1SXZA

Reduced bovine superoxide dismutase at ph 5.0 complexed with azide
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
151
structure length
151
Chain Sequence
b'ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CU-ZN SUPEROXIDE DISMUTASE)
publication title Crystallographic determination of reduced bovine superoxide dismutase at pH 5.0 and of anion binding to its active site
pubmed rcsb
molecule tags Oxidoreductase
total genus 41
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1998-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1sxzA00
3KM2A 2SODB 1L3NA 3GTVA 2LU5A 3GZQA 4L05A 1IBHA 2VR8A 4MCNA 1PTZA 1QUPA 3KBEA 1XTLA 4BD4A 1E9OA 3KBFA 2E47A 1RK7A 5KBKA 3L9EA 3F7KA 1E9OB 1IBFA 4A7GA 4MCMA 1XTMA 4A7VA 2WYTA 1BA9A 1S4IA 2Z7ZA 3SODB 4A7GF 1MFMA 1OAJA 2Z7UA 1F1GA 2WWOA 1YSOA 3K91A 1FUNA 1E9PA 1JK9A 5CU9A 1AZVA 2R27A 2WWNA 3ECUA 2AQPA 1E9PB 1PU0A 1OALA 1SXZA 3PU7A 4U4IA 1JK9B 4OJAA 1SXAA 1UXLA 2XJKA 1KMGA 2V0AA 4A7UA 2E46A 1Z9NA 1CBJA 2AF2A 1IBBA 1HL4A 2AQQA 3MNDA 4B3EA 3GTTA 3H2QA 2GBVA 1YAIA 5KBLA 1TO4A 1OZUA 3RE0A 2ZKWA 1PZSA 1SDYA 1SXCA 2WYZA 3CE1A 2ZOWA 3ECVA 2Z7WA 3KM1A 2ZKYA 4A7SA 3CQQA 1F18A 3MKGA 1SPDA 1Z9PA 3HW7A 1N18A 1IB5A 3CQPA 1JCVA 1EJ8A 2WKOF 1Q0EA 1BZOA 2JCWA 2WZ6A 1B4LA 2AQSA 2C9SA 3S0PA 2Q2LA 3H2PA 1E9QA 1OZTG 1OEZW 1P1VA 2C9UA 3LTVA 1SXBA 1SXNA 4BCYA 1E9QB 1EQWA 2WZ5A 2AEOA 2WZ0A 1B4TA 1F1AA 3KH3A 4FF9A 1ESOA 3T5WA 3HFFA 2AQTA 4BCZA 3GZPA 3F7LA 1SRDA 2K4WA 4OH2A 1HL5A 1XSOA 2WKOA 2ZKXA 2APSA 1CB4A 1SDAB 3L9YA 3GQFA 2C9VA 1YAZA 2JLPA 1IBDA 2XJLA 2VR7A 1COBA 4A7TA 1SXSA 1DO5A 4N3TA 3KH4A 2AQNA 2NNXA 3QQDA 4A7QA 3GZOA 2AQRA 1F1DA 2VR6A 1SOSA 2GBTA 3QQDB 1TO5A 1U3NA 5KBMA 3HOGA 2GBUA 4N3UA 3ECWA 2Z7YA 1DSWA 1N19A 1UXMA
chains in the Genus database with same CATH superfamily
2EXWC 3O2VH 1UJTA 1P6AB 4JO4H 5KSUA 5IB4B 3U30C 2XX1A 1Y18A 3PGDB 2IANB 5DI8B 4G5ZL 2GJ6A 4JCWA 2H8PA 2PPFA 3NVQA 4U6XA 1UWXK 3OKDB 4Y16B 2ADJA 3NJIA 1IKNA 2NW2A 4O2EB 4N8UA 4QUOA 3NA9H 2PTTB 3JBG7 3QG6A 4IU2B 4NQEE 4OFYA 4PTUA 4K7PH 4RGND 1C5BL 4P5MB 4GQPH 2WKLA 1RK0B 4H2CA 3GSNH 2PMZA 4M00A 4N0UA 3Q44A 1XGUB 1GKEA 1E2WA 2ZOTA 4Q6IA 4ZFZB 1SXAA 5K1VA 5EO9A 4HV8B 4OZHB 4HUNB 4JQIH 3QRFM 1HHHB 4JQXA 3TVMA 4OM1L 4UT9L 3DRQA 3PL6A 3VSTA 4WIQA 4OU3A 3MJ7B 3ZMNA 2CCVA 5AVTB 1KTJA 2K3HA 2D7TH 5I26A 2N7SA 5DVNA 3US0A 2N4IA 3T1FA 1BFSA 5LCVL 5JOPD 4EI0A 1EX0A 1GZHA 3VGGA 1KXQE 3V6FA 1DBBL 1LWJA 2WIMA 3VFRA 5K59E 1U4EA 3AT8A 3SO3B 2WNWA 5AD0B 3OJDA 3K6NA 3H42H 2X4OB 2ATPA 4Q9QL 3CXDH 2X0UA 3MV7D 3EGDA 3L4WA 1AC6A 4O2FA 4OGYL 5HPOA 2ZJSL 1JRHI 4X4XB 2AI0H 3PIQA 1PD1A 4PJGF 5IB1B 4BFIB 3KS0H 4EN3C 1KIRA 4I13B 4FAAB 5IEKB 2A6KA 4WI0A 4JVWA 1PPIA 1V7ML 2E4FA 1S9XA 4OJYA 3FMGL 1YMHB 4Y4HB 5HJBA 3NZHH 5I28A 4ZMVA 2H7WA 3F2LA 3GSVA 4WUUB 1R9FA 1HCVA 4AYDC 2EDDA 3N42F 1U8QA 3GTNA 3AXHA 3SKMB 3C08L 3CMOL 2Z0UA 4RISL 3VI3B 5E03A 4WI5A 3TCLB 4HULB 4CC4A 3QQDA 2EEAA 4Y19D 4FMVA 3MRNB 3IM1A 2G4EA 2P8MA 5DRWB 5HYIA 2A9CA 1J8HD 2X4QA 4M93B 4KMLB 2Z7YA 2GUYA 4NIKB 1OSPH 4MZ3A 5F88A 1DQQA 1I8IA 4JPIA 3DETC 5D93C 5BS0B 3WAJA 1G7IB 3ZKNC 1ONQB 5I24A 5DK0B 3BZ4A 2AKRB 2C7UA 5F0JB 5D6CA 3HC0B 3MCKB 2EKSB 4MMYA 1I9RL 4B5EA 1NMCC 4NWUL 3L7FA 3EZJB 3CD4A 5KUKA 4G11A 4ZTPL 4FFYH 2FE0A 4R2GC 2R0LH 2EDXA 4FQHA 4JZOA 2IAAC 1RIVL 2C1PA 3FBKA 4MWFA 4E41D 1TTAA 2WQRA 4YHLL 1MSPA 3LRSA 4CC0A 4OLZL 5H4YA 4B9GA 1MREL 3KPMA 5LCVA 4LRNH 1XCTA 2BX5A 4K9EC 4Z78A 2NW3B 4ISVA 1UZGA 4I8DA 1KCRH 3STLB 5JIKA 3BGMB 1GA2A 2BCMA 3SE3C 3U0TB 4K3JL 2AXWA 5I5MA 1JFQH 2E76C 5I66B 5ITFA 4QLWA 4QXGH 3QUKA 2XFXB 3S8FB 3DGGB 3UBXI 1J8RA 1DP0A 4I18A 3VXRD 3HZKB 4JPWH 4E9QA 1LO5B 1JGIA 2VRAA 2RFXB 3P2DA 3RURA 1WPCA 3OHXA 5CGYD 2OMXB 1QSFD 3FTUA 4A63A 1MLBB 4TSCH 4YZFE 4PTTB 1RZKL 4N8CL 1ROWA 1NGQL 3T3PE 5BO0D 3BUIA 4Y7MA 1BMGA 3FZUD 1W0WB 2HKFL 4HIPA 5LG6A 4TF4A 3V0JA 4FABL 4PYHA 3MRFB 5HI4D 2YRLA 4EXPX 3QDMD 1E4WL 1GY2A 1DO6A 1JP5A 1JI1A 4IBLT 2Z1PA 3KBHE 3QJFB 4XP6L 1OW0C 2WQWA 4TRPH 2HN7B 1ZE3H 4BELD 1HT6A 3HFMH 5HDRA 1PY0A 3MLSL 5C09D 3LZFH 2YEVB 4GEJA 3U6XA 4M3JA 5I1HH 4AH2B 1JG9A 3S35H 5DHDA 3GSNB 5T1MA 4LAQL 3ZKQD 3ARUA 4WEBL 1N59A 3G5YB 4G6KH 2C3GA 4AKQA 4HHAB 1EHNA 2FJUB 1K8IA 4FQQB 1NICA 3BAKA 3H9YA 3AXIA 1EJOH 1NC4B 5BOPA 4P23C 1FJ1A 5ID0A 4PJEA 4CW1A 2J8UE 1QWHA 4P3WA 5FC9A 5AOJA 4PJEF 5D2NB 4LVOC 1IAMA 2CIKA 1CU4L 2O6CA 4KC3B 2OYKA 4Q7DA 1AH1A 4JRXA 5FKPA 3HA0A 3EJRA 4RAVA 5CZRA 2EACA 2WYHA 2IQ9L 3BUDA 1N8ZB 4U1MB 2VDNL 4ZXBB 1NGXA 2CKBH 3QI9A 1A7BA 2YUXA 3PP4H 4Z7OB 4AL8L 3HI1B 4OT1H 4POUB 2BSTB 2EJ1A 1QRNB 1QLEL 3V0DA 1R3IL 4YHOL 4Z7QF 4MA3A 5FDYA 2P3YA 3WHXA 5F1NB 4XB7A 4OAWA 1RSYA 5H37A 2BNRA 4C54A 2QPDB 3WFDH 5I8OL 3VXMD 2WIIA 1CE1L 2MQGA 3KPRA 5DJ2B 2F54D 1G1OA 4Y4KB 2G3NA 3BYTA 4U6HB 1TLKA 3IE4A 1AYOA 4HJ0D 2PWHA 4TSAH 2WLJA 3O9WC 2LU7A 4WDIA 4JS7A 5DEGB 1ADWA 1KXQA 1WYJA 3IN2A 3BX7C 3JTTB 2WSKA 2N7AA 2UY7A 3AREA 4ODTL 1UG9A 1E7VA 1TXKA 5FYJU 1NAKL 1UD3A 2Z35B 3QEGH 3GXNA 3TM6A 1F97A 3MBEC 3KLAB 3BKCL 2ODIA 5ESQA 5I1JH 4QJ4B 4M1CC 5JTWA 1XIWC 3VMNA 1J5IA 4LHUB 4YO0A 5FUCC 