1SXZA

Reduced bovine superoxide dismutase at ph 5.0 complexed with azide
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CU-ZN SUPEROXIDE DISMUTASE)
publication title Crystallographic determination of reduced bovine superoxide dismutase at pH 5.0 and of anion binding to its active site
pubmed rcsb
molecule tags Oxidoreductase
total genus 41
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1998-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1sxzA00
1JK9B 2NNXA 3HOGA 4BD4A 2XJKA 1Z9PA 1QUPA 2C9SA 2GBTA 1YAIA 1YSOA 1SRDA 1CB4A 1YAZA 1L3NA 1XTMA 2AQTA 2E46A 2WZ0A 1P1VA 1SXCA 1SDYA 3F7KA 4OJAA 1FUNA 1OZTG 1TO5A 2K4WA 3KBFA 3L9EA 4A7UA 1PZSA 1U3NA 1COBA 3GTVA 1PTZA 2WYZA 1B4TA 3GZOA 2Z7UA 1SXZA 3KM2A 2SODB 2ZKWA 1SXBA 1XTLA 5KBMA 2ZKXA 4U4IA 1DO5A 3MNDA 1E9OB 1AZVA 1F18A 2AQPA 4A7QA 4A7SA 2Z7ZA 3KBEA 3HW7A 2WWNA 4MCMA 4B3EA 3PU7A 1E9PA 2AQRA 1MFMA 1SOSA 1S4IA 3GZPA 1KMGA 2C9UA 3L9YA 1F1DA 1XSOA 4A7TA 1UXMA 3H2PA 2Z7YA 2XJLA 2LU5A 1UXLA 1E9QA 3S0PA 2GBUA 3CE1A 2WKOF 4A7GF 2WYTA 1OEZW 1OAJA 4A7VA 2VR6A 1HL4A 1Q0EA 1RK7A 1N18A 1OZUA 2AQSA 4L05A 3ECUA 2Z7WA 3KM1A 1IBDA 1Z9NA 4N3TA 1OALA 1IBBA 3QQDA 1PU0A 2VR7A 1CBJA 2APSA 1ESOA 3H2QA 1E9QB 2AQQA 1IBHA 1HL5A 1B4LA 1JK9A 2WZ6A 3CQPA 1F1GA 2WKOA 4A7GA 1BZOA 5CU9A 2AF2A 2C9VA 2R27A 1SXNA 1JCVA 3T5WA 3ECWA 2ZKYA 3CQQA 5KBKA 3GQFA 1TO4A 1DSWA 2VR8A 1E9PB 1IBFA 4FF9A 3GTTA 1EJ8A 1SXSA 2WZ5A 1SPDA 1BA9A 3GZQA 3KH4A 3K91A 1IB5A 2E47A 3SODB 2JLPA 2WWOA 3KH3A 1N19A 1SXAA 5KBLA 3HFFA 3LTVA 4BCZA 1EQWA 2ZOWA 2JCWA 2GBVA 3F7LA 2V0AA 2AQNA 1F1AA 1E9OA 3QQDB 2Q2LA 4OH2A 2AEOA 3RE0A 4MCNA 3MKGA 3ECVA 1SDAB 4BCYA 4N3UA
chains in the Genus database with same CATH superfamily
1YRKA 3OG4B 1USQA 2YPLA 1MW2A 2JELH 3NMEA 3FSVA 2E8YA 5BQ7A 1D5ZB 3EH5B 2FUTA 3T6QC 1K85A 2WM0A 4I85A 4PWGA 5DWUL 5DJCA 3FUEA 2FWOB 3BGAA 3CXDL 4J4PD 1AQMA 4WF7A 2YEQA 3ZKMD 4LL4A 5ENWB 2VNCA 1HVXA 1EV2E 5JHDB 3DRTB 3DVFA 1QBLL 4HXAL 4M7LT 1K4DB 1AAJA 1SDYA 4FG0A 4HFWB 4G9FE 3DX3A 1C1EL 2HVJA 5CGMA 3LPGA 4HFUL 1FL5A 5TE7H 4FQQA 2XCMC 3CZNA 1PY0A 1X5YA 1XB8A 5LGHL 3KDPB 2ZUXA 4LRNL 5EF1A 2VR9A 4OJYA 1DANU 3P40A 3OPZH 5HPOA 3QWRA 2EYTB 1C5DB 43CAB 3VD2A 2AAAA 3F65A 2BDNH 3T0VA 2IDTA 2YKKA 1I1AB 2WAHA 4R2GB 1B0IA 5HPMA 4Y7OC 4PJ7E 3BAWA 3KR3L 4UOW1 3UCQA 1HWWA 3B2UD 4RGOH 2D7OA 3L45A 4GS7B 4OGZA 4YDJA 4UT9H 3SQRA 3KLAB 1RMFL 4ZSOE 1MW3A 3HE7D 4JB9L 3AU1B 4Z7IA 3VSVA 4NNPL 1KB5H 3ASWA 3NIGE 1R33A 2L04A 4XP4L 1TQCB 3BO8A 2KBGA 3LN5B 4JKLA 4E5XA 3VCLB 4ANKA 4YFEA 2PCYA 2O61A 2E7LA 2V17L 4XNDA 1H3PH 5KSBE 2W81C 1MAJA 4TSBH 1NFIB 2IANE 1QP1A 3LRMA 1L7IL 2PMZA 4X5LA 2VLRB 4E2OA 2B5IB 4P2QA 5SWZA 1OT1A 2WYIA 4XNYL 1A6UH 1NFDF 4CVUA 1NBCA 3MGOB 4ZFFB 3KPSB 2P5ED 2W94A 4L48A 3OX8A 1UYWH 4XH2A 1MCPH 1RSFA 5F3FA 2J8UA 4K23L 4P2CG 4L4VD 2NY2D 1BZ7A 2PPFA 4LVHC 1X7SA 5IBUG 3DSFL 5KYWB 3GUFA 4XBEL 4IM8A 1QLEL 4LIQH 4CGTA 2QADB 1T0PB 3N40P 5FEBA 2KLRA 5HGHB 4H26B 3W0WB 1DQKA 1R5WA 1J9CT 4J3UA 5HHOB 5KW9L 2O5ZL 3BWUC 2ALAA 1E3ZA 4XOAA 4K7PL 3LIZL 4BKLA 1K5NA 2VXQH 5I17B 5ICYA 5DJAB 3HR5B 5HD8D 5KSAA 2K7QA 3C09B 5I1HH 5F0JB 4QRBA 4YHPA 1DVYA 3CFEB 5ETUB 5B1KA 2FHFA 1FAKT 4PGCB 4CADA 1JRHL 2WNXA 1LYQA 1TZ8A 2IFFL 2XA8L 3CFKA 4I89A 1CB4A 2OX5A 1NBZB 3LH2L 1KIRB 2Y1VA 5CM1A 4ADJA 3HUJE 3H9HB 2KT6A 1DZ0A 1QO3B 2G2RB 3WY4A 4A66A 4AZ8B 1ZGLB 3VDBA 3JWNE 4L3ED 1WA2X 3JWOC 2YWYA 5I1DB 4MA3B 1BOGB 3CU1A 1HL9A 3IU3B 3O3UN 1U0QA 4HP5A 4YWGH 4TQEL 3GZOA 4GSXA 4BFGA 1J8RA 4LARH 5DMGD 4KXCA 1YEJL 1T7WA 4QRQA 5ISZA 4R3SB 1ZDQA 3E7JA 3GSWA 3M7FB 3MNDA 3O4LE 2UY6A 1HTYA 2CO7B 3PRZA 4AYID 4TSAH 2DD8L 2I9TA 1HCYA 3BZDA 2XG5B 5MENE 3UADA 1BP3B 3EGSB 4NS0A 3Q5YA 3SJVB 5AG8A 1ZIBA 5DEFB 4HU8A 1CXIA 1Z9OA 4XWGL 4N5ED 4IJ3B 4QXTB 4Z8FL 2R8SH 1E4KA 5CO1A 1MXDA 1HQ4A 1KJ2H 3ZTCC 3U6RA 4O9HL 4PIBA 4UI2A 3WEAA 4R9HA 2WD0A 1NLDH 5C1MB 4YAQB 1J5DA 1OAJA 4YZFE 2V33A 3L1FA 3RI5K 3GXMA 1XCWA 4OZ4B 1UACH 1CFTA 1D5XA 1P5VA 4OLYL 4PRPA 4F20A 5I1AA 3AFLA 3TA3B 1VPOL 2XN1A 4KTYA 3UPCA 5KSVB 4B60A 4FHKA 2BVYA 4KJPC 3L3HA 5J11B 2ZQKA 1E43A 3OB0K 4TTDD 5LXGL 4U7SA 3BZEB 1KLGB 2H4EA 1NC4A 1KN2L 2HJKB 5IFJB 4J3WA 4J3VA 3ZBMA 2BMKB 2HRPL 1JZGA 4DQOL 5IW6B 2AEIT 4OV5A 4L8SC 3HB3C 5DJ6A 2AW2A 2ERJB 4HIEA 1S7XB 4FZ8H 1DDTA 1RU9L 2XZZA 4JY6B 5GRUL 2VXUH 2YD3A 3ZMNA 4URTB 4DKDC 3CLWA 4YSPA 4H8WC 3MCLH 4FYTA 4Z77B 2X0UA 4JJ5B 4NJ9L 3ABMB 5I6MA 5D2LB 5J0BA 3VVWA 3UJTH 1FIGH 3DGDA 5D5ME 4DHLA 3LKSB 4LDOB 4ODSL 4NAQA 2XG4A 4ENZA 2MNWA 2R23B 3FQWB 2XWJA 5AVVB 2Y2WA 2ODHA 3U7WL 1QBMH 3S35L 1GYWA 4FTVD 3CH8A 5EBGA 1UUNA 3N9GL 1JWSA 3UH8A 4XNXL 2DLEA 2WXHA 3CBKB 1JK9B 4C57C 1KB3A 2MCAA 2CDGA 1IAIM 1OTSD 2ROYA 5HDBF 3UJIH 4BD4A 1CE6A 5F96L 1JHKL 2H32B 1N5YL 5D2NC 2GAZB 1H3WM 3PPEA 3BVNA 3MROA 5D7SL 4WU5A 4OUUB 5T3ZL 2EDTA 2YFNA 3IGFA 2CBTA 1RJZB 3MHZA 4JLRA 3BMVA 1CGTA 3UTSA 5DMKB 3F7KA 4UOJA 2ZUTA 3TBYB 3QARA 1QSED 4X9IA 4N1CA 4DVBA 1NGWB 4FFYH 4BUGA 2SEBA 5DJXB 1IKFH 1TVDA 4UM9A 3B7RL 5D1XD 4KI1A 4JDEB 1FVCA 3L5JA 1UKTA 2JQMA 2R51A 3FFOA 4EUPB 4JPSA 3R7RA 1WFNA 2IV8A 3GXFA 4JHAH 4JM2B 