LYGA 3HN2A 3U7JA 3GCZA 1T36B 4YRIA 3OTHA 3WMFA 4J76A 2BGTA 4FX5A 3SR0A 2ZS8A 4LOIA 2PU5A 3FJOA 2NXEA 2PV7A 5HQ3A 3A37A 1J8QA 2ZRAA 4ZN6A 4YAGA 4FOPA 2XCTB 2WPNA 2QV7A 3FUCA 1KPIA 3JQ9C 4NCBA 2D54A 1L4HA 1WDWB 4WBNF 4BP1A 4AKGA 4IQ8A 3FOEC 1WNTA 1X13A 3OLYA 2NAPA 4LBVA 2O2JA 2R84A 3IFSA 4JCOA 3H7AA 2BFNA 1B3RA 2BTQB 3A70A 3ETEA 4EGQA 2C9CA 3IQDB 4ZFNA 2QPOA 4E14A 3I76A 2RK3A 3DE5X 3RS2A 4YAUA 4ZVUA 4ZQCB 3G8AA 3L79A 3K71B 1LPAB 2WFLB 4DB4A 1UK6A 2M98A 1H8ED 1NBHA 1DCFA 3AZPA 4RPKA 4DV1B 2ZAOA 3KPVA 4IPTA 5TARA 2VF8A 1JKIA 3BXZA 1H8EA 4MX8A 5ESXA 5HJ7A 4L5IA 2C2BA 4WWHA 1MGPA 3TQQA 5HE8A 1YZGA 2NSLA 2ZWIA 4MK4A 4PHGA 1XZMA 1J2RA 5BSRA 4JLBA 4BGDA 1H2HA 1KZYC 3B1JA 3DTNA 1N0UA 4C4AA 2F8MA 2R6HA 3JD2A 1KYTA 3ILYA 3R9WA 1E2LA 2DPGA 1V47A 3QVXA 3ANTA 1MLDA 1R15A 4HBGA 4L6AA 5E1OA 3IR6A 5FA5A 1XZLA 4BFVA 5KJ1A 1QZ3A 1ZUD1 1H2WA 1EB8A 2CMDA 2L69A 2OV1A 5CVJA 1LS6A 1YI1A 5J2TA 1NVBA 1QG2A 4KC0A 1QHXA 3KWLA 1Q12A 4CCSA 3L8EA 4M0KA 2BEUB 1O6BA 3IP8A 3P0EA 3X1KA 1ZMOA 5HS4A 1QIFA 4HRXA 1NP6A 4R4JA 3KAJA 2V7WA 2BF7A 4UBKA 1EXNA 2GEUA 4MP6A 5J4HA 1LTKA 2I2WA 2GT1A 3EIOA 2BEVA 4G37A 2CV0A 2C61A 1ULAA 2OO7A 5DGXA 5FBZA 3EMDA 2JASA 3D1JA 3O91A 4A91A 1L7MA 1NJ6A 3OUTA 2WKWA 4MUFA 1Y1PA 2R68A 3WBJA 2EX0A 3UW3A 2XADA 2BZSA 4KX5A 4ETNA 2LUOA 5JY1A 4BNVA 3ZDDA 2H18A 3MIIA 1T3LA 1WM1A 3KL2A 2GDJA 4C7MA 1VA4A 2F17A 1XTKA 3HLTA 5IXJA 2J7KA 3LLCA 3VHXA 3E0XA 2EX4A 1PDWA 1RFLA 2IYLD 2QTAA 2XYQA 2OCLA 1R7RA 3DJFA 1NHWA 4D9BA 3PK0A 1RHUA 3MB8A 2QT0A 2AC2A 1Z2DA 1IBKB 3ZDEA 1N2SA 2GYWA 4AT1A 4G26A 4HDRA 1MGOA 4ALMA 2P30A 1AQ6A 1TI7A 1A7KA 3NX4A 3D64A 4JL8A 