1G6RB 3RWFA 2XLLA 4BWUA 3X14A 3INUL 3QPQD 4AQEB 2VL5A 5ISZE 2YUWA 4ZMNA 5ELIA 2X1PA 4XP9H 3VI4E 4N0CC 5I8KH 3QHTC 3R06B 2BHFA 3FU8A 3K46A 3LZLA 4U7SA 1BJ8A 1IJNA 1GGTA 1R33A 1UB5B 4AMKH 4XOCA 1RJYA 4HJJL 3RI5F 1DUYA 3P4MA 3ZK0A 3S5LG 1DDHB 5DJZA 1NDGB 4PY8I 2VUOA 1TZGH 2WXJA 3HZ3A 2AW2A 3DX7B 1FG2A 2ZX9A 3FOMA 4EZLA 5GIRA 5L88L 5LGKA 2ZUSA 3U0PB 2IDTA 4AQ8C 2ZOUA 4IIQA 4JDVA 4UUJA 4WI8A 2R56L 2Q5BA 2R83A 2Y07H 1KENL 5JUEH 2DMGA 2HVKA 4J3XA 4RGNB 4YHPA 4BQBA 3HZVB 2M8XA 4YDNA 4TQHA 2N7BA 1MY7A 4KNSA 1R46A 2E3VA 1MW0A 1L9RA 1U8MB 3OR6B 2B0SL 2WQSA 3UTTE 4R7LA 4DH2A 3CDZB 3QXDB 5A6MA 5ANHA 2ETWA 1D5MA 2FSDA 3U48A 2ZP0T 4FXKA 1TITA 1YYLL 3O11A 3O6FA 3MKKA 3QZMA 2BWIA 1KGUA 4JQVA 4XVJH 1UM4H 3WN5C 1A8JH 1QFWI 3OKKB 2H1XA 2P24B 3EJZC 2QPEB 1SY6L 1KYOJ 3HRZA 2CO6B 2X2HA 4OGXH 3RWHB 1HOCB 3O6KH 4FQPA 3ZDYE 3JWOL 2EIZB 3LEVH 4PHXA 4QRFA 3FU7A 3QRGL 4WFGD 4XBGB 3CNKA 1KB5L 2HT4D 3DUHA 2OXHA 4NRXA 4XO4A 1ZLUH 5BCAA 1MI5B 3LIUA 4ABVA 1TVHB 4H2AA 4G8GB 1I3RA 1U8KB 4AOFA 2FL5B 3MR9A 4MNQE 3IDNB 3LJ3A 2GTZA 2HCZX 4M8QA 2MKLC 1HZLA 2VISB 4LPCA 3VJ6B 3X1NA 1E28B 1OPGL 1OAXL 1MH5B 3FPYA 3FU3A 3RJOA 3MV7B 2XWCA 1OE3A 4XXDB 2BH0A 3EKCA 2WYIA 1S7TA 2M83A 4YE4L 3TNMB 1UXSB 3QXTA 2ZCLL 3GBDA 2XTJD 2O4EA 4EE2A 4HFWA 2XWTA 5JIIA 4BWTA 3B1TA 2BNUB 2YXWA 3O6MH 2N59A 1MRCH 4OW6A 2PP9A 1DBAH 3IETB 2YPLE 2ZD0A 4FQJL 2OMVA 4ZX4A 1S5IL 4WNQA 2DQEH 3NMEA 1OCRB 1Q1JL 1A5FL 1IGFL 3ATAA 3C5SA 5EOCH 2P5WB 4A2HA 2XN9B 3KL0A 2Z93A 1LLAA 4PPTA 4ENEC 1G5AA 5EC2B 4AYFB 3QE5A 1ZLSH 1FL6B 4GW1B 1PY9A 5GZND 3RZCA 3EJUA 4B0MM 1AHWC 4FI6A 4J27A 2ADIB 5B21A 1EWHA 4HX1A 4PWIA 1FZMA 1INQB 3UXFA 1OAKL 4N9GB 4GRWF 2WXHA 2EC8A 5I1CH 4K0OA 3IFNL 3VRIB 4DP9X 1KN4H 1QBML 2ZP8A 1A4AA 2CRYA 4LEXH 1NLDL 1I7TA 4DQOH 4EDWL 1F1AA 4XOBA 4OF3A 4QI3A 4V1DE 3GMRA 5DZ9A 4GLRH 3HTLX 2DLFL 5DD1H 5LGHL 4FNUA 1JYNA 4LEOB 2CR6A 3L3HA 4IYKA 4ADGA 3VDBA 3BVTA 2N1KA 5DC0A 4X6EA 3SBRA 3DUUA 5AVSB 5TPWL 2OTWA 5EF0A 8CGTA 4WJG3 4DEWA 1JGUH 2BVPA 4IMKC 1MHPH 1FIGH 2K45A 4HZLB 4WFFD 4XCCL 1PFCA 1P0SE 3SPIA 4F58H 3FT4B 3MCLH 2OSXA 1SY6A 1PVHA 1RMFL 4NJAH 4OZFA 4AMXA 2WMPB 1GIGH 3EUUA 5GGRA 1PW3A 1F90L 1JWUA 4JAMA 4N2HA 4XPGL 3DXAD 5CZKA 4OKVA 4DN3L 2VH5L 2BIPA 2XPGB 3K3QA 2BNQA 1HEZA 3EHBC 2CRMA 1FBIH 2YPKA 3RPIB 1GSKA 2UYLA 3SKOB 3PUCA 4KWUA 5JIMA 2P46B 1R75A 3UZEC 4NCC2 3VFWB 2KZBA 4EOWL 1H15B 3ZTNH 1W0VB 5LWYH 1IM9B 4KKRA 5JDSA 1DFBH 5E8EA 3BEWA 1AJ7L 5KVFH 1R3KA 3JV6B 2A74C 4Y4FB 4FL4C 2XWBA 3T71A 1QLFA 3GXTA 1SJHA 4N2FA 5HJGA 1AKPA 5GRWA 3WFZA 2AJSH 1DQJB 1TKWA 1AZCA 3QWQB 3BRGC 1R24B 2AABL 4F2FA 1QFOA 1AHMA 2ZPKH 2CK0H 1JK9A 5CZVL 5K9KA 1SN5A 1WCBB 4XE0A 2VB5A 2C3XA 4XVSH 2WBJA 4QRRD 1S7XB 2VR9A 1FYHB 1GAFL 5E6ID 1QI5A 1EERB 5F3BB 2E46A 1TLMA 5EU6A 2FYYA 2PWDA 1FCGA 5ITBH 2DI9A 1VGKB 4B5ZA 1RFDH 4NZFA 4WGWB 4L3EE 3CAFA 5HI3D 4X9YA 1W8OA 2OV0A 1A6TA 4MA8H 1IQWH 1L7TH 5JW5A 1I7UB 3L4ZA 3AUVA 4R8WH 4GUQA 2Q1EA 4F7KA 1OARL 4XBPB 3KJ6L 3WIFA 5D7EA 1ZS2A 1EFQA 1QUNB 1UGNA 3SKUD 2WUBH 5L8LB 2AJZB 1ZY9A 2LU4A 2X10A 4EQ2A 4MD0B 4CVXB 1P4BL 2DKUA 3GI9H 1UD5A 5AW6B 2BY0A 1L0YA 4G6JL 3B5HA 1A7RL 4JB9L 5DHYB 4XR8C 4A37A 4CJ0A 1B3JA 1HFUA 1ZEAH 3IMTA 4QTIH 4F8LA 3MHZA 3X17A 2ZWKA 4P2AA 4HWUA 4ZW7A 2CUHA 1YYCA 5DYOB 2Z34A 5TF1H 1NGPH 5JZ7C 3HHSA 2WP3O 5J1TC 5HSFA 3AXLB 4NT6B 3IF1A 5I1LA 2FHBA 4G8IB 4TQIA 4D9RD 3S3BB 1EZUA 1HKLL 1U21A 4AUUA 4C4KO 5FECB 2IALB 3QS3A 1NBVH 3C09C 4AI7A 3RIAK 5GGVL 2QVKA 2WQAA 3OPZH 3UTSD 4HXBH 4BSWA 2X70A 3OBAA 4HCIA 4N2LA 2F54B 5ID1B 1HYSC 1QSEB 4M5SA 5ILTH 3MJWA 4DGIH 2DWDB 1F56A 4PVNA 3BXNB 2AAVA 4HLZG 4JKWA 3WJJA 2JB6B 3ZGIA 4ZUSA 3FFCE 4HDIB 1G5GA 5AW8B 4LLMB 3L48A 2VITA 1UB6B 3F6JA 4OD2A 1IGJB 3OR7B 2X1OA 4KMTL 4JFDB 3ZE2F 2YO3A 2I60L 5HYQB 1S3KH 2BY3A 2XXFA 1FDLL 4JY6B 2VR8A 3V5DA 4NYLA 1WBYB 4JKMA 2GSMB 2P5EB 2GK0A 3TWYA 1TTRA 1WVZA 1RZPA 3AG3B 2VLKA 2WJ7A 4XPFH 2DI7A 2PCXA 1GC1C 1GGIL 1I4FA 3ZL2A 2VQTA 1ZA6B 5EBMA 1A0QH 4LPTA 3GMLA 4Z3GA 1F4WL 2OJZL 2IFFH 2YPLA 4NHUA 4DKEL 1A3RL 4S1SH 1X7QA 2O5XL 5HYSA 3AG1B 2ZF9A 4KKLC 4DFIA 4H8VA 4J1UA 3NCJH 4XHQA 1K3ZA 4PRNB 3VXQA 3M1OA 5L4MA 2H3NA 3CX2A 4HIJA 5CWSB 1SHMA 3RA7H 1DQKA 5EEUA 2EYTA 3EOAB 2P7TA 1SYSB 1XCQA 2ZYIA 5CSGA 4GSXA 5GJSH 1ADQH 9PCYA 1XF2B 1QVOB 2EIKB 2VR3A 5CP3H 3S2AA 4DN4L 3CFNA 4BZYA 4UMSA 2VDPL 1BXAA 4ZW5A 4M48L 4P2OC 5SWZB 4JR9H 1HL9A 4NN6B 2D31B 1HESA 3INOA 3PCYA 2Q6WA 1MJ7L 1HCFX 2EE3A 4EI5D 2IAMD 3TO4C 1EXUA 3QNXA 1JPGB 4V1DA 3M7OA 4ACPA 4Y1AA 3T3MB 4ZSOA 1UWGH 1FL5A 1BXXA 1E4XL 1RZJL 1A6UL 4UQAA 5G4NA 3WGVB 3L3GA 5I8EB 3PABA 1J0YA 2AEQL 4MA1C 5IVZA 4KY1H 1CGSH 1FO0L 3E9TA 3QFDB 2YD4A 3GNML 2Y2TA 1TTCA 5HGHB 1AZNA 1MLCB 3ARFA 1KIQB 3QQNA 3L3KA 5DD3L 1DQTA 1DQVA 1MJJA 2IQAA 1YO4A 3GJFH 1JPSL 1UOLA 1OM9A 4AK2A 4K5NA 5D1ZA 4YC2B 1P5UC 1T89A 4C58B 3TBVB 4PU2A 1JV2A 5AVYB 5CN2A 1UEMA 4DF9A 4P5TD 2DPKA 2AK4B 2APBA 4U1KA 4X6DA 4QT5A 4L4TB 1Z9MA 3B9KD 4FQXC 2ZG1A 1OM3H 2HRGA 4C8XA 4X6DF 4HIQA 5B22A 4G80B 3SE4C 4BK5A 2VXVH 1WZ1H 5KANI 4JY4B 3Q5TA 5F8QC 1AKJD 4NQED 2XTJB 2R23A 4ERSL 3C60A 4XX1E 4MQXD 3GXDA 2ED8A 4HJUA 2XA8L 4D0DA 