3S2AA 1XCXA 4D0BB 1X4ZA 2ICEA 4XX1E 4G8GA 2WXJA 1TTGA 2ZX8A 3EJTA 2EDJA 1MVUA 3CSYB 4HMCA 3O8XD 4BZ1H 4FADA 1H0DB 2XKNA 3MXWL 3T2OA 1F45A 1JPTH 5BRPA 1EXUB 3TCXA 1A7OL 1R9FA 1FNAA 3S96A 2V9QA 2IH8A 5LGHH 3JT2A 4LRNH 3G5XB 3LEVH 4J27A 4AIZB 1QI4A 3BVDB 3E0GA 4D9QE 4EEEA 1G7HB 4RWHA 2OXHB 1ID5I 4WW2C 1EBPA 4AYFB 1ADQH 3VFPB 5DUML 2V2XA 1QW9A 4AYDC 3APDA 5TF1L 3IDIA 3P0VL 1WBYA 3FTGA 3T3MB 1UUSA 1SOKA 3UIZA 3BPCB 5B4MD 2R0WH 4HQQL 2NNAB 2NSQA 3PNWA 1Y18A 1S78C 2HTLD 3JYBA 4L0YA 1FVEA 1CK0L 2WVVA 3D0LA 4XB3A 4QXGL 1W6LA 4QRUB 2E7LC 1NEUA 1AFVL 3D08A 5I73C 4XP4H 1NLBH 1RH8A 2GTWB 1AGBB 4PPTA 4XN4A 1NKGA 3B2MA 3HCVA 1KFAL 4L3FA 1T1WA 1PZAA 3NZHL 2QR0A 4O58H 4PJBF 5FECA 3AREB 5B1JC 2GY5A 4HCGA 1AZNA 3BD4A 2OP4L 5B3NA 4QTIH 1AXSA 2PP8A 3LNHA 1I7UB 4A2EA 2ICWA 4JL2A 1T66C 3AG4B 5JW4N 1CFQA 1KJMB 3MACL 3P0GB 2VXSL 5JDSB 2HT3D 4XNYH 5I1LB 3UGXA 3D33A 5LQBH 1E2ZA 4LLVB 1PEWA 4OD1H 2I07A 3RY6A 3ATEA 1U3HD 2PPAA 4PG2A 4GMSL 5FHBL 4E0RA 4K23H 4CJ1A 2E9WA 5DJ0B 4ZUTA 2ADIB 3KJ4B 4I48A 4YPGA 1DQMH 1JXDA 1U8OB 5C0AB 4ZQKB 4XB8A 1M7UA 3EG9A 3WEXB 5E08L 4ZMWA 2FBRA 3NIFB 3FQ1A 3SBWA 3CX2A 1PZSA 3FCTA 5K59F 1FFRA 5GRYA 1AKJB 3RVWD 2O5ZH 4IU2A 2ZSWA 4K7PH 3HN5A 4MA7L 4MNQD 4XRCB 3HPLA 4EBQH 1YG9A 4DZ8B 2RTTA 3GHBL 1PYWA 1NMAH 3UG5A 5I0XA 3MU3A 1T6VN 5CD5D 1LE5B 1T7XA 2V3DA 4FI7A 2WC7A 3VGGA 4G80A 1RD6A 3B6SB 1JRHH 4P3CL 2XA8H 5D7IB 1KCRH 5GS0C 1E7VA 1RLBA 4OZHA 3CVHL 4F2MA 3E3QC 5E9DD 2UVFA 3WIIH 4ACTA 1DDHB 1I3VA 3S8WA 3TV8A 3UAJA 1IC7L 2OYKA 5E5LA 2HFGL 4TNGA 3IDJB 5CD3A 3DWTA 5JW4M 4YBLC 5DHVB 4TQEH 4HXBH 3VRJB 1XZ0B 2ATKA 1YEJH 3F7QA 3O41A 4IIQA 1DSFL 4PQXA 4ZAKB 4PHXA 4A68A 5GGRY 4DGVL 1N64L 2F6AA 1KLUA 5DURB 4GW5B 4UU9A 1GZQA 1B2WH 1E4KC 1M6OA 2W38A 4LLMB 1WWAX 2L7JA 1Y6NR 1AYRA 4IKIA 4JFQA 4XWGH 2YKLL 1MCJA 4RCAA 3HNVL 5FYLL 4DFHA 3JWOL 3TJHC 3H42L 3FB7B 4KRPB 3BGMA 4LMQE 4XPFH 1EJ8A 4O9HH 4X0KA 4I1PA 1JDDA 1DBML 2OXGA 3BQUC 2W60A 3F6JA 4JFPA 1FF5A 2VDNH 3DRQA 3PL6D 5JO5A 2RHEA 1JZ7A 4OCRL 4Q14A 4OLYH 3LNDA 1H3VA 3GEFA 3IFNH 3JYCA 4P2RB 1OAXL 3SDCD 3BLPX 3LRHA 4NHUA 4E9SA 5C0CB 2NQCA 4MQTB 3FT2B 4V2BA 4AKPA 1NQBA 3HKFA 1ND0B 2XN9D 1CXHA 2YD4A 3L5WB 3P02A 1NAML 3GSXA 1DBAH 2BP0A 3ZTEA 2DPKA 3N41B 5FM5O 5EIIA 1D3CA 1OOWA 5C7XH 5K69A 1PSKH 1NDTA 3P4MA 4XPTL 1EIBA 1KN2H 3D87B 4RAVB 4KKZA 4MTMA 4YR6A 3J07A 4HWBH 1VFAB 2DI9A 4ODHL 4PJFF 2V5YA 4DQOH 2CKBL 3DSNB 1A1MB 1ZSDA 1ZVYA 5GRUH 5FAAA 1Z66A 1AR1D 1JTPA 1XIWC 5CGYD 1DQIA 5BVJB 2QFPA 2HFEB 2NY3D 5CBAB 4BQ9A 2WZ0A 2EVFA 4BE5A 2C34A 2XNAA 2ORBL 4ODSH 2P48B 1V3KA 1MAKA 5DO2D 3HE6D 2P5EE 4Z7UF 1UD2A 1MI5B 2VDMB 1N7ML 3SCMC 4L4VE 4Z7OB 4N0UA 3N9GH 3U2JA 3R1GL 4NN5B 1RUAH 4QRRD 4ZUSB 3VFRA 3T1WA 5HDQL 1YEHH 2YBRB 4Z7WE 3WNNA 4ZW7A 4H8WL 3CLEL 4G11A 3FZUC 4A7SA 4E41A 1JHKH 4KKCD 4YSRA 1JZ2A 5JIKA 4XZ4A 1ACCA 3AB0B 3QC6X 5C3TA 4IKLA 4PFEA 5T3ZH 1J0JA 5F1IA 3BD3A 3ES6A 4CVZB 3O3EA 1KB9K 1DJXA 2X4RB 2OMXA 5I76B 2D0GA 5C0RL 4Y1AA 2B08A 4UILL 1YN7A 2BHUA 3FU6A 3IJHB 1GKEA 3KLSA 4HJJH 3RX5A 3D3VA 1H8OA 2PW2A 4PWFA 3VFWB 4ZMAT 3DGGA 4JK0D 4HS8H 1N0LB 1A9BA 1L7TL 3KL0A 4XC1H 1UOLA 5AOJA 1E9QB 1NIDA 2EILB 5CLYA 3LD8C 5C9KA 4JZJA 1MN4A 2WZ6A 2X2HA 3W39A 4WWKD 3CHPA 4WNQB 4BFKA 1KGWA 3MLYH 4JZNB 2VR5A 5KSUA 2ISDA 4PU2A 3F84A 4PJ5B 4H7VA 5T3XD 4FG2A 1MWAL 1OP4A 4WV1B 1EZVY 1RZ8B 1SXSA 1T89C 4FXGB 4WDIB 5IV2A 3FT4B 2AJZB 1X44A 4KTGA 5GZOD 2P3YA 4XBMA 1QFUL 3P3YA 2IFGA 5INDB 3GBDA 1NUNB 1PKQE 2LFEA 3R18A 3V4PA 4HUMB 2AS5M 5E1QA 1OK8A 2LU7A 3TESA 1BZ9A 4PJCA 4L4JA 1JN6A 1P4BH 4TVSa 5DUMH 5D1ZD 1T4KB 3G6DH 3P0VH 3B83A 1T5WB 5GS1A 1QRND 1FFPA 4N9GB 2CK0H 3LKPB 3VFOB 4AEIH 1CIUA 3EZJB 5LHDA 5J6HA 1CK0H 4R97B 4HOZA 4QXGH 1QLRA 2YQ3A 3LXCA 5B8CA 1IGML 1AFVH 1HFUA 2RFXB 4ZFOB 4OAWA 4OCXL 4PJ9B 5BJTA 4WUUB 1KFAH 3VRLE 3NRPA 4GG8A 3KXFA 2VABB 5AAWC 1BJ8A 4MMZC 3IMSA 1JTTA 1BWMA 4OFYA 2J43A 4FYSA 3EJJX 4KVPA 3RY6C 4HCIA 2AK1L 3K6SA 3CDFA 1CE1L 3FH8A 1RUKL 3TWCL 4L1HA 3MACH 4FQXD 3CTTA 3MLUL 4KVCL 4HH8A 4RRPG 3DECA 3RWFA 3GYRA 2UYLA 1KELL 3SE4A 4FTVE 5I30H 4GMSH 3LSOB 5FHBH 3WN5B 1CFBA 1ZIAA 3BPOB 3PHOA 4P3DA 5IR1A 5MEOB 4Z0BL 5CILL 1TJXA 2W0KA 5IQ7L 1E30A 4Z3FA 1KTJA 3KPNB 1OCWL 4BWUA 1ROCA 4ZMYA 3C5XA 3BKYH 3CZJA 2DQMA 1E4XH 1VFBA 1BIHA 4Z7QE 3MRHB 1IEBA 2C3VB 2XQYA 2FSEB 5IVXF 3NAAL 1Y0LB 4MA7H 1LD9B 2X4UB 3T0XA 5B39B 3EGDA 1XH3B 1QSFA 2IBZX 3GHBH 3BEWB 3QJRB 1AIZA 3TT1L 1QSEE 3T0DA 5FB8A 2QZQA 2YRBA 4YC2B 4FFVC 3IDMB 2H9GB 3UAJC 2GY7B 2BHZA 2P5WA 4KX7A 2R0KL 3EDKA 5D1XE 4XTRC 1OE3A 2WYHA 3CSBA 1AG6A 3UTOA 3NEEA 3CVHH 4RZCB 4JNXA 1OHQA 2FJSA 5I8KH 4JPVL 4OT1H 5E70A 1VIWA 1IC7H 5CUSL 2KZWA 2A0LD 1G7PA 2CA3A 4KU1A 4CVXB 2HFGH 3RWCA 1AGEA 1OGAB 4HUKB 3VI4E 3RHWK 4CMMA 1NMBL 2YPVL 5GRJH 3JTSB 2W91A 3RJDA 5K9OB 4YK4C 3L3IB 4Z7VF 3MR9B 1DSFH 1QFOA 3MI6A 1N64H 2N7BA 4NT6A 2MCG1 5GS0L 2BVQB 2J6EH 1TF4A 3WOVA 1G7QB 4DERA 4APQD 4P3WA 4C83B 3QORC 2OM5A 4GSDL 5AWNL 4BQBA 1CDUA 4I1NB 4D3CL 4GW4A 3VFNB 5EU6B 3S37H 1E5BA 2XV3A 5F1OB 5FYLH 3STZA 3TVMC 3SE8H 2R2BA 4PRBA 3JWOH 5HHQA 3SQOL 4U6VL 2UWEA 4TKWA 3TBWA 3FO9A 4LNRB 2QFRA 2QQKL 