1JGTA 1CZLA 4KITB 1MKYA 2VH2A 2XUJA 4I55A 5F9MA 1ETUA 4X8OA 5KC8A 5EE3A 1Q7TA 3M9XA 3G8CA 3CLUC 3NI2A 4I1YA 4GPBA 5L3QB 3EEIA 1WMBA 3AI3A 1S8OA 3Q98A 4KO3S 4MV4A 1Q3TA 1JR6A 1HNWB 3H13A 4JGIA 3P9PA 4F2GA 1V7QA 2SICE 1KEEB 3ABIA 4TWIA 2TRSB 3FPCA 4PBSA 2HO4A 3B7GA 2ISCA 3GJRA 3JQDA 2X2OA 3I2KA 2D0DA 1C30A 1EUZA 4YIKA 5B1YA 1F2VA 1MHPA 1O5OA 1GIAA 2BRUC 3KYCB 2VJNA 2P27A 2RH9B 1GT6A 4K81B 5ENDA 2OK8A 3TMYA 4TLLB 1HE1C 1SQGA 4HWKA 1FX0A 1TFRA 4V1CB 2V4MA 1DG1G 3OZAA 2H7YA 3AEKA 1JVBA 3IUMA 4KH0A 4GRIA 1R0WA 4KXWA 3VV3A 2EARA 4ENVA 4HH3C 4C1NA 1FFCA 3BF8A 4RKEA 4QATA 2IJGX 2C5FA 3P2OA 4MAFA 1CDEA 4EY4A 3D8RA 3OCCA 3CWQA 4YMSA 4TL6A 1D4AA 2ISSD 3OQNA 1ZRHA 1PQPA 1PJBA 1VPDA 2XYGA 1KORA 3L5KA 3PYMA 4WY5A 1KVRA 4Z5XA 5GM1A 1VQ1A 4NBRA 1O94C 4YQYA 1E77A 1WCWA 1X39A 5D87A 4J16C 3D59A 2A1IA 4G0MA 4WJLA 1RRKA 4MGIR 2MJLA 2PLRA 4Y18A 3SXUA 1FUUA 3LT4A 5KB3A 2ORWA 3DGEC 4R1NA 2FXIA 4YGXB 4NDZA 4Y9DA 1G5RA 5GIOE 3FIUA 4HNHA 2BBWA 1OWOA 4V24A 2FU5C 5FQNA 3RJ5A 2P75A 1TFUA 3VU0A 5AKEA 4ILKA 3LF2A 4LWOA 4KTTE 2XF8A 2C8JA 1YBHA 2APJA 4XWTA 5L4NA 2R8YA 3E3NA 1SHLA 4FMBB 2XHEA 4WOKA 5NULA 1CS0B 2NVBA 5EWLB 3SSAA 4D4IA 3QFRA 4JK3A 2QS9A 4MW0A 3AGPA 5BPHA 2EIHA 1Q17A 2ECQA 4MUAA 1AGYA 3WGKA 2BF4A 4QASA 1SD5A 3OT1B 1MJFA 5BR1A 5JDIC 2JLZA 3DDUA 4RK0A 3VUEA 2B94A 4RD3A 3BWDD 4DUZB 2XNDD 3C6BA 2OAQ1 3ADDA 5JJKA 1X80B 4G9GA 4D0RA 4YRAA 3HJGA 3NHYA 1HDXA 5IKEA 2XNDA 2F62A 5HMMA 1RZVA 2EKPA 1AUOA 2FDRA 4HRYA 4IDHA 2TSYB 4HUQA 4MKGA 2DJ5A 4CUKA 3VTFA 2YOFA 1QOPB 5JAHA 3IV7A 5CH3A 2BT4A 2OYCA 2XRZA 5DMHA 1KJYA 3UCXA 4PPGA 4IUBS 3MXTA 1PL0A 3PJDA 4R8RA 2R6ZA 2JGJA