3VWKD 3FU0A 1FZJA 3NIDB 4E68A 2EDYA 1HH9B 4TUJA 1ZVSB 3DO4A 1HL8A 1GH7A 4KK8C 4RCAA 4KQ3L 4JMNA 4PWGA 3D25B 1LILA 3E6HB 4L9LB 4ZUUA 1NCBH 2XFGB 3J07A 4QEGA 2YD8A 2PXYB 6TAAA 1Z3GH 1U8NA 2GI7A 5EZIL 3B9AA 3TV8A 1NZRA 4K3EH 5JHLA 3GGWB 4IRZH 4RWHA 3PGCA 4F33B 4PEEA 1BLNB 1O9WA 4L3AA 5CP7B 4MAYA 3SJVD 3PHSA 1DEEA 4XN8A 4OLVL 3AWFA 5TQ2H 4ZFOL 3SYOA 4JRYE 5IOKA 1OAYH 1YJDH 4L1HA 1I3GH 1W15A 4JO2L 3AS2A 4OLYL 4PGDB 4OZ4A 1BVLA 5C0JB 3G5ZA 5E2TH 3BKYH 5CZXD 3MRCA 1SMOA 4PR5A 5I1DA 1LO0H 1FO0A 4GRMA 1FZKB 5TDOB 1HQRB 2FLMA 1E30A 1ZIAA 3HR6A 2PWGA 2Q9OA 4IJ3B 4WV1C 1XGYH 4PJHA 3F7VA 3B2UD 1AE6H 4W4OA 3DO3A 5PCYA 4HUKB 1LQSR 4GUPB 5C0FA 4PJHF 2Q7YB 2QPSA 4HETA 3UO1L 4GBXA 5IVXE 2DWTA 3S98A 4YUEL 4HCRH 4GIPD 2JVUA 3LMJL 2JIXB 1QABA 4PJAB 3ECVA 2ATKB 5IMMB 2YRBA 25C8L 3KM1A 1JNLH 2HX8A 3DX9A 3HI5L 4W9KC 4WWOA 2QADD 1IL1B 4NO0A 3MUZ1 4JKKA 1MJ8L 3MJ8A 4MVBD 2JCWA 2JJWA 4UBDD 2F5BH 5IHZA 4JFOA 4K9EH 1AQHA 1ACCA 4QRSA 3FC8A 3HAEG 1PNCA 1SXNA 3PJSA 4U33A 4ZQKA 5FW8A 5J1AA 1GHFL 1NIEA 3EJYC 3LX9A 2ZUYA 3QAZB 1XSJA 1N0XH 3G6JA 2NQDA 3B7SA 2IGFL 2NRDA 4H88L 3ZGHA 5I1KL 3G6JF 4UOZA 1S7SA 2BC4B 1QZ1A 2B2XH 3FFCA 4XCFL 1UD4A 5EV7A 3WXVH 4K8RD 4K94C 3N04A 2WJ5A 3UROR 1BIIB 8FABA 1JWMA 2E4TA 5IV2B 1HH6B 3L9RB 5BOZG 3II3A 5HI5D 5C0CA 2Q3ZA 1MCOH 4DKAA 2A99A 5AW0B 1L6PA 2AITA 3U30B 1JWSA 4U05A 3VFMA 2R0ZL 3QDHA 2Y5TB 2IGLA 1F11B 2XZCH 4FZEH 1Z0NA 1ED3B 3EO9H 2E9BA 5IEHA 4I0PB 2AJXL 1VKXB 4DAGH 2P5PA 4U6VL 1DR9A 4X7SL 4P9MH 4NOFA 4TPRL 3W82A 4DP0X 3KL3A 5BXFA 1NCJA 4WTZG 4AZ8B 3ARPA 1RVFH 4WFHE 3SQBA 3SDDA 3SPGA 4CC1A 4Z3FA 3KLHC 4ESKA 3K5RA 4LMQI 2XZAH 2WP3T 4UU9A 2CAKA 3GJFB 1HILA 3SQRA 3RVXD 3I85A 2XQBL 4QCIA 3VXNA 3EDFA 1KIUA 4BUQA 1BDYA 1TQUA 3O2WH 1QG3A 1MF2H 5K9OB 3QULA 5DUBB 1EO8H 1TETL 3C9NA 5DRNA 1J12A 4K5MA 3MOBL 4WW1A 3VFTA 3VDCA 1YEKH 5IQ9A 2ZKHL 5A2BA 5A1AA 1CGWA 2I5YH 1ZTMA 3MDJA 3F58L 2PPCA 1ZHBB 1K2DA 3O4LA 5KJRH 5D7JA 1G7MA 3C6SA 4KV5F 4O5LL 5SWQA 5BZDA 5JPMA 2CJSA 3PV6B 4B97A 3UBXA 3D4CA 3QJTB 2ODHA 3ZBMA 2NZ9D 3CVIH 3UTSB 5AB0A 2VDRL 4GO8A 3KYOB 5G5DA 1HXKA 3E3QC 2YJQA 4OD3L 3IFPA 4OVUA 3U36B 2GTQA 4GAJL 1DLHB 2F58L 5I19H 3QFJD 4X80H 5GSRB 4ODVH 3MMEA 3KWUA 4N90E 5GRVK 3P3SA 3CZSA 4DIXA 4M7LL 1BVKA 3MLZL 2ENQA 4NNXA 4ZAKC 2AAAA 3QC5X 3U9UA 2P80D 1DBML 3CJJA 1YPZF 5MI0C 1T5XB 8PAZA 3T2NH 5L8KB 3OM3B 3HFFA 4PREA 1AAJA 2MCAA 4NZ8A 2PYFB 1UD8A 3LKPB 3QZWA 5K9QG 3MLYL 5JW3L 3VFNA 3KVQA 1A9BA 3X12A 5AW9B 4G83A 5CKAA 3SYQA 9CGTA 3IMBA 1NPNA 5I0WA 3QA3B 3HC3H 4JLRB 3LKQB 3AABA 5CJOH 1BQ5A 2A6DB 2OR9L 3UFIA 4K8RH 1WF5A 5D7LA 1Q9OA 1DLFH 5B39B 3MOAH 4OFPA 3WNOA 1AQKL 3RWIB 4JDEA 3MNWA 1OHQA 3VD0A 5HHXL 4I2XA 1O0VA 5F6IB 3WY3A 3SOBH 2Y9RT 4R2GB 5E24E 1YEJH 2QVMA 3E1F1 2DIEA 1DHKA 5F71A 3PNRB 4ALAH 3BP4A 1Y6KR 2JKNA 4HHWA 2R29L 3GMPB 3MLVH 3ULVE 1D7BA 1P84K 1A1MB 2VN3A 1KDJA 4IKLA 3KBFA 4JRYA 4LPVA 2BXZA 1N12A 4O00A 4AJVA 2J25A 2IWEA 4WSGA 1H8SA 4LAJH 3TJEH 3Q1SL 5D5MF 5EU7C 1XD1A 1NFDA 4JPVL 1I75A 3ZX1A 1XEUA 2V2WA 3EDJA 3FKUS 1NFDF 4NO5A 4FLSA 1BMZA 2GJPA 5HHME 2NY7H 4QOKD 2A83A 2XPYA 3OKYA 3QJVB 4PVMA 3T4AB 3H7BA 4P5SA 4PSPA 4HZAA 3EJPA 3Q5OA 5CUSL 5ISZD 2WWNA 2LVEA 3CFDB 4IU3A 1C9SA 1CYWA 2J8OA 5L7XH 4FKEA 5D7KE 4Q9RH 4KOCA 3BDYL 4G71B 5CFAA 5E8DL 4PAZA 3ULAB 4OLXL 4X5RA 2HTLD 2X2IA 2IDUA 3KPTA 1T20B 4MQ7B 3PE9A 4PUBH 4YXLH 2DJUA 4MJIE 3G5XA 2VDLL 3DGDA 1OLZA 3WTWA 1IGMH 5FF6A 3FONA 3CE1A 5DQJB 2LAGB 4OJFH 5T33L 3K2UH 3KNBA 5DS8A 1JL8A 3WUWG 2QTVA 1BZ9B 1LK3L 3MKGA 1UT9A 2X4NB 1BM3L 3DJZA 1Q0EA 4AG4H 4QWWD 1JJUA 1QPKA 1UASA 4UM9D 3VWKB 2KHAA 1SJXA 4BK8A 1UWEL 3VFPB 2WVVA 1WDAA 1N5YL 3PWLB 4IRSA 4JFFA 2IPUK 4ZFFA 3ZIYA 3UTTD 3A0OA 2QMJA 3C5ZC 4AEEA 3HBQA 2GBAA 1IC7H 4E42B 5E5MA 5EORL 4TL4A 3RTQC 1P7QB 4P23B 3V9EA 1EHLL 5CKGA 5IBLD 1RPKA 1A3LL 1N3NB 2R29A 4M1GH 3FT1A 3UJJL 3V0WL 5HD8C 3HEIB 2ICWJ 4PJCB 3SJVB 1JHLH 1E2ZA 2H0FA 2VR7A 3BQUA 3D85B 3KPOB 1AXSA 3QHFL 2IH1A 3SDCA 2R1YB 2EDMA 4U0QB 4YSDA 3PREA 4I1PA 3O8XC 4GLRI 4NQDB 5FDWA 3QPQC 2UUDH 3SGEH 2LE9A 3QDGE 4X0KA 5CSZB 5IQNA 1M1XB 3EOTL 2CDGB 3FQRA 1RHHB 1OSEA 1B88A 4H1LA 1JPEA 3GSXB 4MNQD 5LN8A 1TENA 5AOIA 4I1RA 3MYJB 3V4VA 3ORJA 2DQGH 2Q20A 1A14H 3NFNB 4MHHI 2K9FB 3V52L 4XB8A 5IM7A 1J5OH 2VDQL 3OD3A 4M5ZL 2LLLA 3A5VA 4X83A 1YN6A 3NTCH 3P9WB 3TWCH 4GKNA 5DFTA 2EVHA 1SEBA 2B5IC 2QLVB 5EN3A 4ZX5A 2O5YL 5IBUG 3ULVL 2MWCA 3FTVA 2A6JB 4H5SB 2V17L 3I84A 3G6DH 2O26U 3LKSB 1QTPA 1IC0A 2XETA 4N5UA 5J11C 4YS4A 4WEEA 1FFTB 2EE2A 3FRPA 1WFUA 3WMSA 4NQCB 5AQ0A 2PYEE 3DYOA 4UV4L 3KPQA 3EGXA 4C55A 1USQA 3Q13A 3OAWA 4WW2F 2WNXA 5KYUB 2MQ3A 3MROB 2H2SD 5K39A 3T0EC 2EE9A 1M9SA 1H6EA 2RCSL 2HG5B 5KS9A 4JRWA 5TDNB 1GS8A 1UATA 5KS9F 2EDWA 5DRXB 2J12B 4TSBH 3MRLB 4OKDA 5HJ3B 1KFAH 4Z7NF 1B2WL 2A77H 2EILB 4K3DL 3RAJH 1LMIA 3QEQA 4MS8C 2HT4C 2IG2H 1NKOA 3ARGD 1V3MA 3BWAB 1HYRC 3ARWA 1NCNA 3K8KA 3WDIA 3LCYA 2ZOKA 1RV6X 3LSOA 2GJZA 4YPGB 2QKSA 5B3JF 3HBZA 1IFRA 2GB2A 1OZTG 2I26N 1NGYB 3GF8A 3JTSB 3P30H 2DQFB 5CM1A 1BG1A 3QR1A 5D7IE 2ZXDA 2CO4A 2I7OA 3R8QA 2EC9T 4XPHH 5IT2H 3RP1A 5HHOD 5SX4H 1FFRA 1DSYA 1QRKA 3R19A 4YHIB 