5A2LH 1FHNA 1G4MA 3VSTA 1FN4A 3CHRA 5H94A 4WI3A 3I9PA 1ZPLA 3ULSB 1WK0A 4LLUA 1NGPL 3MV9A 1XF3B 5B21A 3EHBD 4K71B 5I0YA 1BBJA 3SYQA 1WF5A 3ESVF 4PJGB 4RSVA 4GQ9H 4MS8C 4ZMXA 4PJEB 4W68A 4XZUA 3G5YB 3D2UD 1OAZL 4W70A 1D7FA 1I9IL 1KIUA 3KM2A 4NKIH 5IG7B 4F9PC 5L2KA 4AI7A 1BBDH 5MEPA 4YE0A 4D7BA 1EERB 4V1DA 2Q3ZA 2AABH 3M1CA 1G7IA 2CKBH 4XXWC 4DF9A 2H26A 1NOAA 3QJQB 4J3XA 2XN2A 4U1JA 1HJCA 5K9QI 1JDAA 2EXYC 2Z31B 3HMXH 4GQPH 1S4IA 2DB8A 5BO1L 3P0YH 5F9OH 3LKRA 1CXFA 3Q05A 2GBAA 4L8BA 1H6EA 2WNGA 2WQ8A 2GJ6B 3QRFM 1MFAH 1DBJL 1HHGA 5EOQH 4QPEA 3ILDA 3IN2A 2Q3XA 5EEWA 1J48A 1YEFH 4K94L 1TDQA 1MHEA 1QEXA 3WY2A 4O2CB 4L1DA 2V4LA 3EYOA 5EORL 4UQEA 2V9UA 3R1GH 3OHMB 2E56A 1IVTA 3AMKA 3JZ7A 4OLWL 2X2IA 2P49B 2BNUA 2A6IB 3REWA 3E6FA 4XGZB 3LNGA 4JX0A 2X9XA 5EN2B 3LOWA 4PJHF 4H8WH 3ZTNL 4IRSB 1EFQA 1M7DA 1R1CA 4A39A 1U21A 1NCIA 4M6NL 3TC9A 1NL0H 3C5ZD 4GKLA 3ZHFA 4E42B 4NUJB 4KMTH 4UILH 3SE3A 4OV6F 4RISH 1KGIA 2DQFB 1HHJB 4KKPA 4ZX3A 4JDZB 4UM8A 3MX0A 5E6IB 4X80L 5E9DE 3FOLA 3APFA 4Q6IB 4BWTA 5FDWA 1NBQA 5E2UL 3TO4D 1L7TH 4LEXL 4U7MA 5EZJB 4DTGH 1L4IA 2JV6A 4JN1H 1CF1A 3IT8D 4HZLB 3QG6A 4LVNC 1MW1A 3ESNA 4OZGF 4PUBL 3L3DA 5D1QA 1JZ8A 4LHUB 2WLLB 3I6GA 1ACYH 2CCLA 1BVNT 3NCCB 1UD5A 1AO7E 1UXWA 3CXHJ 1YEGL 2P8MA 2X88A 3GMOA 4MLSA 3W9DA 3V6OA 2B59B 2EZ0D 4X6DB 3QIWD 4MAYA 1JXFA 2CLZB 2LV4A 4RGMC 3ULUH 2B20A 2NYYC 2DICA 1QKZH 3X14A 5DC0A 5ESVA 3O2DA 4RBPH 3STLA 2FQFA 2Y1ZA 2VZVA 1X3DA 2DTSA 4E9TA 2EDLA 5GS1C 1LDSA 2X89D 4HSCX 4LAQH 2XQYK 3TBTA 4DPCX 2EO1A 4OI9A 1HXMA 2Y07L 2GVYA 1M71A 4LHQB 4X5XB 3FO2B 2B1AL 3DARA 3ILPB 2ZXWB 2HJFB 2YUXA 3K80A 5EPMA 3F6IA 2LVCA 4XVSL 4NBYB 4R4BA 2IPUK 2RQEA 3QUZB 3OG6B 2AAVA 3HC0B 4JRXB 4DN4L 4AKOA 2DYPB 3ROLB 1J1OH 1IGMH 5C0GA 4X6EB 1W8NA 4B9PA 3DX9A 1FNGB 1NUDA 5AKRA 2QL1A 4OCXH 4OI8A 1S9XB 2ARJA 4JFDD 2WTRB 1Z9SB 4ODTL 1JF5A 3RUGA 4L3AA 3WMSA 1U4EA 4FERA 3EOBA 3HBPA 2NZ9C 4WJKB 1K8IB 3GSOA 5E9NA 4JKPL 4X98A 1QR1A 1JPGA 3BEVA 3FQTB 1YQVH 5IEHB 1VENA 5J13B 1RUKH 4I2XA 3V79C 1D7CA 3L54A 2ZSVA 3MLUH 4KVCH 4Y16C 4XN2A 3RVUC 3EYSL 3MMEA 1UHVA 1Q72H 1ZV9A 2HFTA 1J5IA 3H3BC 1JDCA 3IXTA 5T3ZD 2E3VA 4NXKA 4JVUA 4QRRE 5AKVA 5TDOA 2PABA 3I84A 3IWVA 3OHXA 4TNFA 2NYZA 3LZFH 4ZFQA 4QRPB 1KYAA 4K3JL 3RFRA 3HS0A 1K3ZA 3FT3A 3O6FD 1XGUB 4Y2OA 4TM9A 4ZXBD 2D2CC 3O9WB 2NY1D 1A6TB 2V37A 2CGYA 4EQ3A 1O7DC 4GRLD 3RB7A 4LE8A 4EN3C 4PRHB 1YMME 4UNIA 4HIHB 1GHFL 2IDQA 2B3IA 3BC9A 4I87A 1PS3A 2E6QA 1C5BL 1GIGH 2R0KH 3ULUF 1X7TA 2P4AB 1BDYA 3ORJA 4G7VH 5TDNA 5ALCH 3S97C 4LCIH 3N50A 1TVHA 4JPWL 4AXWB 1IM9D 1HHHA 1KACB 1SNRA 5CUSH 2ZOOA 4K5PA 2FIKB 3UTTA 3U9PH 4KK9D 4DGYL 3O45A 4AQ1C 1E8YA 3L95A 1HXYB 2DWTA 3WI9A 3W9EB 1CL7H 2M26A 4HGMA 4LSTL 3L1OL 2VDRB 4G5ZL 2RIKA 1THCA 4QHKJ 2IDSA 5T3XE 3ME0B 1IFHL 5FCSH 2Z0BA 3NVQA 4WU7A 2K78A 4HBCL 4AQ8A 1E50A 5A16B 3RTQA 3M17A 4EJ1C 4NO2B 4GKSB 5FYKH 1ZE3C 1G43A 1NCAL 2F2HA 2KHAA 3PP3K 4F5CE 4IOSA 2JTYA 2ADJB 1GR7A 5LGJB 4PB0L 5J6SA 2BIHA 2XWEA 5ID0B 1BVKA 1FE8H 4KROC 1SJEB 2BERA 2DI8A 4G43A 4IOIA 2QQKH 4PP2B 2YWZA 1MLCB 1Y6MR 5IP4A 1B4RA 2YJLA 3MJ6A 5C6PB 2BXYA 3UL4A 4LQFL 7FABH 3BW9A 4K5OA 1QRNE 2DLTA 3QI9B 1W0VA 4PN6A 3Q2WA 1OARH 1QG3A 4EUPG 1V54B 2ZD0A 1OV8A 1LMKA 2YFOA 1TTBA 2DAVA 1ZKAA 3OKOB 5J1AA 1RFDL 1OAZH 2QSVA 5F1SA 3ZT5A 4XMTA 5E94B 5DJDA 2VC2H 3ZDZE 2ICCA 4LCYB 3KAAA 4KI5F 1V8HA 3HMWL 3LKNA 3PXLA 1DJHA 3AQXA 4NLHA 2WZPA 4AUJA 2A74C 2VDOB 4Z7NB 5BQDA 1TKWA 1N59B 3EF4A 2ZXAA 5JOPD 2IDFA 2WKOA 2C9PA 1ODAA 4IHOA 5C2UB 1XDTT 3BH9B 4KMQA 3CZUB 2VQ4A 4YHNA 4L2YA 2OZNA 1ZT7A 3V4LA 3VQ1C 2CO1A 1TITA 1MFEL 3V6FB 1KEGH 1DBJH 1N0XH 4PAZA 4NM8L 3Q3GA 5M95B 1BFVL 1T2QL 5BZDB 3OLEA 5FW7A 1SPDA 3A21A 4M3KB 4RMBA 3DUHA 4K94H 3TEZA 2A7BA 3AY4C 3QQXA 2XTJB 2C8NA 3K6IA 1VGEH 4Y0GA 4R5VA 5AOZA 4OLWH 3RKPA 4DKFH 4XMKL 2Z8SA 3B2DC 1OAQH 4L37A 1H6TA 4M1DL 1C7TA 2X4OA 1XX9C 1UJ3C 3SEPA 5DTFB 4ZUVB 3ZDXE 1UM4H 3MRKB 4X5WB 2Y4SA 4R84A 4XOCA 4FXLA 3GMNB 5SV4A 1JZHA 1G1KA 1KENL 3FBQA 1QPKA 1YEKL 5E4EB 5IKCA 3ZKNC 1MFBH 1F2XK 2MOVA 3BAEL 5CCHE 2HKHH 4HOWA 1E6OH 4X80H 5G5DA 1EH9A 4HEPA 4PLJC 2BSBA 1LO5A 4ZPVB 5CSGA 3CZEA 5C09B 2EYTA 5I0DA 3RVXC 43CAA 3RPIB 2V2TB 3FTYA 1S7WA 3BVXA 4EN2A 4S1DC 1GMEA 3MRLA 4FFZA 1A66A 1I1AA 1UJTA 3WJJC 3PWJA 1IGJB 1B6DA 2FGWH 5FYLD 3D30A 2JQAA 4YSDA 4KFZC 1E4WH 4JQVC 3QUXA 4FL4C 5LKNA 1M2OA 3EO1B 2MQ0A 2IALA 1JMXA 1KCLA 4TLSA 4X7SL 1GVIA 1TZOA 1IGYB 1DEEB 1PZ3A 3AU1A 4NZUH 4P5SA 1WIUA 2X6UA 4CU8A 2J8HA 3DI3B 4HW6A 7PAZA 4JE0A 5JTWA 3RJOA 5BV7C 4X8JB 4P4KB 5HI5C 1W91A 2ZP0T 4XP5H 4IMKA 3MA9L 2RACA 3GKWL 4UNUA 5C0IB 4AUYA 5AVXB 5I18H 2ZAGA 2Y07H 1KCKA 3QXDB 2Y2YA 2B1AH 1GCYA 4U1MB 3DTDA 3R19A 4Q56A 2XTSA 4FZEL 3FQUB 2CLVA 3ZO0A 2BO0A 4HIIB 4M62L 5J56B 3QQ3A 4DN4H 2FATL 3U79A 4MNGE 1YNKL 3MA7A 3KPSA 1KSRA 4KJPD 4OLXH 3AITA 3LS5L 3Q44A 3X2QB 5JW5B 4A55A 1X5MA 2VR8A 2BVPB 3UO1H 4ODTH 3SKNB 2BC4B 5ALBL 1L5GB 3AC0A 5HGHA 2V7NA 1IM3B 3LXAA 3K4DA 4H26A 4KKLC 4CNIA 5KS9E 1GTFA 3TOPA 3VXRB 5LNGA 4OZIE 4GKZA 2IMMA 4RMQA 5JQ6L 1SM3H 2QBWA 4JKPH 3EYQC 3HB3D 1FG2B 4BK8A 4N2MA 1JNHB 3QEUB 3G5VB 