1SXZA

Reduced bovine superoxide dismutase at ph 5.0 complexed with azide
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
151
structure length
151
Chain Sequence
b'ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CU-ZN SUPEROXIDE DISMUTASE)
molecule tags Oxidoreductase
publication title Crystallographic determination of reduced bovine superoxide dismutase at pH 5.0 and of anion binding to its active site
pubmed rcsb
total genus 41
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1998-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1sxzA00
2ZKWA 1DSWA 1OALA 3F7LA 5CU9A 3SODB 1E9QB 1HL4A 1UXMA 1YAZA 2C9UA 2WYTA 1F18A 1XTMA 1SDAB 1SXZA 1SOSA 3L9EA 1IB5A 1E9QA 4B3EA 2XJKA 3GQFA 3GZPA 2VR6A 2AQPA 2NNXA 1FUNA 2GBVA 3ECVA 3QQDB 2SODB 2LU5A 1SXNA 3GTVA 3HOGA 2C9VA 4A7QA 1IBFA 2APSA 2ZKXA 4OH2A 1TO5A 4A7GA 1MFMA 1JCVA 5KBLA 1F1AA 1SXCA 2WZ5A 2V0AA 2R27A 2E46A 1OZUA 2ZKYA 4U4IA 3H2PA 1COBA 2WWOA 1OAJA 2GBUA 3ECUA 3H2QA 1U3NA 1BA9A 1OZTG 1Z9NA 3HW7A 1TO4A 1SXAA 4L05A 1L3NA 2Z7YA 1BZOA 4MCMA 1JK9A 1RK7A 1CB4A 5KBMA 1PZSA 2VR8A 1Q0EA 3CQPA 3GZOA 1F1DA 2WYZA 2XJLA 2Z7ZA 3L9YA 3KH3A 4A7GF 2WZ0A 1N19A 1SPDA 2Z7UA 1SXSA 2AF2A 3GZQA 1CBJA 1IBDA 1S4IA 2JLPA 3LTVA 1Z9PA 1HL5A 5KBKA 1ESOA 1F1GA 1B4TA 1QUPA 3CE1A 1P1VA 3KBFA 1EJ8A 4BCYA 1SRDA 2VR7A 1XSOA 1B4LA 3MKGA 4A7SA 1N18A 3KM2A 4A7TA 1YSOA 2AQNA 2K4WA 2Z7WA 1AZVA 1YAIA 2AEOA 2WKOF 2AQSA 1E9OB 1E9PA 4N3TA 2ZOWA 3K91A 3T5WA 3S0PA 3GTTA 3KH4A 1EQWA 4MCNA 3HFFA 4N3UA 3KBEA 4OJAA 2JCWA 2GBTA 3KM1A 2AQTA 1UXLA 3F7KA 3MNDA 2E47A 1E9OA 1E9PB 3ECWA 2Q2LA 1JK9B 2WZ6A 1DO5A 2WKOA 2AQRA 3CQQA 2C9SA 1KMGA 1SDYA 4BCZA 1OEZW 4BD4A 3RE0A 1IBBA 4A7UA 2WWNA 1SXBA 1IBHA 2AQQA 4A7VA 1PU0A 1XTLA 1PTZA 3PU7A 4FF9A 3QQDA
chains in the Genus database with same CATH superfamily
4F9LA 4RQQB 5DMIH 4HAKA 5HHQA 2QVTA 4MMXC 5EUOB 1GMEA 1RIHL 5IMMB 2X7LA 4HH9A 3NABH 2VMEA 3NVQA 2VAAA 1CFNA 4HOMA 1I3GL 2Z1KA 3BSZL 4J12A 3FFCE 4JGUA 3LN9A 4Z7OB 2VLRE 2FSEB 3K6IA 5DVMA 1FYTB 5JW4R 4FULA 1EAQA 1E5AA 5E08L 1W15A 4IRJB 3VXME 4YBLC 2OR7A 2DMCA 2LAAA 2YUVA 5ALBH 1HJCA 3MBXH 5HYJD 4Z18A 3B2UD 5DHXB 3WENA 4EZJA 1IFGA 5KBLA 2QMKA 1YA5A 1L9QA 3QNYA 4FCAA 4TNWF 1KIRB 3BMVA 2HT2D 3CH1B 4K23H 5B7EA 5IBUB 3FRPB 1XMEB 3NJKA 5JIPA 2BNQD 3DIFA 4L4VD 2FE0A 4F92B 5B4MD 