5DD0L 1TU2A 1LO3L 2LABA 1MCKA 5DJ0A 4PRID 4OQTL 2DEYX 1VGEH 1UT1A 4ZUVB 1OWRM 3KWWA 4I48B 4BIKA 3NJMA 3QWNA 3D34A 1WD8A 3DI2B 3TL5A 5GZNC 5IFAL 3L17A 1VLXA 1KEMH 3LZOA 5GGTA 3LPFA 3QQ9D 3WN6A 4AQZA 3MI6A 1AY1L 1EDHA 4DPAX 4GG6B 1B2YA 2J5LC 1ZPUA 2Q3AA 4QF1A 4XCNA 5IIEA 3MGOA 4ZUTA 3CN4A 3QUXC 5IBTL 3OZLA 4JANB 3TS8A 4BRJA 5J3HD 2YIHA 3BP5B 1BF2A 3PP3H 1F4AA 5BMFL 2A9AA 2FLRT 3KM2A 4MB3A 1WK0A 4OCMC 4JM0A 2F53D 3TIDB 3DRTB 2LU3A 4JL2A 1NCIA 1D5BB 5E08H 2L4OA 4EMZA 1QLRA 3V0VB 5T3ZD 4P2QE 1MWAH 4QRPD 4JE4B 4P46B 4KXBA 1PJWA 5EO0A 1QWUA 4TVPH 1HINH 1QHPA 5DJDB 4JY5H 3WKYA 5I2IA 3H8NA 4N0FA 3WJLC 3N50A 4G7SB 1I8MB 4Z9KB 2YLHA 4MJIA 4JZNB 3SDYH 3GLZA 2EIEA 5CIPA 2NNAA 1OF2B 2EDLA 4IOIB 5F1KC 1KBPA 3T6VA 3SSGA 3NZSA 1PD6A 1ES0B 3FJTA 3IU3A 4G43A 1Z9OA 3HG1E 2BHZA 1BOGA 2BVYA 1IBBA 1B9KA 1AO7A 3AG4B 3I9GL 2VWEC 4W4NA 4NZUL 2V5YA 5ICXA 5DZLA 3IDIA 4H25A 5KVGE 3SDAD 3W0WE 4NN7C 2G75A 5GS1A 3K5SA 3RWCA 3HBGA 4NQVA 15C8H 1GZQB 1KPUB 3NUKA 1UFGA 4OQTA 5T3XL 5EEZA 4MXVE 1HWGB 2WLLB 4Q6IC 4HBCL 4FG2A 2J6WA 4LEBA 3FTZA 4DO4A 1F8TL 5H35A 1NGZB 1HKFA 5CILH 1S7QB 1YCSA 3IFOA 4JQXC 3TVMC 1RIHL 1E3FA 2FD6L 3S36X 4PJDB 1UJ3B 4Z76B 3QO0A 5DMGD 4JHAH 2WZ5A 2BSSB 5D70L 2R4RL 3AU0A 2WZPD 5DUPH 3ROOA 5DQ9B 3RGVA 3DK2A 4L5FE 1MXDA 2NY0D 1CICA 2F18A 5D71L 2D0FA 3QDGA 1XQ4A 3BWSA 2JKRM 1G4MA 2NOYA 5DSCA 4YNYB 3WNJA 1GZHC 5FB8B 3QIUA 1D9KB 3QPXH 4U6TA 5IOPB 4JG1L 3EHBB 5BQ7B 1BYOA 1YEHL 3C87A 4B9IA 3IDMA 4I85A 1ORSB 5H37G 4YX2L 3QIWB 1J1XH 1OGTA 4RESB 4L8CB 3G6AA 1KCLA 3VFOB 2HFGL 1T66D 3S37H 3V6BR 3BFQG 2PW2B 1MIEH 2WVSA 3C6LA 1EVUA 2A74B 5C0AA 3BUYA 1Z1WA 4B95C 2PPAA 4WNSA 2G5RA 2PPEA 3MRDA 2OCJA 2UXFA 4BFNA 3N0AA 1P7KB 5E1GA 5C0EA 5ICUA 3TEUA 5D1QE 3FCTA 3FO9B 3CLFH 4MMXB 3DHJA 5T1LD 3GSRB 3RL1B 4KRPB 3VCLA 1FA4A 1LEGB 3QZLA 5FHAL 5HVGB 3TZVA 2ESVE 2FGZA 4CC4C 4MJ5B 2H32A 4LVNC 4PV9B 2XU9A 4KRLB 3RVTD 3S5LB 1B6DA 2MNUA 5T3ZH 1P5VB 3PPSA 4N6RA 3DDGA 1BJ1J 2DYPA 2MNWA 5DHVH 1J0IA 4K7FB 1O9VA 1RPUA 2K8MA 2A6IB 4J3OH 2DOCA 3KCPA 1CE6A 4S1RL 3DROB 1T1XB 1GCFA 2FRGP 3EO1A 3GK8H 1PCXA 3LQMA 4J28A 4KXDA 1WH0A 2HLFD 3EJSA 4UB0L 4QDGA 4KPHL 1ASOA 3UTZB 2F8IA 4O51A 2AQ2A 2W0FA 3IKCB 1YN7B 2Z1KA 2XG5B 5IJKA 4WTXA 4PWEA 1NAMA 3WFBH 2Q76A 5I82A 1P2CA 2Z92B 2IEPA 4EIUA 4JN1H 5KVGL 5ESVB 4KROD 3U6RB 2DIAA 3IJHB 2VLJD 2Z31B 5FYKD 4EVNA 2MOGA 2YMXH 1AGEA 2VLRD 1X9LA 5DO8A 1E4KC 2DWYA 1GZPA 3RY6A 4AV0A 4CADA 1SDDA 1QAWA 4M4RA 4FG6C 3DOSA 4N22A 2HVJB 1NUGA 2OW7A 4KQ4H 2ZONA 3WKQA 4CVUA 2QFPA 4ILDA 3HUJE 4ZD3L 1MRFL 1MWAB 5IQMA 4I18C 4KI5F 2GHZA 4A68A 2WZ0A 4MCYB 1TTBA 1L9QA 5JQIB 1P1ZA 4MSWA 2YR3A 3Q6FB 4RA3A 3ZHLA 1VFBA 3OHXC 4LCCA 4U1HB 2QQQA 3PFUA 5L2JA 1F6FB 5GS0L 3FUHA 3EJJX 4EI5C 3ESVF 4TXVB 1Q0YL 4KUCF 4BZ2H 4PJFE 2X2UA 3CC5A 1NLBH 2VM4A 1DJGA 1R1CA 3ZDWA 4Z7OF 1AGCA 4U49A 3MV8D 3P77A 3CDCA 3REVA 3HVDA 2AJ3A 4GRLB 2W0KA 4PJ5D 5ADOL 2XTSA 4FZ8L 2DQIH 4KTYA 1LP9E 3I75B 4BZ1L 5IMLB 1DCEA 2FGWH 4F7EB 2HWZH 1EAQA 4EEEA 5J9PB 3QUHA 4LLQB 3LYRA 5I15L 2CHNA 1A1NA 4GP4B 5C07E 4UQ3B 1G84A 3UYRL 4L37B 1CG9B 2X2YA 3QH3A 3ULUE 2ZSWA 5I18H 2BIQA 1S5HB 2G9HB 4D3CL 1OVZA 2G2RB 5AAWC 3ARGB 3B7TA 3VSQA 2VMJA 2QR0A 3QQ3B 6PCYA 4IRJD 3FT2B 3K1DA 2CO7A 1CT8B 3U2SB 4ETYA 1CLYL 3ARBB 3B9KC 4YFEA 5CEZE 4ZO8A 3QQ4B 4J6IA 2EE0A 4U1SB 3NIFE 1WFOA 4HMDA 2D7NA 5D7SH 1BEYH 5D4IA 5TE4L 4X4YB 4MXWL 3ZHNA 2KLSA 5CJQH 4MQXC 1CYXA 3MLRL 3CFEA 5TJWK 4ATTA 1EEZB 4BKSC 1NCAH 4Z7VE 5HHOB 1SJEA 2OKMA 3NSFA 1A6VH 4PRIB 3ARDA 4ABUA 5ICYA 2YKLH 1HL4A 3KWVA 5JIQA 4I89A 2ITDB 3EJTA 4FQ1L 3WFHB 3HE7B 4ZTOH 3G08A 4FA6A 2W1NA 1CFBA 4PJ8B 2AP2A 3I6KA 4PJBB 5EU3A 4KRNA 4Z7UB 4P2RD 1QQDB 4GW5B 1RZKC 4HBQA 3FCSA 3WELA 2YAHA 3QEHB 5D55A 1AQDB 2F74A 4QRAA 3RU8H 3V0FA 4X6BB 4XP4L 2XKNB 2D03H 1CJYA 2JJVA 4F92B 3IFLL 1EANA 4DO5A 1D5IL 5IROA 2FX8H 3CTTA 1AI1L 4WU5B 1TZIA 3U82B 1E5YA 2HKAA 3ILQD 1EZVX 4PG2C 3B2UC 5EA0H 3FT9A 5IB3A 3CBJB 2V5MA 3ATEA 3M45A 2LTQB 1A6AB 3UP1A 2DZEA 3NP3A 2RHEA 4XBEH 5LAXB 3RDTD 1NEZA 2WNKA 2C9AA 3HC2A 4KZDL 2QADC 3D39B 4J2XA 4HUXB 1BM7A 5D1QA 3I3DA 1TVBB 1ZV9A 2ZWSA 4WFHD 3Q43A 4HJ1A 4WWID 4MNHB 1EGJH 4MVBC 3U79A 5KW9H 2RGSA 4UBDC 3WS6C 4AQ1A 4XWOD 5I73B 3O3BA 4LSVH 2DQJL 1ZTXH 2ESVA 3AMLA 1VPOL 2GIYA 4O2CB 3BZFB 3MUUA 4L8DB 2N0KA 4M43H 5IG7A 4NQSB 2DQCH 3FQUA 1J9CT 3U7WH 1MDAA 1WWAX 1I7RA 4IIQC 4NDMB 4LHQB 5DRZB 1DUZA 5TH2A 3CSTA 4U1IA 3SDAB 2UWEE 4LLWA 1MPAL 4AL8C 4L23A 1T0MA 3GIVA 3QIBB 1PYWA 2HRLA 3MRJA 4JZJA 1DVFA 3HIZA 5I74B 3P9MB 3SYCA 3GRWL 5HI5C 5EF1A 5KVEH 1OGAB 3CFTA 3F7QA 1T21A 3BZEB 1EA9C 2B4CH 1BF8A 3PWVA 5CEZL 1UH3A 4W6YB 2OMTB 1F4YL 1SYVA 1BAFH 1IGCH 4AE1A 4AM0A 4K23H 1N7ML 4JQVC 2WINB 3IJSB 3T0WA 2OX5B 4P4KA 1H5BA 2X4TB 3HRZC 4N90D 2OZNA 4CMHC 2VDOH 3TBTA 1F2XK 4QAWA 2K78A 2QQKL 3M8OH 5FWRA 5IK3A 1FGNL 2YEZB 5I16A 3NSDA 4LFHG 3NSYA 3K71A 5DO2C 3RPBA 4D9QE 1CIDA 1E7UA 2CDEA 5A6LA 5FO8A 3GSQA 4PY7A 3SCMA 3TPKA 4M02A 1MFAL 4N1CA 2DJ4A 3K6FA 3MV01 2DDQH 2CGYA 2EUXA 2YZ8A 3VXUA 3ZE1B 2NUTB 3GKZA 5L6YL 1W91A 3GKWH 1IB5A 4UTBL 2Z91B 4KFMA 5MENE 2WKOF 4FKHA 4PWFA 1FNEA 1F3DJ 1ZV5A 2BPBA 