1WS8A 5B7FA 5HY9A 3DURB 3FQRB 1DP0A 3OKKB 3A23A 4M6MH 3UJJL 2X41A 3P3UA 4N2CA 4NQCB 2C7UB 3WXWL 2YRZA 3FONB 4OH2A 3AAZB 3T2QA 3B1TA 1SJMA 3GMLB 4OFKA 2AEWA 1MF2L 4R7DB 1BD2B 2RCSL 3BP6A 1Z9PA 1NM9A 2F58H 4I0PA 4HWZB 4TSCL 1SHMA 3VVVA 4PRAA 4MA3A 1BOGA 3SBRA 2HH0H 2FBJL 5DD1L 3LKOB 4I13B 5K1NA 2QTEA 2YQ2A 3QZPA 7TAAA 2P43B 4N0FB 1GHFH 4NQQA 4RFNC 3VM5A 2FNBA 4DW2H 3NG5A 2W8CA 5HYSB 5JYMA 3RDTB 1PTZA 4XNZC 4XPGL 3L3OA 3AQZA 4WHTA 3NESA 5IVOA 3SJVA 3R06B 5FOBB 5DEFA 4B6ZA 1QUNB 3HEIB 3IJ7A 5H35B 4Y4FA 4AIOA 5E8PB 2YPLD 4MD5A 4YSAA 4QXTA 3U4EA 1J5CA 3FCUB 1MQ8A 3NABH 1WCBB 5L7XL 4DGYH 3WO4B 3C2AL 3T09A 3U30C 2D0HA 2HUEA 3ARQA 1FZJA 3L1OH 3V6ZB 4YAQA 4GRWH 2F54D 1W9XA 2E9JA 4LSSL 2WTPA 4OZ4A 3D8MA 3IJEB 4PY7B 5FC9A 2ZX9A 3MFGB 2VN4A 4AGOA 5KSVA 4M61B 3MYZA 4HBCH 4CSZA 1E7UA 3PWPD 1OP3K 1XF1A 2FLBT 3BZEA 3RIKA 1IAOB 1B4JL 1I9EA 1KLGA 3ARTA 3MJ9A 5DVPA 3QWRD 4N3TA 1BW8A 1FPTL 2KUTA 4OD3H 4ELMA 4LZKA 2FZ3A 4TQHA 3CPLA 2COVD 5DZ9A 4B95C 2N7SA 2VUKA 1A3LL 2NX5B 3GZKA 3N1QC 5LBVA 1R0AL 1U6AH 3K7UA 4YDVB 4LQFH 4PV1C 3UGEA 3VNZA 1GGUA 1TO4A 2YMOA 1MJ7L 1ODUA 1BQKA 2H6PA 3GRWA 1O7SA 4IBSA 5F9WC 3LKSA 2EKJA 3CVDA 1JNJA 4EKXA 1U2CA 1O5DT 4YDLC 3ZRSA 4WI7A 2CDEA 4MS6A 1I9RH 5HSFA 2FBOJ 1AHKA 4DVRH 1M53A 4ABVA 1S78D 2HP4A 2LU3A 4RDQG 3WSQL 3DX6B 1I8LA 1J9RA 4RDQF 25C8H 2BLFA 4JFDE 4LOEA 3SY6A 4CBPA 3IPBA 3VXUD 4OF3A 2GAZA 5BMFH 1QLFB 1BVNP 3WNIA 1S7UB 3ULAB 2GW5A 3QWOA 1LHZA 4EOWL 4OBRA 1RJZA 3F7YB 3OMIB 3X3FL 4TOYH 2EADA 3FOMA 3D09A 2VLKD 2R1YA 3NFSL 3NSFA 4G42A 1YAIA 2WLNA 3ARBC 4YSTA 5ITFB 2O5XH 1T66D 5I2IB 5DJXA 5CEXB 3K2IA 1AO7B 2NR6C 2VQUA 2NY4B 2BNRA 4HT1H 3DKHA 3MLXL 4OCMC 1S9WB 2QVTA 4HKJA 4X6FA 3SSGA 4Y4KB 2FL5A 3P73A 5C07A 5SWSD 2ZX6A 4IYKA 1F02I 4YEFA 4EIZC 1COBA 3B8SA 1DFXA 4JM2A 2A9AA 2XWTB 3HJ0A 2ENSA 3D69B 2JSFA 4OZHF 5KOVC 1EFXA 1HOCB 5EBLA 1QNZH 4AE1A 1Z2KA 4HKXA 5GHWL 3QZWB 4UIMB 3QQ4B 4GSRA 4RQQA 3SGEI 5C2BL 1E6JH 4Y2NA 1LO3L 1R5VA 2DEYX 1VEOA 4R8WL 2J1XA 3QEQD 5C0EA 3BAEH 4GAYB 3OZKA 4WLCA 3EIFA 2EIEA 1MHHB 2JJSA 3LDBB 3MGAA 2P1YA 1I1AC 3KPMA 2IBZY 2IC2A 4R2GC 4AIZA 3DGCR 4DOHE 4QKXB 1JZDC 3C6LA 1MQKH 2QHRL 5GS0D 4U0RB 1ZVHA 1WBXB 2CO6B 1G7HA 4LASH 4U7KA 1FJ1A 4QD2E 4GS7C 1AOHA 3HS8A 5IQLA 4O2FA 4AYFA 3VFPA 2YSSB 1KCVL 5T5FA 2BVTA 4LFHD 4XCYA 3QQDA 2APSA 2UX7A 2Y24A 1NGZA 4KDWA 4MQ7B 1TQCC 2I69A 3QG7H 4EZKA 1MRDL 3L7FA 4WTZG 2XKSA 4X7SH 1LEGA 1R3KB 32C2A 4MDIA 4IMKC 1CD8A 4QRUA 3WHE0 2J1WA 4YFLI 1A9EA 1AY1L 2GTWA 2OCJA 1H8NA 1BZ8A 4F9LA 1EJFA 1MVYA 1OTTC 2JK5B 1ZS8B 2LLLA 2IGFL 3FT1A 3MFFA 4XMWA 5DK3A 5EA0H 5B39G 1B3IA 3CDGB 2B5IC 1IGTA 3GKWH 1TSHA 5FA4B 3TJHD 5B3JE 1AGDA 3KPPB 4PRPD 3O2DL 4OF0A 3KH3A 4GAJL 3CDZA 1LEIA 3F8UB 5F1NB 3GMMB 1RZ7L 3GSRA 2VTFA 4YUEL 4M8UA 3V4PH 4JY4B 2DOCA 1JERA 4FZEH 1LQSR 1CD9B 5ACMA 3VFGL 4MD0A 4M62H 4G7RB 4LLVA 4A37A 2NTSP 4MCZB 1ZV2A 2QTVA 4YHIA 3RZCB 1YNKH 1A5FL 5BV7L 1CJYA 2QADC 3HAEB 2BOBA 5EO1A 3HC3L 1XF5A 4PJIE 2F5AL 1Y1UA 5AVZB 3LS5H 2DWXA 3WMPA 1XCQA 3MUY1 4AWJC 1YMMB 2X2JA 2K0RA 4ZODA 3ZE2E 3CMOH 1R5IB 4PS3A 5JOPE 3B9KB 2K6WA 1YEWA 4L4TB 3C09C 3MJ7B 2C4XA 4XE0A 4GPVA 3QZMA 2ZT9C 4YXHL 2Z8RA 5GGQH 4DZ8A 3CFQA 1XIWD 3LZRA 3UJJH 4Z3HA 2AEPL 2VN5A 4OSUL 2E76C 3WXWH 2NXZB 5JW3H 3VUAA 1SXZA 3WS6C 1RPKA 4NC1C 4HUNB 2H3KA 5KYXB 5MP6L 3REVB 4QLWA 1PAMA 5KWYC 1HH6B 1JD9A 1GC1H 1MF2H 3SCMD 4E9XA 3D39A 3CVBA 2OMTA 5DJ2B 2EDHA 3TN0B 2GJZA 4OIAA 4ZRGA 4N8PA 4LLYA 3UTSD 1R47A 2C9QA 2EYRA 5DHVA 2MKLC 3FZUD 4WAFA 1HCFX 1QHOA 3F64A 4FLQA 2ZYRA 1XZ0A 5BZWB 3FO0L 4DN3L 4LPWA 5G2NA 1MJ8H 3TP4A 1WFTA 1LWHA 1TVBB 4IJ3C 4TUJB 2P9RA 9CGTA 3LAFA 1L9TA 3L4TA 4PM1A 3AQDA 1NCGA 1N18A 3POCA 5JA9A 1NBVH 2E7DA 3JTTB 4PGDA 4BSJA 3RWJB 1ESOA 3L8QA 3VDAA 3INOA 1J87A 1JHTA 2VLJA 4HH9B 1PPIA 3ZO9A 4GXVH 5HGAB 1BZDA 4Y5XA 5D7JA 2V9TA 5JIMA 2PYFA 1WT5A 1Q0XL 4U3HA 4O4YH 3TA3C 4G8GD 5ACZA 2AK4A 4DFIA 1I7TA 4ZZKA 5EBMB 1BFSA 4PRIB 5J11C 3ZDZB 5FO7B 1N67A 4LSSH 5DK2A 5CIPA 3KLKA 3MRNA 3Q8BA 1F4WH 4PJCF 2B9BA 3VWJA 3C60C 4OCLC 5IFHH 2GIYA 1M7IB 1LK2B 4PD4J 4TNEA 3DXAA 4PJDB 4LOFA 5E95B 2ERJC 3MOBL 4I9XA 5I1IH 3G6JF 4TLUA 3R0MA 2UZXB 4L1BA 4O02A 1BVOA 1RURH 1VFAA 3QUML 5EZPA 4L29A 1OF2B 3MLRH 4YX2H 3DUSA 1A1MA 5I5MA 3D9AL 4JFEB 4E9RA 1OWRM 1WGOA 4X7CC 4YLQT 2OL3B 1WG3A 1BIIA 1BREA 2DYSB 3NPZB 3U2IA 5KUKA 2HFEA 2ZUVA 3DPBB 5CBAA 3JVGC 5IQOA 5CJOL 2NY7L 3ZHLA 4LP4A 4X5QA 5F7HA 1QVOB 4BXVA 2IXQA 3MSPA 1JOIA 2VJ0A 4MJIB 3FFCD 2IQ9H 3MLTB 4JO1H 3CZFA 4LHUG 3MBWB 4WCYH 1P4LB 1Y07A 5KTEL 3QXAB 4HUXB 4G9FA 2P45B 4HIJB 1HJBC 1BJ1J 1NGQH 1YEEH 3BVTA 2DH2A 2C1PB 4PJXF 1GS8A 4JFXB 1J86A 2Z3FA 2DDQL 4EOWH 2DLFH 4XHJC 4N0YL 3IK2A 4CVZA 1P7QB 2X4RA 5JXAH 4JG9A 1BQSA 1CLYL 1G6RB 2FWSA 3NFSH 3WGUB 4AH2B 1FC2D 1U8KA 4NKDA 3WY3A 2YUVA 5BS0B 5LNEA 2EIKB 3M45A 1HIML 4PJ7A 3L08A 3UOAB 2VE6A 3CFIC 4RFOH 2IPUG 4AGPA 1MIML 1RZKC 3L7EB 4L5FH 4P99A 1E9QA 4PGJA 1A7QL 2PWGA 2UZYB 4QOKD 4ZSOA 3GXTA 4ABQA 4BV1A 2A2QT 2I60H 3CZSA 3VXPA 4MJJA 2PTUA 2EVHA 3FQNA 3CFUA 5GHWH 4MD4B 3KWUA 4ODUA 5C2BH 4X7TA 2XTLA 3EH2A 2R59A 2J4WL 1R34A 1NDMB 4EF3A 4MZIA 1KTBA 4RIRB 3ZTJH 4WDIA 5KSBA 1MXGA 1GMIA 2NY5H 1QHQA 2ITCB 3MUJA 2IANA 1A14H 1AACA 3MRCB 3BRDA 1JWUA 3CZLA 4FFVD 3UAJD 3HHRB 3IJSA 2JI1A 4XTRD 5INDA 1SMAA 1B0GB 1DLHB 1ZTMA 2H2PC 3CVCA 4WHYG 2F54E 3ZE1B 5LGKA 3PS6A 1KCVH 4K9EC 1T4KA 4D0DA 3QFJB 1QWUA 5DHEA 3BP4B 1AKPA 4H88H 4ETQA 1DCLA 3SPCA 4PB9L 3WAJA 3ESPA 3IF1A 3QAQA 3F2LA 1ZLSH 4JFHD 1MRDH 3PWPE 5JHLL 2FH8A 3LKPA 3QJFB 4KZDH 1ZT1B 3VFOA 3A0OA 4M7ZB 3T8XA 4XCCL 1ETA1 4JG1L 1A7PH 4MCNA 3AREC 2ZICA 1EAPB 4FRWA 4Y2DB 2RFXA 1AY1H 4HBQA 3LVTA 2IQAB 1JGDB 3QORD 2XPZA 4NNYA 4R5XA 3HHSB 3PGCA 1ZHKB 4U1IA 2EDXA 3EBAA 1KIQA 2IH9A 4D9LH 2XRAL 3B9AA 3OQ3B 1OSZB 4U1KB 1MEXL 4L1TA 1U42A 3TVMD 2BRRH 2WWKO 3U9UA 3S88H 4ZYKB 3SIKA 4A04A 4MXQC 4PV9B 3O2DH 1ZTXL 2AJYH 3HUJA 3RWGA 3FB5A 1OHZA 3KYMA 4I3SL 3HIZA 3DOSB 3LRLA 1UH4A 4G5AA 2DM2A 4UT6L 3KJ4C 3HI1A 3VFGH 4BELD 5B3SB 2WVUA 4ERSL 4ONGL 4OBSA 5L88L 4H25B 2HKFH 5T5NG 3NJMA 3UZEA 5T5NF 1RZJC 3LSOA 4HCRA 3HC3H 2FX7L 4UUJB 2D9CA 4NSKB 4MS8D 2VR3A 1S7RB 2L8AA 3UROR 4AGMA 1UZ6F 4HAKA 3KS0H 3KPNA 3O4LA 2YMXL 1EJOL 3NZSA 4LEBA 2B77A 3QC5X 4JRWA 1MY5A 3VXUE 3V52L 5MENA 1WBZA 3QH3B 4KPHL 3U0WH 1DQJB 4NKMB 5T33H 2C3VA 3SE9L 4D0CA 2FSEA 4BFBD 4LKCB 2YEZA 2FCBA 1LD9A 5D72L 5B39A 2EXYD 1BLNB 1BXXA 2VLKE 1RP9A 2DEWX 4NENB 3EYFB 4YDMA 2XA3A 3OJDA 2HPOA 3EW3B 2QQNH 4KOCA 4JBSA 5GGUB 3IGLA 1WAAE 5F0MB 4NUGL 4XNMB 1WVZA 1S5IH 3GXUB 4RZCA 5DK0B 5TDPB 4YSQA 1J05B 4M4PA 5SWSE 2G5BA 1L0PA 2GI0A 3PHSA 3SGDI 3KVQA 5TE6H 4G6AD 3V9EA 5E2TL 4ZAKC 5FF6A 4CVXA 3FXIC 3VXOB 1OWWA 3NZ8B 3S3JA 3BH8B 2A4CA 3RPKA 3PAYA 4PGEB 4PWIA 3HTLX 5DYOA 4ODVL 1FA4A 3GQFA 4MLIA 3N1MC 3MR9A 4DN3H 4N2AA 4YIQB 3QVAA 5I1JH 3J2PA 3QEQE 2V8MA 5ILTH 4DP8X 2FEEL 3IGKA 4A2HA 4KRPC 2BY0A 3LPWA 4RA0C 1JGEB 2OMVA 1S7VB 4BDVB 4MZ2A 3HFFA 3PLYA 5D5MA 1DJZA 3E3QE 5EWIL 2AV7B 2V7HA 1Q0YH 4DH2A 5AG9A 3KYAA 4JFFD 2A73A 4OCYL 3GSNB 3L4VA 3B1UA 1Q0XH 3VAEA 1IQDB 1AQDA 3NIDB 2VSDA 5FK9A 2R9HD 5JXEA 4FN0A 1HHIB 4MB4A 3ULSA 1JUFB 3U2SB 5B38B 3VNYA 5AYUL 2VL4A 1TQWA 3QIUB 5F6IB 4P48A 4PJGA 1JPFA 2JMRA 1CPUA 3O3BB 2OCCB 3QE5A 1OKEA 4X4ZA 1VF5C 4PY8J 5MERA 4FQLL 4LF3A 2D2OA 2H3NA 1VFOA 2NYYD 4OLZL 5DO8A 4HKBB 4Y7MA 1Z9MA 5FUZH 2DQDL 5BNXD 5FO9B 2VN7A 3SBPA 3PJSB 3ZE0F 3DJZA 3PHQB 2QQQA 1FFTB 3GC3A 3BDYL 1CO1A 5DD3L 2KQMA 1TJIL 3CZKA 3UTPE 4P5MB 4NN5C 2NY6B 1OAYH 1R3IH 1OM3L 3Q43A 3MLVL 2YRPA 5F9JB 1FGNH 1JGLH 5I1GL 5DUBB 5EDSA 4G1EA 3QRLA 1DJYA 2YQGA 2EO7A 4GIPD 1R6VA 3AB0C 3EJUA 2A6IA 1PNDA 4ONFH 5E99L 4PP1C 1MY7A 4KHXL 1U8LB 1LVEA 4GI6A 3HZYA 1JG9A 2ZG1A 2DDQH 3HNSH 4AK1A 2EDWA 3ZN6A 4E42A 4N0YH 4NUJA 2BK8A 3OKMA 5T1LA 2OTUB 4JCLA 2MQGA 1CLYH 5EC1A 2NZ9D 3WUWA 4KKQA 1YCSA 4F7TA 2NY0B 4TQIA 2DQFA 3L1EA 1UB5A 4XPAL 3LMJL 4LMQI 2R2HB 1CGYA 1EDQA 3G5ZA 2VAAA 2VQTA 3N42F 3NSJA 3RVUD 4Y16D 3O81A 4UDUB 1UURA 1Q9OA 5KJRL 5G4OA 5EZJA 4Y5VA 4HUVB 5F6HI 4TS6A 4HZLA 4MCYA 3UTSE 1U8JA 4MMXB 1UFUA 3VFSB 1RLWA 3VI3E 3KDMA 1DQLL 4WV1C 3B2PA 3MRPB 5J12B 1QSFD 2NW3B 4FXGC 4X4XB 3TNMB 3FO1B 5IHLB 1HQRB 1CR9L 1TZHB 3OGCB 3PUUA 1NOLA 3F7LA 1BX2A 2Y7MA 4MHHG 5D93B 1WGVA 3ZSTA 2J4WH 2IWFA 1HI6B 2X1XR 4ZX5A 1IAII 4JHWL 4C4KT 1RZKL 2PYED 2A1WL 2CLZA 1QBAA 1B88A 1Q38A 2CUIA 2DW5A 4AW7A 1HX0A 4L2LA 4R83A 3T04D 4NJAL 3TV3L 4EQ2A 1I9JH 2IPKA 4N5UA 2IF7A 2JCCE 4J1UB 4S10A 1ZRUA 4J3OH 5IW1A 1AD0B 3K4AA 1FNSH 3QUKB 3BP5A 4I18B 3HC4L 4UTCA 1X5IA 4XCNB 4OCNC 3K46A 2Q1EA 3DOHA 2GUOB 4X5XA 4CL7A 1WRFA 1P7KA 3ULVF 2VOTA 3N3EA 4Z3EA 3CFJB 4XAKE 3B37A 4FFZH 2BSDA 5IJVA 4PJ9C 4JZOA 3IEAA 3JUZA 1SZNA 2K45A 5GRWA 4NP4L 1CLCA 2DYPA 1IBGL 4XCCH 4UNTA 4B9FA 1DUZB 2IG2L 4EIBA 3O2VH 2OSLA 5E1HB 2EDDA 4V11A 4YMPA 1OGSA 1TXKA 3HJEA 4K9EL 3V4UH 2BNQB 3B3IB 1MEXH 5F0LB 5JORA 1QWNA 2JKNA 2MNJB 4K15A 2WKGA 4YGVA 5FYJL 4DKAA 3UCRA 1TEGA 2E7MA 5HYSG 3BUYB 5IMKA 1KCSL 3MV9D 4LBAA 1KPVB 4GBXB 5HYJB 2JKJA 1I3GL 4I3SH 4HKZB 5I0WA 3SKMB 3WN5C 4FFTA 5IEHA 3BPOC 4OGYH 1LO4H 3WCYA 4LVHB 1FGVH 3VXSD 3KL3A 2WKOF 1G7MA 4ERSH 1FV1A 3APCA 4NWUH 5TF0A 4F1SA 1RVFL 4JFUA 1MFCL 2QGBA 3QDJD 4N8CL 4J4PA 3PWLB 3FFCE 3L6FA 2D7TL 5L2KD 2FX7H 3DLQR 2YGVA 3AGWA 4V1DD 5HHPA 2YMXH 3FSWA 3CQPA 4IOFC 4QRPA 5D7LB 4XT1C 5AAMA 1D5MB 4F57L 4PCSA 4YOKA 5C0BD 3N44F 3WGVB 5KVGH 1S7QB 4LGPB 3NQKA 2WXLA 3O9WA 3QWQB 5KBKA 1A6TA 4YC2C 5I1CL 5ADPH 5TGBB 2YC1A 2G60H 3CIQA 3WLBA 4Q0XH 3MLPA 4MVBD 1FO0B 5DZVA 1OSPH 1RZJL 5HYEA 4HIHA 4TPRL 4C47A 3N43F 4UINH 3U6XS 5EG6C 1PZ2A 3NSXA 1LDPH 1GRWA 3EJZC 3KLHC 5DD5L 2ZOKB 3QIBC 1FWXA 3GI8L 4WO0A 1I1RA 1H6UA 4QOKE 4H5SB 1XF2B 2FIKA 4W81A 3VFVA 4J3OF 4EZLA 1HEJC 5BPPA 2CHWA 2OMZA 1OP9A 1HXYA 4BEIA 2YSTA 3D5OF 3QS3A 4JMXA 4OLVH 2GITA 3E6HB 5FGCE 4UTBL 3OF6A 4XMPL 3S36X 3ME0A 2R4RH 4NI6A 5DRXA 5CFHA 5K9JL 4CU6A 1NFDE 2ZPKL 4BH8B 5EBWA 2BFVH 4FABH 4YXLL 3FQ2A 1OOAA 3EBGA 1JYNA 2QQLL 2G75A 2ZONA 5ESQA 2G0KA 2XVBA 3U4AA 4A7UA 5JXEC 2E7CA 4PLJD 4JY5H 1SYVB 4OCYH 2P5EA 3SPJA 3FQYA 3BIBX 2X70B 2ETWA 4XI5C 4K71C 3RVXD 3UTQA 4J3SA 3FNKA 5KBMA 2DKSA 1NMCB 4FQJH 3LKQB 4S1DD 4XPBL 2YXFA 2PKDA 5I19L 1UA6L 4JFHE 3QI9A 4Z7WA 1UADC 3ZSSA 3VW3H 4IU3A 4LXFA 2VMEA 5DZLA 4AIXA 