1OQXA 5CCKH 5GGQL 4JM2D 3BPLB 1OY3B 5C3IA 2RQEA 4NRYB 1IILE 2GCYA 2QSCL 1VACA 2NY5C 3CHRA 4PJFA 3NIGB 4WO4B 4ANWA 1U95B 1T1ZB 1HZKA 3EYUL 2XN1A 1YZZA 32C2A 1DN0B 3WE6B 3OKNA 4F7PB 2O93L 1HSBB 3N1MC 3MA7B 3J8F7 4Y5VA 4L8BA 3MXWL 1SQMA 2FX9L 3S3JA 1A9VA 4KXZH 2R2CA 3GSUA 3ARSA 1KYFA 5AWNH 2J4WH 1OP5H 3ULSB 1KYOK 3LS4H 1YY8A 5KG9B 1LE9B 2V2TA 1SF3A 4F8PA 4NPJA 1SEQH 3OKEB 3M1BA 1E6OL 1QPPA 2WW8A 2D8KA 3UZVA 3GRWA 1WG3A 4Q6YA 3CBRA 3OJMB 5HHMD 5K33A 1QW9A 2YSSB 1S9WA 3BPNC 4ZPVA 3B9DA 4PGCA 3BJ91 3MFFB 4O9HL 5HDLA 3GHEL 4NP4L 1I1AD 3QGVA 5D7KD 2Q86A 1QR1A 3KXFD 5LXVA 5J1SC 4LSQL 1A7NH 4XH2B 1R5WA 5KSAD 3CQFA 4X98B 1VEPA 3MRPA 2HH0H 1R0AL 4UDUB 4FP8H 2HMID 3JWOC 3OJ2C 4UQ2B 2G2PA 2FBJH 3SKJH 3KYKH 5GGSA 2J44A 4KROB 5IR1B 4OCWH 5C0BD 1JGLL 2OMUB 5BO1H 5FGCE 2A9MH 4DUXA 2XWDA 3VG0L 4EZMA 3I02B 2R2EB 2NX5A 5E8OB 1WZMA 2J57A 3MRQA 2MJWA 4KJYB 4FYTA 2BWQA 5C0RH 3ECQA 2MCG1 3TYGL 5GRVL 5BJTB 2HT3C 3VAEA 3PHOB 4X7TB 1LMKA 3H85A 5MHSE 5I1EH 2AEPH 4XAWH 4DCQB 3MCG1 1CURA 4XC3H 4NPKA 1W2KT 4TQ8A 4KZEL 4LPXA 5EIVA 4H26B 1MHEA 5FYJL 1JN6B 4D0BB 5IF0B 3UBFA 5IHUL 2E9GA 4AVHA 2GT9A 4EI6A 4F9LA 4ZQTA 3LXBA 3U1SL 1GYVA 4HZ1A 4W81A 1ZGLP 1FI8C 1JSYA 4ZAKB 4QXTB 3EOYG 5J6GB 3QUZB 5E8NB 2WOBA 3MV8B 3PG2A 5MI0B 4HKBA 4PJ5B 5E2WL 3HI6L 5LBVA 1CL7H 1IGIH 2GABA 3BH4A 3HR5A 4WGKA 3KPLA 2W0LA 4W68A 1JHTA 5KSBF 3S36H 1XGQB 4H0IA 3WHE0 4BEIA 4OFYD 1RCYA 4AEFA 2CDFB 3WXWH 3BVNB 2DM4A 4W9CC 1OD9A 5JW4N 5MEQB 1D2OA 1I1FB 2XYCA 3B8SA 3VXSB 2G0LA 4IOSD 4AGQA 4IBVA 3T1WA 2UX7A 5C08B 2HVBA 5JW4R 1OT1A 4NO2B 1R3HA 1FE8L 3PQYD 4HJGA 5AAPA 4LLUB 3BUPA 3ZDZF 4LCYA 3SB3A 3O0RL 4B7LA 1DO5A 2VDOB 4K71C 4ZT1A 3LXUX 3VFUB 1IAIM 4QWWC 5DVPA 3UTQA 4Z5RB 3TBBA 4IGBA 1S9YB 3GM8A 1YEDB 1ZDQA 2NY6D 2Q8BL 4JN2B 2PYED 1NC2B 4HMEA 3WV0A 1JPTH 1CC3A 1U9KA 1XH3B 5E4EC 5IMOB 1KJMA 4CU8A 2X87A 1FFPB 3IYLW 2Q87A 2CGRH 1BZDA 1FNSL 1S7RB 1X9RA 5C7ZA 1U92A 4C4BA 4CKVX 3VB8A 3X3GH 1YQVH 4Q9CA 1U41A 3C2AH 3O3AA 4QYOB 3QXAA 4PRPE 5GRYA 3LEYH 3O6LL 5G55A 5IBLC 3H9ZA 2UZYA 4QIRA 3EG9B 4YSPA 3S2CA 1JDCA 2VN6A 4HG4J 2EH7L 5C0IA 3QPKA 4OCXH 4Y2DB 4XB3A 5F7KC 2X9YA 4P48A 1A4JB 3G3LA 5HDQH 5ALCL 4NIYE 3CGTA 3MLUL 2ZYHA 1D5ZB 3OXRA 4AEIL 2C9RA 4MB4A 3VGAC 5JA8B 4MB5A 2K9UA 4PSRA 4WUKL 4JDZB 1EEYB 4RVBA 5JIDA 1W72L 3H0TA 3FCGA 3LPGA 5AZEH 4J39A 1UZ8B 3HMXL 1I9IL 4WKXA 5FGRA 7PCYA 4NUJB 4WHYH 2JK5B 2E5EA 4GT7A 2P8LA 1BG9A 3I6LD 4N28A 5DJCB 1F4HA 2FT8A 4JFYB 2EH8L 5DVMA 3IS1X 4Y19A 1EJFA 2VUKA 1MUJA 2X4UB 1G7QB 2PR4L 1U3HA 2O6EA 2ENYA 2VSDA 4OTXH 2DM3A 4O58L 2B14A 3UZQA 4HS8H 3C5ZB 2NUPA 4ZFGH 4A2FA 1QEWB 5F2FA 3JWDH 4KZCA 1FAIL 3T77A 2A4CA 2VZUA 4POYA 3ZO0A 2DLGA 1DL7H 3EYFA 3FQYA 3N9GL 3NJGA 5DHXB 2H2SC 4PCKA 3L2LA 5I30H 4LOFA 3VXOB 1T03L 3UAJD 4F7CA 2KS0A 2ZAGA 1A7OH 5I6OA 5EHFA 1AGBB 2CO1A 3AY4A 4BKLB 1VFAA 4QTHA 3COOA 2UZIL 2BOCA 4UT7H 5T1KD 3LD8B 2QDWA 5DWPA 1ACYL 4L3FA 3O8XB 5DMKB 2ENSA 2Z4TA 2VXUH 3OAYK 4F93B 3OB8A 1NM4A 3NIDF 2FYVA 5I1AB 4LCWA 1HL5A 2ZICA 4JKPH 4N87A 2R39A 1P69B 4GSUA 1B3IA 1BBJA 4K15A 1HAUA 1U2HA 3ABKB 3FB8A 2LFEA 2V3EA 3ASOB 4QRUA 3ARFC 3BVWA 4YIQA 5FUZL 5LXGH 3CN0A 2VE6A 2OFQA 1KB9J 5CLWA 5JHAA 3HKZA 4W93A 4JO3H 4LU5L 3B1UA 4ONGL 4JG0H 5EUOA 2WPGA 1DYZA 1VESA 2ADGA 5JHDA 5D1ZC 2W9EL 3UX9B 3VH8A 2IVFC 4AC2A 5EUOF 4C83B 5J11B 3LKNA 2ERJC 1BYNA 3Q3GB 4N6QA 1Q72L 3HG1D 2ZXCA 4XMTA 1MFCH 3F3HA 1W72A 3OB0H 2XNAA 4QHLA 2DLIA 3EYVA 3HMXA 3GI8L 1KBGL 4IM8A 3GPEA 4JFHE 1M6UA 4UDTA 4CRPA 2LQRA 3WEAA 1NKGA 4L8SC 3W0WD 3C60C 2BP0A 4M5TA 4FD0A 1NCHA 3U9PL 3NPSC 4QLRA 4DVBA 1AG6A 2ICEC 3KGTA 1QACA 3N85H 3LH2H 2E7MA 3D2UA 4LSSH 4PJAF 4U7MA 5PAZA 2NTFB 3QQ9C 3ME0B 1LXMA 1QBBA 1HAWA 1ETJA 2J1WA 3P0VH 3S34L 3G04B 2CUMA 3DSFL 1QA9B 2X7LB 5F7MC 1C16A 4M61A 3MBWA 2W80C 5D9SA 3SGKC 1G94A 4RFOL 2ZXEB 3CIQA 5F89B 4G5ZH 4NNPH 4EDXA 1M53A 3ZTDC 1JGEB 1QOKA 3HS8A 3U4EA 5TF0A 4OCSH 3B9VA 5I1GL 4ES9A 5B38B 2QHRL 2Y7NA 5TE7H 2RTTA 3T4YB 1IBZA 2VDMH 2OM5A 4XRCB 2WVUA 4F2MA 5J06A 1BBDL 3OXSB 4MAYC 4G82A 3P4NA 4MNGE 1E27B 5J12C 5LBSL 1IEBB 4HWBL 3UAAA 3EBGA 3U0WL 3GBNL 5EZJA 1KCUH 4G6ML 1GJWA 1JPFB 1DZBA 4RX4A 3UYPA 1TZAA 1RZJC 2YGQA 2ZOLA 5ERWB 3S3CB 4CMMA 4XZUA 4E9SA 3QUML 4F24A 4DUWA 1MJUL 1HJBC 2B59A 2KERA 1JUFA 3FSWA 5B1BB 1Q9WA 1LK2A 1MCHA 4NPYB 4OM1H 1NANI 5E9NA 3SPCA 1M71A 4GBXC 2X2JA 5A2JH 5IHLB 1UHVA 3VM7A 1UM6L 5KSAB 2V5TA 3PDGA 4N4YB 3HE6B 1S7VB 3T5WA 1WC7B 4XN7A 1D7FA 4TNGA 5DGQA 3C8KA 2OTUA 5C2UB 2O72A 1AC0A 5SWSB 5EZOH 3DIFB 4KAQL 2PTUA 2W9DL 5C0BB 3RB7A 2N3JA 1BWMA 4BH8A 2LW3A 3ARED 3QUXB 3ZE0F 3FQXA 2JCCE 1DBBH 4H8WC 3ZKXB 4NBZB 1MG3C 1T22B 3LN9A 4TVSa 2NQCA 3BHBB 5T5NF 1HE7A 1KPRB 3NCFB 4Q9QH 3US1A 2QQLL 4KUZL 4OGYH 2XBDA 3KJ4C 3NSXA 4NQUA 1A3QA 2FR4B 1WGVA 1MVUB 4NENA 3KR3L 3QO1B 5HHQA 2E7HA 2XWRA 1ZT1A 1FYTA 1WIUA 2B1AL 3ECWA 3L16A 4MLSA 5AYUH 4F7TB 4PBXA 3FMGH 2NDGA 2OJ1A 5CGBA 1NJ9B 3TT1L 4AIZA 3GUFA 4X8CA 3ATFA 4HS3A 2FJFA 3IJYA 5KSUB 1I7ZA 5CR8A 1Y18B 1YNLH 5AVQB 2GJ6B 3FTWA 4GMSH 2E8ZA 3KPSE 4NWTL 4U6XB 3ZR5A 4OF0A 2YLKA 4OZIA 2ADJB 3MV9A 2NW2B 2KMWA 1U8LA 4HWBA 4IKIA 4OZGE 3WSQH 1CDUA 4OZIF 4MD4A 4BBWA 4HLEA 2DBLL 4LK4A 4BDVA 4EN3A 3L4YA 1J1PH 4X7CC 4ZG1A 4PTUB 4XXWA 5EEXA 4DGUA 2LLNA 1U30A 3QUMA 3SE9H 5HGBA 2HUEA 4N0UB 2MKWA 1QNZL 2FEDC 3TIEA 3TXAA 4P3CH 2XWEA 4PW9A 1I9RH 5EO9B 4N2CA 4TS6A 3DVNA 3SDDC 4LDCA 2EZ0D 5FUOL 3TVMB 2VKXA 3DRQB 4ZTPH 5BV7H 2ZUUA 3PL6B 4PV8A 1BD2A 4OCRL 5I5IA 5CINH 5H8DA 3RVTC 1INEH 1GRWA 3RKDD 3VGBA 2AGJH 4H1LG 3SDXA 1MREH 2VLMD 3T1FB 3QS2A 1A7PH 2YD6A 5IBUB 3SDXF 1MIML 1JD9A 4XPBL 1SVZA 2BFVL 3V6FB 5M7QA 4M7JL 3VFRB 3WAKA 4XNDA 4U3HA 1DBJL 3I2CH 5D7JC 1V55B 3OJDB 1CUOA 3T0DA 1K85A 2HLFC 5E2VL 4L9DA 3EGDB 4ZUWA 5C07D 3FTXA 5E1IA 3MC0A 3DX6A 3PIQB 4HPHA 3EDEA 5H37H 3MN8A 4HT1L 1KIRB 1YMME 3A21A 2A6KB 4WI0B 3UOAB 3ULUD 3DURA 3LHPL 4IBTA 1S9XB 1RUPH 4QHNA 4XCEA 3A23A 5MEPA 1RZKH 3FRPG 4N8CH 1NGQH 3LPWA 4RSYA 3N42B 3Q8BA 4BGLA 2X42A 3GSVB 4JFEA 4OLEA 3K2IA 3ESNA 1TNMA 1U8QB 4JFXA 5CEZD 4ZNCD 2OBGA 3KEHA 3DJSA 2J1YA 3CHXA 4DW2L 5ICZB 1TEYA 3QORD 3N43F 4WY7L 2VZVA 3QQDB 3RZCD 2RMNA 4WK2B 4Z95L 2CO3A 5AVUB 1JNHA 3S9DB 3WTTA 2IOMA 2WV3A 4C56D 1SMAA 4MBRA 2X4QB 3DV6A 5J56B 1KJ3H 1SJMA 3IT8D 5F88B 1DQQB 2W07A 3AROA 3Q6GL 1KGWA 1TQCB 2DWSA 4JPIB 4M4PA 4ACTA 3M6DA 2Y7QA 1DJXA 1PTZA 2ED7A 3BZ4B 4RMSA 2C7UB 1KBKA 2FEJA 4JHUA 5D6CB 2FO8A 1Y1UA 4YDMA 3QB7C 4FG0A 4FQCH 4MMYB 3PDOA 1URZA 3M17A 1QFHA 5L2KE 1UTDA 3L7FB 4UZGA 4MCMA 2BJML 1TQVA 4MJ6A 4PHZA 3FT0A 2H41A 2QMKA 1OAJA 1JTOA 3CXHJ 4FQHB 3TF4A 4WAFA 3TN0D 4MWFB 1JTTA 2AV1A 2C1PB 1NUFA 2WXFA 4H0HB 4NFCA 5AFAA 3AZUA 3NCMA 3DX8A 5DUML 1E43A 5B8CC 3LRSB 4FTVE 1PLGL 4Z7IA 2AQPA 1CU4H 3KPMB 3KLLA 4ZPTA 1XCTB 3VXTA 1UOKA 5C8JA 4Z78B 4WEUD 4ISVB 4WKZA 3DVGA 3J2PA 3C5JA 3OPUA 1ZRUA 1IFGA 3AM8C 4AL8H 2XI9A 4GAYA 4XCYA 2NXZD 3DMMD 4H0GA 1YG9A 1KZYA 5ITFB 4JKNA 1PKQE 1M56B 5AVVB 3QUKB 2NZ1A 5GJTH 3ASNB 3D06A 5AL0A 4I18B 4IRJC 1JGVL 1SDYA 1WWWX 2IANE 4A1RA 5IFHL 3P11L 3Q7JA 3IMUA 2NXYD 5EIIA 4B53A 1CE1H 4JRLA 1J5HA 3ET9F 3OHXB 4YDVA 1X6LA 2E75C 2FHCA 2J20A 4Z8FL 2JJTC 4PJCF 4QJ3B 4D94A 3BP7A 2BHYA 2HFTA 3CN1A 3BN3B 1O5DT 4IHOA 3TF7C 1WIOA 4JMXA 4ODTH 5HHVH 5J5EA 2BVQA 2ENPA 1QYGH 3PJNA 3F83A 3KPNA 5EC1A 2ALWA 3DTXA 4MRCA 2DAVA 1ODUA 2AJUL 3STZA 3ILEA 1UOVA 1OSZA 3BKCH 2FX7L 2WBJD 5I75B 4U3SA 3WFEL 2VQ1A 4BRVA 4OZHE 4U1GB 3VFGL 3CVBA 1T5WA 4LARH 1C5DA 4M7KL 5JR1L 5GISL 1BAWA 3WCYA 5EU6D 2C4XA 5GRUL 5T1MB 2SEBA 1N59B 3O9WA 5HYEA 5I17A 4F57L 2ARJA 1K8IB 4IEFB 2EVJA 5BV7B 4OUUA 5E0QA 3MBEA 1FJ1B 5ID0B 2IH3A 4JO1L 1FAKT 4GO9A 4PJEB 4CW1B 1MY5A 4OZGA 4LIQH 2DMKA 4OGAC 2H6UA 1KNOA 3RIKA 5F9DC 3VD3A 5DMYA 3BQUC 3SDCC 4DEPB 1KJ2H 5C2BH 4ODBD 4GRWH 2CIKB 4F9PC 3Q5YA 4OFIA 2COQA 2NNFA 4JRXB 5FKPB 4RAVB 3F65A 1KENH 3D3VA 5ABAA 4CVZA 5J13B 3CZFA 1NGXB 2IF7A 4QNPF 3QI9B 3CVHL 3RDTC 4Z18A 4D9QD 1XBDA 4QHUB 1BFVH 1KCBA 3RIFK 3TTYA 4Z7QB 1KTKE 3W39A 4MQSB 2W60A 3I74A 4MA3B 2BFGA 4N5ED 4WUUE 4XWOC 3WHXB 1L3WA 4JKLA 1OO2A 1IFHH 2EEFA 4MJHA 5MEND 4OAWB 4UIMA 4JL1A 2BNRB 2FWLB 3VI3E 4G7YL 1CIUA 1YYLH 2WIIB 3ES6A 3Q1EA 3CG8A 1KUMA 3BP6A 3KPRB 5DS2A 4PJ9C 4AQ8A 4HVBA 1U93A 3V0AC 4Y8DC 3O3DA 1UURA 4I3RL 2CRZA 4GFTB 3SE8L 1SY6H 2CLZB 2GSGA 4WDIB 3IGAA 4LSRL 5E2UL 3AGVA 3AREB 2UY7B 4NZRH 1OCOB 2HKHL 5B3SB 4YAQA 4HK0A 3PS6A 4DK3A 5BNXD 1WS8A 1SFDA 1V5JA 2R9HC 1SLUA 3KPPA 2ZX7A 2J73A 3FUEA 4NUQA 5GGVY 4RLDA 5ESQB 2PO6A 1KSRA 4LLAA 4NXKA 3QYCA 1J11A 4YO0B 5ECJE 3NQKA 3RWFB 1LO4L 1U2YA 2ZCLH 1FF5A 3P0YH 5F0PB 1YMMA 7FABH 3WN5A 3X14B 1YNTA 4Q74A 2DQUH 4GG8A 2VL5B 1RUAH 4BGDA 2V7NB 4S2SA 4FQJH 2EE6A 4ZZKA 3I50L 4ORZC 2FWOA 1GYWA 1S5IH 4G1MB 4L48A 1A5FH 1IGFH 3TJHD 1ANUA 4Q56A 3V9CA 4MLIA 3NJHA 1RJYB 3MNZB 4U3CA 4R5TA 1DUYB 1F42A 2HT2D 3P4MB 4KK6C 5DJZB 2PLTA 4LRIC 2GTWA 5EG6C 1RI8A 5DZPA 2APSA 1TJHH 4EAEA 3LKRA 5DWUH 2MOQA 1FG2B 3FOMB 4HA1A 4AUYA 1P7HL 3WJMA 4JDVB 4IIQB 3P73B 4L3CB 1OAKH 4UUJB 2Y36H 1BAGA 3IFNH 1KIPA 3R0NA 1QBMH 3H9SA 1E50A 1MFEH 2HVKB 3GMNA 4YHPB 2NMSA 4HFUL 1NLDH 4JM2C 4MMZC 2AHIA 4PS3A 4WHTA 3AB0C 3T04D 3D05A 2DLFH 3GS0A 5L2KA 4Q9BA 5AZ2H 4BKTC 3MUGA 1M7IA 4P05A 1WA1X 4G5AA 4KTGA 2FUQA 4FADA 2SODB 1D5MB 3X3FH 2FH8A 1AHWA 1JXJA 1XD0A 3IJEA 4FXKB 4L2YA 2H9GA 2V9RA 3O11B 3O6FB 2BS8A 2D4FA 2UV3A 3ZPDA 5J8OA 5FX3A 1JNNL 4XCCH 1WBZA 5IY5B 3ULVC 4MJ4A 5E0FA 1H3PL 5J7CC 5JORA 4BM7A 2OSLA 5F9WC 5KSVA 2F5AL 3RVVD 1AZBA 1XTMA 3CFJA 1MWOA 1D5XB 5F70A 5LGJA 3FU7B 4ZMPA 1BZEA 1F90H 2IDQA 2QFRA 4XPGH 2OXHB 4NRXB 2J1ZA 1E65A 3OAZH 2VH5H 4UT6L 1B0RA 1CFQA 4AYGA 1I3RB 5A7BA 1DQLL 1DBKL 4QPEA 3CFCL 3MR9B 4FC3E 4HU8A 1E9PA 1ZA3A 4YXHH 1URIA 2GTZB 4M8QB 3PGDA 3X13A 3ECUA 5FR3A 4YLQT 3NZ8A 4UQEA 1F3JA 1FVCA 2Y6SD 3T0BA 1I1AC 4Y5XA 1E5AA 1S7TB 1KC5H 3CN2A 4HIEA 1TZ8A 1AGFA 1DJZA 2XWTB 4LASL 4X5WA 3EGSA 1ULVA 4GI8A 4R5VA 3LY6A 5EWIL 4HH9A 3UACA 2DWXA 3IXTA 2OMVB 1F6LL 2HMIC 3PAUA 2EP6A 2WD0A 4WNQB 1QFUL 1E8ZA 1UA3A 4P5MA 3C5SB 4J4PC 1ZLWK 1C1EL 2Z93B 4A2GA 1TQBC 4J2QA 5KANG 1BCIA 4WVRA 1QRNE 2OLDA 3ZZQA 3RZCB 4OZHA 4G3YH 4WWKD 1KJ2B 3UZEA 4GRWB 2BMKA 4HX1B 1GAFH 3KYMA 4FJYA 2R69L 4FJZA 3K8LA 5DLML 4URKA 3R1GL 3EDKA 4DETA 5I71B 5FGBA 1I7TB 3CX5J 5HYJA 1MCJA 1AD9A 4XC1L 3GMRB 3DPBA 3GZPA 1N5AA 2YD0A 4KDWA 