2O6EA 5D6CB 2K8QA 2VW6A 4U3CA 4NNXB 3QXTA 1U8QB 3IM1A 3QR2A 5KG9B 1UZ8A 5ANME 1JI2A 5DQDL 5FGBC 4C54A 1MCNA 1DBBH 1WEJL 2Z31C 4WFFD 4D8PA 4DEPB 5DHYB 4N0RA 5IIEB 1A4CA 5JUEL 3QZWG 4PTTA 1CC3A 4LT7A 2FGZA 4K7FA 4P5TB 5AQ0A 1N59A 5FKPB 4L05A 3MJ9H 2DQDH 4CBZA 4X6CB 1PDKA 1EO8L 1F3DH 1F4HA 3NFPA 4AEEA 3MJ8B 2L7QA 2YD1A 4IS6B 1IQWH 1UD8A 2FO4A 3MV7B 3WMQA 1TJIH 4WFGD 5BZDA 4H8QA 2QGEA 2OR7A 3MLVH 4NQTA 4Z78B 1QWHA 3W57A 3AG3B 4IRSC 3MRGA 1ZPUA 1M42A 3GRWH 2WXOA 2Z93B 4IBLT 4D9RD 3C6EA 1EJ6A 1N5AA 1XSIA 1DN0B 1RJCA 2FB4H 2WHVA 1W8OA 2VDML 8FABA 4CSPA 1UWGL 2BW4A 3CZGA 2YEVB 3ZHNA 1OTUD 1PBYA 1WC7A 2HFFB 3MRKA 3T71A 4GEJA 5GGVY 2ITDB 5E6IC 4KKLD 2IWKA 1PKQA 3GMNA 4Q6IC 1UQSA 1YNTB 5JHAA 2LFGA 3EYQD 3BAXA 1LEKB 4ELKA 3HZKB 2Y3AA 4XPAH 2XWCA 3LMJH 5EU7C 3J7HA 4M8QB 1QFHA 1VLXA 4M6AA 3MV8B 2HZHA 1QX1A 4NKQB 1UD4A 2WXNA 2AFNA 2Y7QB 5DEJA 5EOCH 3FU5A 3RPIA 2V2TA 4JR9H 2ZUYA 3IRCA 3KPQB 3DBXB 4WGKA 2PXYB 2TRYA 4YSSA 5EOTA 5CS7A 3PJLA 4XBGB 3HAEG 1M57B 2CWRA 3GIVB 3H9SB 2PCFB 5LN8A 4MZ3A 1LQBC 4QYOB 1B4TA 2R15A 5DJZB 5CN1A 3VD5A 4ONHB 1XH2A 1YJDH 5E8NA 4XBPA 5AW3B 4L9LB 5AD0B 1IGYA 4N90D 5DS8A 2CJSA 5AOIA 1CICB 1ONQB 2ZKXA 2H5UA 4O00A 1RIVH 1XT5A 1X9RA 5LWYH 4BFOA 2V5MA 4FXTA 5CCKL 4RMVA 5DFTA 3V7AG 1C5CL 2LR4A 1JK8B 1Q9LA 4JFFE 4KRNA 4X8JA 4P4KA 3NA4A 1V55B 4BFIB 5F7DB 1FZMB 5CAYB 3MGTA 5IB5A 2OQJB 3DA0A 1IAKB 4FTVA 4N0CC 3SQBB 4NEHB 1Q9KB 3ABLB 3QUZC 1RJYB 3MRJB 1ZEAL 5I1EL 1BPVA 4Q74A 2DV6A 3N1GC 3V9FA 2APWA 4ELMF 2Y7OA 3P3SA 3MV01 4D7PA 1I31A 1WA1X 4IGBB 3OAYK 4W9IC 4LSUL 3QCVL 5EUKA 4A7VA 1URZA 1HL4A 3VRIA 4HIIA 2AQSA 1A3QA 4FQIH 1SQ2N 4A2MA 3LNFA 4LLDA 3L3JA 5T5FH 4S0HA 1IBGH 1AHMA 2FLRT 1JV2B 2RALA 4OM0L 2X4QB 4BKSC 1LWJA 1CFMA 3BZFB 2R0ZL 3H2WA 1O75A 1MPAH 4KY1L 1QSEA 2BVPA 3F12B 5AUMA 5BRZB 4K9EH 1UM5H 1ZJBA 3FTVA 4RMWA 2JQZA 3PXHA 3BZ4B 4RFEB 2E27L 1WD8A 2BC4A 5J13C 3K6OA 5D1XA 5IQNA 1G9NH 4ZFOL 3VXRA 2ZOLB 1KCSH 1NCBL 4H40A 1I8MB 4AUUA 4ZT1A 1I3GH 1FG2A 2VDPH 1JNHA 1P5UA 4FA8A 5EZIL 1JPEA 1Q1JL 3HHMA 3WD5L 4I0KA 3FQRA 1FFOB 3VH8A 2Y2TA 4K55A 2VL5A 2OMWA 2OV0A 4QHLB 4UDTB 3TIDB 4DP5X 3ETTA 3QK0A 1U8IB 4GUQA 3O8XA 3O9WC 1VESA 5E1GA 2V0AA 4R7DA 1BD2A 1RUPL 1J9QA 2BXZA 4UMSA 3AVEA 5H2BB 4DPAX 2C1OB 4LCCB 2ZUQB 4K3EL 2AVGA 1JCKA 4DP2X 1RZQA 1YUHA 5I1CH 1P2CB 1H9VA 4KZCA 3LKOA 5DLMH 4MXWH 2R2EB 4GIAA 5EU5A 3INUH 5GQBA 5GIRB 3LQAL 1T0NB 1ZOXA 4GP5B 4L8DB 5I5JA 3S8GB 1RZJH 4N0FA 2J25A 1UFGA 4I3RL 4KUCF 5HYSA 3IMRA 4BSWA 2XUWA 3RDTA 3P4NA 4JL1A 1E28A 4E9YA 3E1ZA 9PCYA 3ARBD 1IVLA 4QHNB 1KCUL 3DX1A 1HE7A 4JO3L 4GG6B 4QY8B 2NR6D 3BIAX 5IOPB 2AHIA 5JOEA 1WCBA 2PP9A 4Y1TA 4TNVF 3UXFA 1RPUA 1I8KB 3OAZK 5JHDD 4Q97A 5AKSA 1AMYA 1HEZA 3OZLA 4NLAA 2AQ2A 3IAPA 4FJYA 4PY7A 5SWQB 1O7DE 2HB0A 2X4TA 1MCWM 2PYEE 1OP5K 1A0QL 3FW6A 3LRGA 3DVNB 4HK0A 4OGQC 5DHVH 2ZPKH 3MLZL 3SGEH 3BQUB 4WWPA 3OXRA 5E8OA 3QJTB 3X11A 4Y1SA 4IRJB 4WSKA 3UG4A 5JHBA 4FFWC 2O5YH 1E4JA 1I1AD 1LTXA 1U3HA 2BPBA 4R2GD 4NZRH 1XZWA 5CHNA 3T3PF 5K59E 4AVKA 1EWHA 4P9HC 4YDVA 4XPBH 3V0VA 1CGUA 1W8EA 1MCLA 4DJMA 1A65A 3CXFA 2VZ3A 2EH7H 3SDXB 4J12A 3T2PA 2NLJB 2Y25A 5CIPH 5DQDH 4RRPM 4W4OA 1MCEA 2BRQA 1HT6A 3ZIYA 3EH4B 4HPYL 1P4IH 3S5LB 4IBUA 3D06A 2E59A 3GZQA 3L3KA 1I3UA 3O6KH 4X8CA 3AG1B 1IFGA 1R4XA 2BH0A 4XVUC 1OTTD 4NQUA 5E9DA 3MV9E 4HV8A 1U8NB 2H7WA 1TFHA 3DTUB 3FSAA 2VLRD 4O02H 3F7YA 4NKOA 1ILSA 2GI7A 2XTJC 4NHCL 4QF1A 3G3LA 3VXSE 1E9OA 4AX3A 2R69A 5DFAA 2NSMA 4XP1H 3QDJE 1ZT4A 3KPSD 2JIXB 4MMYB 2AEOA 3QYMA 4DAGL 1NCJA 1A3ZA 1P69B 1UCBL 5I2IA 2GSGA 2VDQB 5DS2A 2NNXA 1AO7A 3DV4A 2ZAHA 4NOBA 4V1DE 1YPZF 2OPCA 2CRIA 1RIUL 2PO6B 2XOTA 4PVLA 3QQ9C 4UCFA 1SBSL 4R90H 1OXYA 4WEBH 4Y4KA 2QADD 2IAMB 3KPOA 1WJ3A 4J6IA 1KBPA 5C0BE 1ZK5A 3W0WD 1KBGH 1RZIA 2VDMH 5HHOD 3TIEA 1N8ZB 5DQ9A 5KYUA 1L9NA 2HLAB 3ARYA 5E4EC 3I02B 5E7BA 3WNKA 2OTWA 2G3NA 5EUOB 5GGRB 4QI3A 5I24A 5F7KC 4HUUB 3EFFB 3KGTA 4URKA 1FVDB 3IJYB 3ZTDC 3PL6A 1Z1WA 1HKFA 5D1ZI 4WNSA 1BYNA 2R1XB 1MHHA 2NXYB 4GYBA 4P5RA 1IC5H 4WO4B 3SDCA 1LK3H 5IHZA 3IETA 4LEEA 1FG9C 5IBTL 3EFDH 3RFZA 3ARGB 2CO6A 1XEDA 1CZ8L 3ECBB 1HINL 5IF0A 4QGYA 1QSVA 3B7SA 5LBSL 4IDJL 2FJHB 1MCWW 1LP9F 2YSSA 4I88A 4UV4L 3ROOA 3TFBA 1S7SB 5D6DC 4RWYL 4NZDA 1J12A 4P57B 3KGSA 4OFQA 2YOAA 2ZWZA 4DO6A 4MQ7A 4OIFA 3FCSB 4M03A 5HI4C 3SJVD 3IJ8A 3BWSA 4N2IA 5DD6A 1R3KA 4P4KC 3OR7B 5E56A 4WI2A 5DMIL 3TBSB 1EO7A 4HK3N 4LCWB 2VISA 4G1MA 5CCKH 2WBJB 5DGRA 4BK5A 2JK5A 3HE6A 4F8OA 4EDXA 5C0FB 4TL5A 1AXIB 1JP5A 2VERN 4N24A 4YFLF 2WMPB 4YNYB 3LHAA 2H1PH 4JVPA 4TUKL 4Y5YB 1TETH 3KPPA 4QRRA 3TGXA 4LDCA 4UNVA 1QYGL 3CCHB 5JA8B 3GMMA 4DPBX 2BVEA 2JJTA 1XF4A 3G9VA 4LSUH 3K8MA 4ZQTA 3KH4A 2A6DB 3K91A 4PYHA 3FCBA 3DO7B 4J3TA 1XXFC 5K9KB 4QLRA 4WFFE 4O51A 3ZHKA 2PW1B 4KY2A 2WSPA 4AL8H 3HRZB 1YMMA 3MXVL 4ORGB 1H3XA 4NRZA 3WIHA 3B9KA 1AHWA 1ZA3B 4FHBD 2E27H 4YLCA 5G4MA 2WUCL 3GINA 2LABA 3PUCA 4CC0A 1U91B 4L4TA 3MJ7A 1NJ9B 4NPYB 3HPJA 4YH6A 3WS3B 1PEZA 3F7VB 4QUOA 4FI8A 2CSPA 4WFGE 3NCYP 4KX9A 4NC2B 2I9LB 5EB9A 3KWWA 1H5BB 1XGQB 2VKWA 1XFPA 1N3NA 4MB5A 4G2AA 1OCCB 4X6BB 4PJ8B 5IWLC 1SXCA 