2MIZA 2YGVA 1ZXQA 3L3HB 4PRPD 4O02A 2DBJA 2IBZX 1T7WA 4X6EB 1RU9H 5JOEA 1SLWA 3DUUB 1EHAA 2OTWB 3A6BL 3L3DA 4YSTA 2BVPB 3B2DC 3HMWL 2H1PH 2IOIA 4YHZL 3RGVC 4PJXA 1Z0MA 3A6CL 1CICC 2ICWI 5FK9B 4RGMB 4PJXF 4Y1SA 5F7AA 2YFNA 5GGRB 3JYCA 2VABB 4PP1D 2N01B 4KJPD 1JWUB 4JAMB 1DFXA 3SQOL 4OKVB 3QIUC 2NY4D 5CSBA 1CXFA 2BNQB 4A2DA 1HEZB 2YA1A 4RRPM 1TOXA 3O2VL 4ZMOA 3Q8EA 4MZ2A 4JO4L 4QRQA 4PRHE 5BRZA 4I9WE 3HPLA 2UYLB 1KWKA 1E9OA 1IQDA 1FHGA 5GGVH 3FSZA 4A38A 2Z0BA 4PCSA 1PLBA 3H1ZA 2WN2A 3C6LC 2F7OA 5E8EB 3BEWB 5JDSB 2F8XC 1R3KB 4A7VA 2WYTA 2XWBB 5DEZA 5GRZA 1SJHB 2R4SL 4K7PL 4Z7WA 1OAZH 2XXMB 3QEUA 1INDL 1XEDA 3GSNL 4RGNE 4Z7WF 4KMTH 3FAXA 3NCBB 4MAZA 1JK9B 5K9KB 1IM3D 2YXMA 3TZVC 3K4DA 5KOVC 4JQIL 4DGYL 2WBJB 2X3BA 4PRAA 4ODXA 1CD0A 5DVOA 4MX7A 2K7PA 1OAQL 3EH1A 1NEZG 2W9LA 5EU6B 2FYYB 2D7TL 2OJZH 4I0CC 3UTPE 2LVCA 4Q4IA 3K6SB 4ADIA 2WBKA 2NW3A 1JBJA 5JW5B 4JJ5A 2IBBA 1GS6X 5J6HA 1G9NH 1ZHNA 3LB6D 3V0GA 2V8MA 3MNVA 4RWYL 5DF0A 3WIFB 1JZFA 3PWNB 5LJYH 1MI5E 1H8OA 1KLUA 2X4SA 4JK0D 3GS7A 3H42L 1MCBA 1CWVA 3GJEA 5BVJA 5DDHA 4U0RC 1RP9A 2IPKA 3CXDL 4KNTA 4TMPA 2XV0A 2VDPH 5CXPA 3MV7E 1MAML 1TNNA 5JHLH 4QXUH 2CBPA 3RVWD 5FA4A 4AY0A 2VRQA 1BMWA 3HHSB 2YD3A 2QL1A 4QKTA 2O30A 3NZHL 4XP1H 3VYPA 1AMYA 3ATBA 5EULV 3IF1B 5I1LB 5E4EB 4AGOA 4YLCA 1T4KA 3AW5A 5BUPA 3OGOE 4TYUA 2AEQH 1Z6JT 2P5WE 2XN9E 2XVBA 2X6VA 2FQDA 3KYAA 1WCQA 4GS7B 5CJXC 4BSWB 1QX1A 3UG3A 4P2OA 1RZ8A 2GBTA 2B15A 5D1XD 1Q8MA 5DD3H 5CCJA 4NN5B 2L7EA 4XE5B 3CLEH 2IXQA 5ANMA 4G8EA 2Y7LA 3E0GA 2H47C 1JPSH 1OSPL 3K2MC 4HCGA 4QYAA 4ZUSB 3TO4A 4B9KC 1Y6MR 3ZR6A 4XNXH 2WLYA 3ZYIA 1SBBA 5HDWA 3P3RA 2VITB 3BDBA 3ZE2B 4E9RA 4OD2B 4P4RA 1SUHA 5EBGA 4AIEA 4JQIA 1KYUA 1WS7A 3V5DB 4KDVA 4PP2A 3DOIA 3VO0A 4NYLB 3NDYE 2GK0B 3IBOA 4NKIH 4FFYL 2VLKB 3CFUA 4AX3A 2BRRH 4BFKA 1I4FB 2X88A 1RIUH 4X6CA 5EBMB 3GMLB 2YPLB 3BZ5A 1JRHH 4NHUB 4X6CF 3S5YA 4E41E 5ACMA 3V4UH 1X7QB 1CLVA 1BIHA 4Y2OA 1AYRA 5KBDA 4CU6A 1P5UA 4G6FD 1NBYA 4J1UB 5AKSA 3P2TA 2NYKA 3VXQB 2H3NB 2I32A 2R7EA 4HIJB 4N85A 4UILL 1UQSA 4RMQA 2EUWA 3V7AE 3CDYA 1QRNA 2EYTB 5CLZA 4QXGL 1OP3H 5AENA 2P7TB 1XCQB 2NY1D 3SE4A 3EO0A 1KEGH 3ISRA 4X5XA 5EZIH 4DGVH 1AG0A 3BWZA 5DJ8A 5EU4A 2ED6A 4ONFL 1JXFA 1KB3A 4XX5A 2Q6WB 1IUZA 4GXVL 1FQ9C 4BQCA 1EXUB 2CM5A 3LN4A 2DICA 4ONHA 1TVDA 4OLVH 4IDJH 4TSCL 4V1DB 1G0YR 4Y9FA 4K94L 4HK3N 4Y1AB 4JO2H 4ZSOB 1FL5B 3OQ3B 3ARDC 3QUYA 3L3GB 4PGJA 2X0VA 3PABB 4XVUD 3L95A 5IVZB 2YAMA 5JHMA 2AJYH 5I1IL 2UVFA 4LOVA 3QDME 1N2RA 5AG8A 1CQKA 3ARFB 4L4VA 2I24N 3UO1H 3HNVH 3FCUB 5IKCA 3L3KB 3ETSA 2NY3D 1MJJB 2IQAB 3LMJH 5GS0C 3D07A 3IKKA 1HQ4A 4YOKA 4HPYH 2KUTA 3KLKA 3NGBC 4E9TA 5I1HL 4HUVA 3HI5H 2V2XA 3NT0A 3S35L 4OSUH 3VWJD 1GW6A 1FSKB 4S1QH 5D1ZB 4OD1H 4FNQA 2RACA 4G6KL 1JV2B 1R5IA 3H6JA 1I1RA 3B2MA 4PRHA 1JFHA 5L0QC 1N8OE 4U1KB 4X6DB 5IROC 4QT5B 1XZWA 1JZDC 1T1YA 1UCBL 2Y7OA 4WV1A 3N1FC 1EJOL 2XXGA 4B9PA 1ZHKA 4LQFL 4OB5H 5TFSH 4OI7A 1OB1A 2DQTH 1GHFH 2IFGA 4IOFD 4PJIA 4NKDA 5AB2A 3WBDA 2R23B 1FFNA 4HAFA 2ZXWB 5EU5A 3C60B 4FX5A 2FT7A 3HB3D 1IAIL 4MD5A 3DYMA 4PJIF 1ECYA 4D0DB 5I9QC 2H6PA 1FZJB 1PF3A 2OAAA 2CJTA 3QYNA 4PWHA 1UWXH 5D1QC 4JFFD 1EUTA 3ZLQC 4HWEH 4TUJB 2CKBL 3CC1A 5K69A 2WLHA 3PP4L 1YDPA 1SGKA 3L9EA 1EO5A 4IW4C 2WLNA 3L4TA 4AT6A 4YVUA 5DHEA 3QJOA 5GXBB 4ZUUB 1VERA 2R0ZH 5L9DH 1PSKH 4OGQC 2VDPB 1BA9A 1U8NB 1Z7JA 3S8WA 1DQMH 4LBEA 3VX1A 2WWOA 3PGCB 4XNUH 4R90H 3WFDL 3R4RA 4MAYB 3IU4H 1ROCA 4NNYB 1JMXA 1DEEB 2KQMA 1GOFA 4NS0A 2DIBA 2F54E 4XI5D 2AJXH 2O61A 1NIAA 1FN4A 1I31A 3T2OA 4TSAL 4KGJA 2KT6A 4OZ4B 1DVFC 4X50A 3G5ZB 1NIFA 3ZHDA 3MRCB 4PR5B 5I1DB 1MCDA 1FO0B 2YGNA 4GRMB 3BO8A 3V5KA 1ZWIA 3QEGL 3WO4B 4PJHB 3F7VB 3FH5A 5C6TH 1O6SA 3DTUB 2HX9A 4ZI8A 1JGDA 5C0FB 4GBXB 2NR6D 3VMPA 2V7HA 1R3JA 4TULL 1HXMB 1A02N 2P5EE 4DP4X 1NCDL 3PAZA 4MJ2A 4P4KC 3DX9B 4YGVA 4J7RA 3K8MA 4NO0B 4PB9H 3N5AA 2NNCA 5GZOD 4HAKA 5T1DH 1RUML 1TETH 4XP9L 3MJ8B 3MXVH 3BIBX 3MOBH 5IHZB 1TT6A 2YBRB 4JFOB 4XN9A 2F1AA 4MHHG 3L3OC 4NQTA 4QRSB 2Y7SA 1C5CL 5F1IB 1HZHH 3F58H 1KY6A 3TEYA 3PJSB 2XZQH 1XF5A 4AMKL 4ZQKB 2TRHA 3SCMC 1JXDA 5J1AB 3RWDA 1F0LA 1JZ8A 2FIRT 2EDOA 3RNKA 2H4EA 2K6WA 3CPLA 1LDPH 1O75A 2VDRH 1IKFH 3G6JB 1L4IA 2Y4SA 3KJ4B 4JGJA 4NERA 4OH2A 1WD9A 2ZUTA 3X11A 2YWZA 4YBQD 3CH1A 4OD3H 3HLKA 1S7SB 1SDAB 1J8HA 1XAUA 1VDGA 3IPFA 3RKDC 2WWMD 2CKBA 5JUEL 1S78D 8FABB 5GHWH 5C0CB 5E2JA 3TO2A 3PHQA 5F97E 3GSOA 3MLZH 4ZOAA 5M95B 1JWSB 1PZAA 3T3ME 1DBMH 3ZL4L 1SJVA 4AZUA 4Q89A 4GO6B 4FTVD 4LT7A 4S0HA 1CI3M 3F05A 5FGSA 5IQOA 4BINA 5JQHC 1UXMA 3FB7A 3MLYH 5JW3H 3JWNE 4G6AD 3N06B 2WGNB 4NSKA 2ID5A 5IEHB 4L05A 4E41A 4LOUD 2UXGA 4KKNA 1UM4L 5KVFE 1KY7A 1UD2A 4CNIA 3DX3A 3MGAA 1XGRA 3QJHA 3ULUC 1DJYA 4FNLH 3MA9H 3TH2T 4G1EA 2Q8AL 2VZTA 5BXFB 3FSOA 3PLYA 5B1AB 2IAND 3DARA 1AQKH 1JI2A 1E0OB 1G9MH 5H94A 3SY0A 3SDDB 1BZ7A 4FLHA 2AK4E 4FXGC 1AOHA 4L4TE 1WGOA 3VXRA 4UU9B 2UY6A 2VJ0A 5TGBA 3JVFC 3ZZLA 3PU7A 4HOWA 4QCIB 3VXNB 3L13A 1KIUB 1R17A 4W6WB 3UJTL 1H6TA 2XTJE 1T7ZA 3O6ML 1MRCL 3TPUA 3QULB 1QSFA 3C9NB 5DRNB 3N41F 4WW1B 1XGPA 3VFTB 3Q1SH 3MNDA 2DQEL 3RTLA 5IQ9B 3AU1A 4JPVH 1IE5A 4H1LH 4NQQA 3LH9A 2CJUL 1WBXA 4FN0A 2E6JA 4R7DA 2OYMA 1K2DB 3O4LB 5D7JB 1G7MB 3C6SB 5DXWA 2XKSA 3MAWA 3QDMA 3EYOA 3V4VH 3VB9A 3VRLF 3UBXB 1ZIBA 4XNQA 3ZT5A 3POCA 5E4OA 1WCBA 2DYSB 2BS71 5CUSH 1KLGA 3TN0C 5G5DB 4EUPA 3DYPA 1S7XA 3UDWC 1E8XA 5HDBF 2O1AA 3HN3A 3IFPB 3GMOA 5C09A 2VZ1A 4YBHA 1N9PA 1WZLA 3BDYH 1NEPA 2DL9A 4FLOA 4Y9EA 5FFLA 5L4FA 1WHPA 1KN4L 1VAHA 1QFWH 4OLXH 1I8LC 1UACL 3FCBA 3MMEB 4HOMA 1Z5LA 2WTRA 5EUKA 2VJXA 5DA4A 4K5OA 5JOFA 4HPOL 1BVKB 1UZ6F 2P26A 4NNXB 5DD1L 1A2YA 4YZWA 3U9UB 1UCTA 2VDLH 3KGUA 1L9MA 3LQAC 1SOKA 2A5UA 2W65A 3IDXH 4PREB 3UPAA 2YPVA 2H2PD 3QZWB 4CILA 1LK3H 3J27A 3VFNB 1JGUL 3N44B 3Q9PA 1FIGL 1T5KA 1A9BB 2P48B 3SPJA 3X12B 4F58L 5HVHC 2NXYC 3MCLL 1J9TA 4WFFE 4UQ9A 2YFOA 4NJAL 4Y4HD 3WE1A 3IMRA 1N5YH 2CUIA 1D6VH 5D7LB 1Q9OB 3P4OA 4WUUD 3CFQA 3KG5A 3CVCA 4JDEB 3MNWB 3GFUA 3ZQ9A 4JDTH 3US9A 4I2XB 3B34A 2NY1B 2RA1A 2WWKT 1IIKA 1U4FA 2FATL 5CD3A 3BVUA 3WIIH 1A3LH 2GFBA 3BP4B 4FFZA 4HC1A 3UJJH 1KXTA 1PG7L 3L5IA 2W38A 5LDUA 4RMRA 3VXMA 5LWYL 1DFBL 3SBWC 3BAEH 1J88A 4JRYB 5D5MB 5BS0D 1HU8A 1HHJA 4X8GA 1VF5C 1X4XA 1NFDB 2AJSL 3KD4A 4RNRA 2K0RA 2V2WB 4ZMZA 1MZZA 1A22B 1FRGH 3VA2C 4DPRA 4ZDHA 1U8HA 4HSCX 1WISA 3OR7A 1E3ZA 1WEJL 2Q3XA 3CK0L 3RTQA 2CK0L 1FP5A 1PIGA 3Q48A 2VDRB 2A83B 4U1LA 5C9JA 3H7BB 4DZBA 4XVSL 4R4BA 3L1OH 1LD9A 1RL1A 3AGWA 4IU3B 5KYNA 4JREB 4RMUA 4QRRE 3ZTCC 4NCC1 1ZLEA 1FHNA 2O5YH 1DE4A 4N0YH 5ITBL 1G43A 3FQ2A 5GGTH 4ODUA 3VWJB 1RFDL 2V17H 2JKIS 4ANKA 1K9TA 3MBXH 4RGOL 4AYSA 5IJCC 1KTBA 1IT9H 1MXGA 3UPCA 1SXCA 3G5XB 4MA8L 1IQWL 1L7TL 2Y22A 3II2A 4R8WL 5FF6B 3FONB 4MA7H 4JUTA 1A8ZA 5D2LE 2X0WA 3KNBB 2L8AA 5DS8B 5ECGA 3ROLA 2WUBL 3R7RA 5E99H 3LNDA 2RCSH 1QVOA 1UH2A 4A6YA 1X5HA 3N0PB 2C3VA 4M03A 2FWUA 4D2NA 4LVEA 1WQVT 1ZEAL 4QTIL 2FB4L 1AP2A 2WVVB 4X4ME 1VSCA 4FYRA 4J8RA 1U3HC 2X89D 4IRSB 4JFFB 4ZFFB 1B2WH 1QFPA 1A21A 1NGPL 5TF1L 1ICTA 2J2ZA 4KKPA 5E5MB 2YBGA 3RILA 5I8EA 4D9RE 2I25N 5CIPH 1IRAY 2BM3A 3T0EA 1A7QL 5H4ZA 4XGZA 4HG4K 3OPZL 4J3VA 3VQMA 4HXBL 3D08A 3ZSTA 3BQUB 3D0LA 3SDCB 3NN8B 3UTSE 1AXSB 4NJ9H 2IH1B 5A40E 3A67L 1HSAA 2OCCB 3NACH 5ILTL 5T5FA 3GZOA 4HUCA 5FDWB 5FW7A 4X0KB 2Z3FA 4LVHB 3FQRB 4H1LB 4Q6KA 4FULA 4P2YA 1EIBA 2YA0A 3EUDA 3X1GA 1YEFH 2X3CA 1ZVNA 3QW9A 3V4VB 2CLVB 4FYQA 3V0HA 4OQTH 1NC4D 3TJHC 4DOHB 4WK4B 1UKQA 5IM7B 1NMBH 1SZNA 3T9WA 4JUSA 1YN6B 4XPFL 4TQPA 5JPNA 5IFAH 4GKNB 3U1QA 3B6SA 1ZCRA 3AQYA 1CFTA 1SEBB 3IDUA 1A0QL 3RRQA 3WFCH 3FUNA 4ZXBD 5B39G 4S1SL 4NKOA 1PY4A 1WAEA 3FXIC 3AJ7A 2VDLB 1H0DA 5IBTH 4WW2B 4YEEA 3RKPA 3TCTA 3FRPB 5AOLA 3T09A 3KPQB 3EGXB 3BLPX 4YK4B 3VXPA 2JJSC 3DOHA 4TQEH 3RA7L 1PZ5A 1QTYT 1OCZB 5K39B 3FOLA 3APCA 3E6HA 3IDYB 1ADQL 2G60L 5GZNA 1SHSA 1R34A 4R96A 5KS9B 3L5WB 1ILSA 3K6OA 1AANA 2PTVA 4Y4KD 5IESL 2NYYD 4Z7NB 4PS4L 4JPKH 2OSYA 5F7EH 3IEAA 4M62L 5D1ZI 1HXYB 3BYYA 5EN2A 5CCHE 4FQIH 3RVVC 3QEQB 2VAAB 1DZ0A 7PAZA 3EF7A 3ZKMD 1SMDA 4ETQB 2FJGA 5F3HA 1CFSA 3V55A 1K6QH 2YD1A 3P40A 4AITA 2YARA 3T6XA 4HKXA 3FNKA 4KY1L 2ZOKB 3LSOB 1RPQA 1CGSL 1DTUA 2GJZB 4LHUD 1KB9K 3RIFF 2RH0A 3APDA 2VNCA 2H32H 4PLJD 4RFNC 2R0KL 2BVOA 3FQWA 4RDQG 4XPAH 3QNYA 4NZUH 4OLUH 3JZ7A 1AQ8A 2X1QA 3WJLA 1IL1A 3BIKA 2HSIA 1F4XH 4JRFA 3DXAA 5T3XH 1TU2B 5DJ0B 4ZO6A 4PVLA 2Z4QA 2EO7A 3RWGA 3KWWB 3NJVA 1EEQA 3BKML 4LF3A 5CLTA 1UOWA 1OM3L 2RALA 1RIHH 1OGPA 2FD6H 4IQHA 3V79C 4ZMXA 2YD9A 3WIHL 1WZ1L 2MMXA 1XXFC 4WWKC 1PZBA 1XZ0A 3RWJA 2AXGA 5EBLA 2ICWA 4AYMC 4BA0A 4UINL 5C3LD 3FUDA 2VR4A 5BRPA 1NAMH 2BWDA 3TFKD 5EEVA 1E4XI 4XCNB 1WV7T 1FH5L 4QF1B 5IIEB 3MGOB 4ZUTB 2GAZA 1BFTA 3MVSA 5C1MB 3RY4A 5IV2A 4Y1TA 4KTDH 2VCOA 3ZDXE 4JG1H 3ZMEA 1T1WA 1YEHH 4HXAL 3U2JA 3BN9D 3ISWA 1M4KA 5IW1B 1ADQA 2ZZUT 3QJSB 2GY7B 4YX2H 1BSIA 5EIIG 1S7UA 3OJVC 3HS0C 4PB0L 3UG5A 1QLRB 1DVZA 1Z3GL 4UI2A 2J55A 3VTTA 2MPAL 3UTPD 4QRRA 4K3EL 1AR2A 4IRZL 5EO0B 5E6IA 1LNUA 4PWKA 4AGNA 1R3LA 1BWWA 1T0OA 3UBGA 4N0FB 5I2IB 4TNFA 3IWUA 3SJVE 3ZTJG 2TSBA 2D0GA 1Z2KA 5TQ2L 4HWZA 4ODSL 1OAYL 3MREA 4NQDE 1MI5D 4PP1C 2CCWA 1I3GL 2A3TA 4UZSA 4G8GD 5E2TL 2EDJA 1OAUH 2NY4C 5CIPB 2JQZA 1EK3A 2NNAB 3BKYL 5D2LA 1UXLA 4RETB 4BFGA 5DQDH 3EW3B 4UOJA 2IWGA 3IN0A 3IU3B 4G43B 4X7EC 1O7DE 5DZAA 1BOGB 2EO9A 4MASA 2C4FU 4BWWA 2WLIA 3NFSH 1AO7B 2HRPH 4LLVA 3GLEA 4RAUA 5ICXB 4X9GA 4ZMLA 1G7JA 2C3HA 4F5CA 3IDIB 4H25B 1JNLL 4YSAA 1KGJA 2G75B 2YXVA 4HEPA 4XXWC 4A7SA 5GS1B 3IDGA 4FG4A 4FEMA 3RWCB 4NQVB 4YQXH 4IKKA 4KRMB 2A1WH 2EXTA 2KKQA 2P5WD 4MKMA 2F5BL 2XN9D 3D48R 3QWRD 2P52A 4S1RH 5H35B 4ZK8A 4XMLL 1XX9C 3IFOB 1F41A 4NQCE 3IJ9A 4IKNA 3WIHA 2CA3A 4U7KA 4N9OB 4X6FA 3PV6A 3QO0B 2BOLA 5AVRB 4AQAA 5LQBH 1CMOA 4R97C 4MZRA 3ROOB 1N0XL 1X5AA 3B7RL 3P3UA 4N0RA 5FAAA 3RGVB 2ZT9C 3CCHA 1G6RH 4OVVA 1CICB 2W91A 3QDGB 2B2XL 2CXGA 4ZW8A 4FNPA 5DSCB 2W0PA 2I27N 4PGEA 3QIUB 3JYBA 1M7DA 2CA4A 1UH4A 2PNDA 1MCOL 1EDYA 1E6JL 4X9HA 4UT9A 4CDHA 3IDMB 4U6YA 5CZVH 4B60A 4EQ3A 2VN5A 1GPOL 2CZNA 1T5XA 5CGTA 1F1DA 4OIIL 2CBTA 2PYFA 2GPZA 3SGDI 4FZEL 4WENB 1BQHA 3C6LB 4PBDA 3EO9L 5C0AB 3BUYB 1KTDB 2MCMA 2OK0L 5GGSY 4LLYA 3MRDB 1WITA 3RVWC 4ES8A 4DK6A 1KF9B