4ZOCA 5TQ0L 4KV5E 4MA8H 3REVA 1BFOB 4M8VA 4PI2A 5I26A 4D9RE 1KG0B 4NIYE 2CMRL 3JWNH 5B38G 3ABZA 1RUPH 3ARRA 4MAUL 2V2WB 5DJ2A 5HGBB 1NFDB 3S4SA 4WK4B 4HCRH 4K3EH 1YY8B 4A1RA 4U3XA 4DUVA 4F5CA 1U8CA 3LQAH 1FQ9C 2P80D 2YN5A 2WTOA 3QHZL 4LSRL 1ZLWH 2HTKC 5GGVL 1TOXA 4I3RH 4XHJD 5D1ZA 3MTRA 1T03H 5JPMB 2YHGA 4LO9A 1CU4L 2CIIB 2BIIA 3PGDB 4J6RH 5EO9B 3WO4C 1XVSA 3MBXH 1F0LA 5L2JB 1AI1H 1DTUA 1QRNA 4HS6B 5C86A 5L4FA 5FM5M 3H3PL 5DGQA 4MNHB 5HGAA 3VWKC 4JM2D 4BRJA 3WIFA 1RV6X 2YXWA 3PYCA 5EFIB 5BW7C 1BQLH 3BMWA 3R4RA 4XAWL 2EICA 2P7TB 4FYQA 3ZL2A 5EBMA 5LG1A 2X4NB 4G6FB 3F85A 3RAJH 2YS4A 3BSHA 1UGNA 1A7BA 2YIHA 3CVIL 3LIUA 5ERWA 4AGNA 2HN7A 3W38A 1VGKB 3KPLB 4KK8C 4F2EA 2JKXA 1NCCL 2YAEA 2CHNA 4YHZL 6CGTA 1FYTB 1CDJA 2VDRL 3MLZH 5CFAA 1AGCA 1LK2A 3BH4A 2Q7YA 5LG6A 4WRLA 4XE5B 5MI0B 2VJ8A 2GJPA 5E03A 4FQXA 1SEQL 2D8KA 4BCXA 1S3RA 1WZAA 2UZXA 2LOEA 1ZGLM 3CIAA 3GDBA 1P7BA 2OJEB 3WG7B 1OF2A 3LNEA 3EH3B 1U8MA 3QFDA 3TPUB 2XDHA 1MFNA 2WV3A 2ZCHH 4KVNL 3WKML 4UZSA 4YL9A 1SXAA 4FQCH 3GK8L 5CF3A 1KB5B 1QEWA 2G9KA 3FYEB 2H2PD 3V4VA 1VEPA 3RGVB 4FQ2L 1HSBA 4KDVA 1CDIA 1LNUA 1PY4A 1CCZA 1YYML 3IN0A 3DX8B 1QVOA 5FYJD 1MFDH 1F00I 1JZEA 2N0MA 4LOVA 1KTDA 4PSRA 3HUJF 3MLTA 2OSWA 4JCWA 3MBWA 3MYJA 1HILB 4PRDA 1EK3A 1P4LA 3OKEA 3VO0A 3ARED 2OSXA 1M05A 3P2BA 4HUXA 3T65A 1E42A 4P9HL 3DIVA 4TULL 3UDWC 1XBDA 4JFXA 4MJ6A 1ZHNB 3MRRB 1HZLA 1CTMA 2WANA 4KJWC 1FUNA 5IM7A 1BFTA 4OQTL 1LO0L 4PS7A 4MXQD 2EIZA 2NY4C 2VDOL 3IU4H 1UH2A 1G6RA 2G5UA 2PWEA 4AH2A 4Y4KC 2EDKA 4DAGH 3RWIB 4FQHB 5C0AD 1UB6B 1FL6A 3P2TA 3WNMA 3QPQC 1W0WA 1SBSH 3E8UL 2DQCL 4ZW3A 2ZJSH 4FAAB 4KHTH 4APQA 1J88A 2A9BA 4GEIA 1WICA 4CGUB 5F3BB 4HIXL 4WHDA 1AKJD 5EU3A 4YZFF 4TRPH 4YE4L 1WO2A 1I4FA 1CF8L 1UA7A 4G72B 1WD9A 1KNOB 3WFEH 4AM0B 4NYLB 2CLRA 3KPRE 3TNNB 1Z5HA 4LKXB 1JZIA 3LDBC 3DVIA 2AXWA 4LEOB 5F7EH 2VXVH 2AQ1A 3H1ZA 1NDMA 4XC3H 5HDBB 5FPIA 5E4OA 2GSIA 2YARA 5LGYA 4U0RC 4HHAA 3GO1L 1CIDA 1RKRA 2WQRA 5L6YL 1JV5A 1F1GA 4F7PB 1IV8A 5IBTH 1HC1A 3LQZA 1NPJA 2Z34A 3A4EA 4OIIL 1CZ8H 3D2UA 1HINH 3QJHA 1A4BA 4M43L 4TNWK 3RA7L 3GLAA 5J1SC 4MNGA 3SGDH 3HLAA 1JFQH 5JHDE 3WFCH 4BH7B 1CFSA 4WWKB 4ZAKD 1IBFA 3QFJA 1FH5L 4V33A 3TF7C 2XHNA 4U1HA 1AG0A 4I3GA 5D5MF 3L4ZA 5DURD 5HHXH 4MBOA 2JTDA 1JZFA 1KZQA 2NUTB 2HG5A 5KS9A 2NQ3A 1EGJA 4OZIA 1BQHA 4QO1B 3ILQC 3PQYB 1AVAA 2AJSH 3K3QA 4Y2DA 3RVTC 3D4YA 2W9EL 2IQAA 4KRPD 5D7JD 1MKFA 2CRYA 4M7KL 3HHSA 3BVVA 4YEEA 2UXVA 5CEZL 5JOFB 2DI7A 1DE4B 4U1KA 1OSZA 2VXTH 3EYUL 4GSUA 3UG3A 3LIZA 3SY0A 2CDFB 4EXPX 3L1GA 2ZIDA 4DZBB 2IH3A 4P2RD 1MIEH 3RZCC 1QYGH 3MDJA 5ICXB 3SHSA 1K5WA 5C0CD 4OGAC 3RNKA 1K4CB 5CN3A 3VYNA 4FEMA 3EH1A 3V5DB 2XBZA 1PLCA 4UT7L 1MJUL 3UYRL 3C5ZA 4FDWA 3K2KA 4H25A 5IROC 1ZTXE 4KJQC 5F70A 3SDDB 3B9KC 1TJGL 2N01B 1S7RA 4Z7AA 1A4JB 1A6ZB 2BX5A 4LRIA 3T77B 2HLFC 3BIKB 1XR9A 5TK4A 3NJGA 4HUWB 3G5WA 3SGKC 4F15B 3UBXI 1QBBA 2R2CA 3QS2A 2ZKWA 1XGPA 1SXBA 2QLVB 2VLRE 3DIDA 4U1SB 3ILEA 1J7VR 4LKCA 3RGHA 1YNLH 4AMXA 4LPVA 5TH2B 3P30L 1WUNT 1K72A 1NUGA 4I4WB 3TZVB 3BDBA 2D03L 1INEL 3K8LA 3UC0L 4AK2A 3R7QA 1QMUA 3I3BA 1GS7A 2X4PB 3KPSE 4X8GA 3QNYB 4PJBB 1MI5D 5ID1A 4AZUA 1E90A 4GNKB 4OJFL 3GI9H 2UUDH 2X4SA 5CINH 4B7IA 3IAGC 4XNMA 5IT2H 2W9DH 3DIFA 2VSKB 1ETJA 3TN0C 4HHGA 3P4LA 5F9AC 5TDPA 1J05A 4LSQH 3MLSH 1R3HB 5IQ9A 1SMOA 2CMRH 3MCKB 3C9NB 3W0WE 5DI8B 1NWPA 4POUB 3BHBB 1FZOB 4NZFA 5HHOE 4N20A 4OLUL 2F53B 3NZ8A 5I0ZA 1JE6A 1IBZA 3IGAA 4M6OH 4UB0H 4PP1D 1HYRC 4XWOC 3LJ3A 2APTA 1NPNA 2GTZA 2YJQA 5DJ8B 2P47B 5HJGA 3U0TA 3IFOB 2FVNA 3L5XL 4YIQA 4OR1A 3SKJH 1KYDA 3QGVA 2X89A 4YBHA 1D9KB 2DWSA 3Q6GL 5DDHB 3BYTA 4PMEA 3VMOA 3T1FB 1LO2L 5TPWL 1DSWA 1JGEA 3FTSA 1EBAA 5ESAA 4BXSV 1ORQA 5GSVB 3FRUB 3NUKA 1KBVA 1XL4A 4NC1E 2WZ5A 3A4AA 1I3RB 2D7PA 2WGXA 3GGWA 2AJXL 5GSRA 1WWWX 3H3PH 1AZZC 2HJLB 3GJFB 4L9DA 1R75A 2Y0SA 4JG5A 5IJKC 1T5XB 4XAWH 4B3VA 1F86A 2JB6A 3GSVA 3O3AA 4HX1A 3I6SA 43C9B 3AM8A 1AS6A 2WP3T 2GT9B 1HHIA 3BN3B 2OMUA 3MRIB 4P2YA 5AZEL 4PJ5D 3TTYA 3V8CA 3VQ2C 1UM6L 4JFDA 2F15A 3Q6FA 2CK2A 4YSEA 1NCCH 2KI6A 3FU7B 3O3BA 4KROB 4ZW6A 4JFVA 5C0NC 5E2VH 2B1OA 1B9ZA 1WZ1H 1L9OA 1PJWA 2VDRH 3TASA 5JLZB 3HOGA 3MOAL 3CSFA 1RK0A 4XPHL 1IAIH 3SPVA 1SEQH 1CD1A 2A83B 3BAYA 4HLZG 1BQUA 4QNPE 3FHEA 3P77B 4K3GA 2FR4B 2B3RA 3T0EB 4ZOAA 1YECL 2PCXA 1KTLB 4F3FB 2CA4A 4YQXH 3VQMA 3EO0A 2X6CA 3F05A 3PJSA 3PWVB 4U3SB 2VLLB 1AGFB 2X5PA 1ASQA 2KKQA 1X5HA 5GJSL 3AMLA 3O6FA 1PD6A 1B2YA 1EEZA 2IADB 4P5MA 1SUJA 5IVZA 3QO1A 3OXSA 4PI0A 1T7VA 1WIOA 2FX9L 4HPHA 1O5PA 2Y6TE 4PJ9D 4WUUD 1XV8A 3B34A 4YHOH 1A7NL 1O9VA 1H8SA 5GZNC 1FZKA 3NA9H 4C8XA 3SYPA 3ESMA 4XMVA 5DJYB 3SPGA 4P9HH 3PHAA 3L3GB 1G7LB 1TCRA 1EAJA 3WTTA 5D2LE 5KN5B 3SGJA 1UXMA 4XCEB 3H2PA 1IM9A 2BOCB 1AS8A 1KYUA 1QTPA 3Q8EA 4XNQA 2OTUA 3GMPA 4PJFB 5BXFA 2GC4C 3L9RA 5DRWB 1SY6A 4LB8A 3KNBA 1WHPA 1EA9C 2Z8WC 3FULA 1IBBA 4R0LB 2W9LA 5IB1A 3QHFL 5F7WC 1L6XA 3QZNA 3U0PB 2Z92A 1EEUA 2UVEA 3AUVA 4NBXB 4G9DA 2QVMA 2HT4C 3HG1B 4XNUL 3E8UH 2WZAA 1FNFA 4A7GA 4DGIL 3MRDA 3QEHB 3E9TA 4YBQC 4M5YL 4HUVA 1M56B 3VFMB 3TYFB 2F5BH 1PMYA 4HIXH 4K9JA 1A47A 1MCFA 4S1SL 1V3LA 4YE4H 4Z7UB 3VFSA 4IOFD 4OFIA 3OZ9L 1P9MC 1P84J 2ESVB 3GLZA 3D2TA 3HBGA 1JZ4A 3TNMA 2WINB 5F8QC 3QO0B 3RL1A 2Z9TA 2VW4A 2R7EA 1KJ3L 2I25N 4NFDA 4P2OB 2Q8AL 3GF8A 3ISWA 1F3RB 3WENA 1XCTB 5ICZA 2UZIL 3GO1H 3PWUA 4JM4H 4OCWH 1SJHB 1C12A 5BOZG 5L6YH 2ZXQA 1Z3GL 4W4NA 5FLVA 3VJ6B 3TO4B 4FYRA 1GJUA 3EJZD 3KLHD 1JWMB 1FIEA 1OGAD 2F18A 3KGRA 4OIIH 4J1UA 4M43H 4M4RB 2CCVA 4BYHA 3RA7H 1TCMA 3QDME 4WWOA 5EU4A 5FV2A 2TSBA 3II3A 2P42B 4PJIA 3RL2A 1D7DA 2AEQL 2NDGA 2AXFB 4M7ZC 4WEMB 1EZSA 2GUOA 3O3DB 5C08E 4G7YH 2FNWA 2ZTBA 4Y2DC 2EINB 1WV7T 5E4IA 3R8QA 3G9AB 4S1QL 4APXA 3M46A 5T8IA 1ERNA 2UXTA 4EZMA 2LLGA 3VTMA 2JJWA 3DPDA 4A2FA 3US0A 5IMMB 3GLEA 3C8KA 4S2SA 4W6WB 5EU6D 3LY6A 4WY7L 2XQBL 2VDNB 3IDNA 3VFTA 1H6FA 2W9EH 3N85L 1I1YB 3KBPA 3DBSA 3GBNL 4BGLA 5CEZH 4ANUA 2L0DA 2J56A 3LN4B 3NDZE 4QAMB 3EYUH 1MG2C 1CQYA 4OU3A 5JXED 4PGZA 4W9GC 3T3ME 5AB0A 1D5BB 1JZ5A 2DYRB 3UYPB 4LLQA 2WGNB 5HYJA 4XI5D 4HF5L 3DVGA 3WFHB 2XFXB 3FUNA 2X6MA 4UT7H 1KMGA 3X3GL 5FYJE 1F4YL 3MPCA 1CLOL 4P5KA 3P9WB 5FO8A 3MTXA 4JO4H 1S7TB 2LQRA 4JFYB 3CN2A 1YC8A 1ZHLB 3CLFH 3AWFA 1GAFL 2KYIA 3ZK0A 2DRUA 1X5XA 1DJGA 2WLYA 1HDMB 3VD4A 4FS0A 1S5HB 1NH6A 1RK7A 3LZQA 4X42A 5D7LA 5E5MA 2Z31D 3HZMB 3OQRA 2Z7WA 1D5MA 3Q2VA 3WHXA 4Q89A 1S7QA 4RMTA 3UPRA 1YZZA 3WY1A 1MRCH 3PFUA 4LDEB 1UXSA 4U2YA 3GNMH 4NQDB 3WIHL 1EZVX 1FO0A 3WUZA 2XPGB 1G9ML 2Z65C 3QNZB 4OJFH 3AROA 3D0VB 4ZFZA 1B6UA 5C0AE 4LCVA 3I75A 1H15A 4M7JH 1I1FB 3EADA 3NIFE 3E80A 3DX7B 5DUPL 1JHLH 5HGGS 4U6YB 1MHPL 4IRSD 1KT2A 1N12A 4JFOB 4QXUL 1XF2A 2FWLB 1QA9A 2OFQA 4BQCA 1CDYA 2BHFA 5J8OA 1W6WA 3WTVA 1E8ZA 4W9HC 2RMNA 3LPPA 4U6HB 1T1ZB 4NRXB 3U46B 1A8JH 3X13B 2A9NL 1NAMA 4KQ4H 5D96B 4MWFA 5D7IE 3S5LG 5E6ID 2EUZA 1NTDA 4LCUA 1CLZH 2IOIA 2VITA 3UTZB 5IVXB 3F3HA 2IDUA 2CHDA 2EQDA 3VRLF 2HVKA 5CR1A 3A6CL 4L8CA 4NUPA 5B1CA 2CHZA 3C6SA 5I0VA 3DUUA 1N6VA 4W9CC 5DSCB 1A4KB 2BSSB 2FHBA 4LHUD 5FYJU 3OB8A 1P1VA 3ARDB 1JF1B 3K8KA 3QIUC 3UAFA 5F6IC 3SDYL 3SKOA 3HNTL 3L16A 4FI6A 1AMXA 1JD7A 2J1ZA 1I85C 1RHHB 3Q8AA 5AZEH 2HA1A 4JAMB 4LPTA 4PHZA 4PRNA 2APFA 3FPYA 1W72H 1LXMA 1V3JA 3LH8A 5FV1L 4Z1PA 1UWEH 2V8LA 4TF4A 4QWWC 2JKRM 1KGUA 5D71H 4NNXA 4L8SA 1ACZA 2E8ZA 4XPHH 1NEZG 1UWXH 4WGWB 3DDFA 1FFNB 4Z7VB 4AE0A 4U1LB 4YN3A 1YEIL 1A6WL 1ES0B 4AENA 3OKDB 4Z7QF 1KF9B 3S36L 1R24A 4UV7L 4U1NA 2GHZA 1YECH 4OGXL 5HHNA 1U58B 3MRQA 4ZMTA 4P2RE 2G3XA 2NY6C 4J28A 2VRKA 2HX8A 5C0CE 3FB8B 1UOVA 4N0CD 5GJSH 2RAMA 2K70A 3MV7A 1Q0EA 3QUZD 4XOBA 3FS9A 3IFPB 4JRXD 2A6KB 2DYPD 1CVRA 2EKSB 2RGSA 2OL3L 1CBJA 4KKAC 5BRQA 3V0DA 1MRFL 1U92B 3HR6A 1KPRB 1KTCA 2EVIA 2G9HB 3SGJC 3AT0A 1ICTA 3VI4F 3T2NL 3NFNB 5I5IA 1PG7L 1INDH 2IBBA 3OPUA 2ATPB 4GI9A 1JNLH 2XVLA 3CV5A 1INQB 2FYVA 2NY0C 2VH5L 3GHPA 1T0MB 2DQJL 3T8VA 2DQ6A 1MWAA 2ITDA 3D7PA 1TLMA 1X7QA 2OJZH 4KJYB 1TNNA 1YNTA 1MI5E 1DVSA 3OL2A 4Z7OE 3QCUL 1PFCA 4FG4A 1D5IH 3EZ8A 3Q06A 3HZKA 3K72A 2F54A 2FQEA 2NSXA 1KB9J 4BCZA 4M5ZL 4HWUA 4Z3TA 1GGIL 4DIXA 1WLHA 1ZWIB 3MV8A 4MMXC 4WI0B 2WLIA 5HJ3A 1CYXA 4QRPD 2R69H 2M1KA 1G6RL 3R0NA 4DGIH 1U8HB 5J12C 3KVPA 2Y7QA 4M5YH 3PWPA 4JANA 4KO5A 4B9ZA 3OKNB 2ZNWA 4RAHA 3TT3L 2G3MA 3AS2A 3I50L 3O9WD 4S1SH 1XR8B 5D93C 5EF0A 2QVKA 3ZRCC 3C5SB 1DANT 1NANI 4EI0A 3GMQB 4W93A 3OZ9H 4RMSA 3OJVC 3LB6C 4Z3GA 1XL6A 3TX4A 1QUPA 3U1SH 4PRHD 2AJUL 4XBGA 5B22A 3GIVA 1KYOK 5KYYB 4N6RA 3QUYB 1KJ3H 1KJVB 1BEXA 2Y3NA 1RUQH 4OJDH 3WFDH 4PJHB 3L17A 3W11C 3BKCL 5FGRA 1DBKL 2VR4A 3J27A 5FWRA 3H85A 5AD0A 4L9LA 4JFZL 4WW2A 2AXGA 1CQKA 3TYGH 5D8JH 3CBRA 2XU9A 3WEOA 4I18C 2HRLA 3T4YA 2AERT 1JK8A 3LCYA 3IVKA 1IARB 3K81A 2E4TA 1AE6H 2DQTL 3D05A 5F7DA 2OQJA 5FS5A 2B14A 4FNLL 1KXHA 1FBIL 1Z32X 4R6UA 3M07A 4ZW8A 4PJ5E 3OF6D 1F8TH 3MRJA 3ARFB 3SYCA 4G3YL 4WI9A 1UA3A 2A9MH 4PS4L 4QHMA 4WTQA 5IFAH 1L9MA 4JREB 4O2EA 3GRGA 3BESR 3VXUA 5I8CA 2GFBB 1DN2A 3KEHA 2QHLA 1NAKL 4N68A 2DWDB 4OZGB 5B1JA 1BF2A 4GUPB 2X4QA 3RZWA 4QEGA 2PR9A 5CEYB 2O93L 3NJHA 1KXVC 2PPCA 2VLKA 5DRZB 3FRPB 2A6JB 3QRBA 2XWBA 5BRZA 5FKAB 3F12A 4GBXC 5KVFE 1EGJL 1OPGL 2VN3A 3O2WL 3BZ4A 1WAAA 3IAQA 5EO0B 4QRSA 1YEDA 1IL1B 4C4UA 1E5UI 4FFWD 1XHHA 2ZOLA 1II4E 1KIPB 1T04B 2LLNA 5LCVL 3OSVA 3QI9D 5SWSA 1MCOH 2J7LA 4NQEB 4M7LL 2X42A 3GJEB 3KLDA 5F7UA 5E5RB 3X3GH 3F58L 1B90A 3IS1X 2ZCKL 4ZPTB 1XGTA 1TU2A 1M4KA 4JVWA 4NBZB 3BKMH 2PTTB 1NICA 4WUUE 2H3XC 4N8VA 3SOBL 4N87A 4ZUWB 3RWEA 4AKQA 1X9UA 2JFCA 4OY9A 1XO8A 2X44D 1WITA 4DP4X 3QEQA 2YPVA 4K2UL 3E38A 3GSQB 2D0FA 4B0MB 5LAXB 2F9BT 4LU5L 2QLYA 3DJTA 2YMTA 1CFVL 4G8IB 5G4NA 4V2CB 4CN1A 5IESH 2VDLH 3BE1L 3WKPA 1A6AB 5CSZB 4N28A 4XVUD 3FN9A 4N2GA 1O6SA 5F1KC 5GIRA 3RNQB 3LZLA 3WIHH 1KWGA 4HJ0C 1G9MH 3U7YH 5DT1L 3WJMB 1ED3A 2AITA 3P4OB 1MH5A 2XTJD 2EXWC 2YLHA 4EKJA 4Z76B 2GC7C 2Z91A 3FMGL 2W92A 4N2BA 1IGFH 1DUYB 3CDYA 4PG9A 5DUPH 3DV6B 2VDKH 5DVLA 4GG6A 1R17A 2HCZX 4MA1B 2J6WA 2FX8H 2MEJB 3DTXA 2D7NA 3QQ9D 1ZA6B 5T3XH 1EPFA 2GK0B 2XFGB 1DQDH 3WL9B 3VFUB 2H1LM 1ZVSB 4XO9A 1RZFL 5J9PB 4HC1A 4JO2L 2DQHL 5E00B 5I8OL 1Q90A 1MUJA 3NJJA 1TJHL 3BQUA 1AP2B 3OSKA 1L9PA 4OF5A 5C09D