3ZYOA 3F64A 3NA4A 5JW3H 4N8VG 3A3YB 1O0VA 1QMUA 2IAMB 2LVEA 1OF2A 3W39B 2WZ0A 3BJ91 3D0VA 5E8PB 4WZ9A 3ZU8A 3R06A 3W57A 1B6DA 2H8PA 3U2IA 3NYKA 2Y7QA 9CGTA 1YYLL 4YDJA 4GMTH 3EJPA 2XG5B 3KYOA 1FN4A 3B6SB 3U9PH 4BH7B 4BCYA 3TF4A 1GOFA 3ABZA 5HI4D 3QIWC 3NCYS 1CFVH 3SOBL 3RVWD 1A6WL 2VYRE 2Z7WA 5ITFB 2XU9A 4L1BA 1UUNA 1TSHA 3IDNA 3MUZ1 2CHWA 3EJZC 5T3XL 1SOQA 2QSTA 4EXPX 5CU5A 5AALA 2C1PA 3CMOH 1J0KA 3V95A 4QHPA 1CZ8H 3HNTL 4BFFA 1NGPL 3CVHA 5CR1A 1S5IH 4C57C 1EUUA 2ZUQB 3LQZA 4UT9H 1FRGH 5EEVA 4R97C 1Q9WB 2IDUA 1BQUA 1GC1H 1HEZA 2NW3A 5JOFA 5EZIL 4A39A 4F33B 4XMPL 1T7VA 4GO8A 4M1GL 2BNRA 3OAUH 3CXHK 2Z8RA 1KLFA 4C8XA 1LMIA 2HJLA 3MACH 3QDGD 1U93B 1AR2A 5JA9A 4WY7H 5IMKA 3D06A 2WLJA 3VTTA 3PIQA 1AS6A 3D4YA 3Q3GB 1CN4A 1GZQB 1QACA 3EADA 1XT5A 4EI5A 5AKSA 4NQUA 4OZGB 3CU1A 4ATWA 3V0WL 1A25A 4QJ4B 2A9AA 3T0ED 1CFTA 1V55B 4DPBX 3II1A 4PS8A 2P8MB 2KC0A 3VD9A 3IBEA 2XUWA 4FFWC 3GXTA 4RFOL 3EDJA 5D1ZD 2BHUA 2IVFC 5IJVB 2DYPD 2MQ0A 4WFFE 4Y5YC 4HIIB 1CO1A 4B50A 3EJRA 3KYKH 4IU3A 4BSJA 3U25A 3ZZSA 5EF0A 3SDCC 5B39A 2WZPD 4BCXA 1XF4B 1ZLDA 3TX4A 2D31B 3LPGA 5IQLA 4HUMB 1RU9H 4FERA 2DEWX 4JQIL 5GGSY 4NO5B 5C2BL 3KLHD 1U95A 1AKPA 4WNJA 4ZSOE 1ROWA 1XR8A 5FGBA 5M95B 5SX4H 4LSSH 1DBBH 1VESA 3B3IA 3NIDE 4JZJA 3ETBF 3FS9A 4ZNCD 1HI6A 4WI0B 1G9NC 1MCBA 2J44A 3F7RA 3OGOE 2Z7ZA 4OW6A 1WZMA 4JFOB 4QRQA 2IG2H 4NXSA 1USQA 3ROLA 4CADA 4HC1A 5J12C 3VXNA 1D5IL 4LCUA 4B9JA 3VXQB 5DDHA 4OI8A 4N85A 4XVOA 1NBQA 4GY4A 4P48A 1QTSA 3V0EA 4U1MA 2F8IA 4YWGH 4JKPL 1JGVH 4DUXA 2YARA 1CIDA 1FFPB 1FC1A 2IPKB 4E9RA 3DX6B 4P4KD 2CDEB 5K5YA 4D3CH 2QADC 2CXKA 1BHGA 1V3LA 3RZWA 5IJCC 1X9LA 4M43L 4ZMNA 4WAFA 1NC2A 1S7RA 2YEZA 4ALAC 3ARDC 4JO3H 4B9ZA 4Z77B 3OF6D 3G7TA 3FFCD 3FQYA 2ZOOA 2QQKL 1TQBC 4O2FB 2P7TB 3GIVB 4H20L 4PLKC 3WLBB 1S9YB 3L3HB 2ZD0A 4BBWA 4NLAA 4R0LB 3UROR 4U49A 3MV7B 4R7DB 2J4WL 4DP7X 3LN4B 4L48A 2EDWA 4ZW5A 1BOGA 5JO5B 3BO8B 4HHWA 1DJSA 4PRPB 3F7PC 1E8XA 5E2UL 3NSFA 4KOCA 4QXUH 2B20A 1DO5A 3U36B 4AJYV 4XB3A 4O5LL 1R47A 2CWRA 1ND0B 1YEJL 3SJVB 4PRPA 4YXHL 3CIQA 1BPVA 3NA9H 3SYCA 2AQQA 3WIHA 1I1AA 5FYJL 1SUJA 1SJHA 1A1OB 1U8CB 2CR3A 4P2OC 4YX2L 4KJPD 4WWID 4Q97A 4NC1C 3APCA 5CU9A 2NY2C 1IC4H 3I02A 5IREA 4XCNB 2CHDA 2VRQA 1QUNB 1JVOA 2QQKH 4LEEA 2AJYH 2WXMA 1ZEAH 2J1KA 2WKLA 3MCG1 2KS0A 4N8PA 4OZGA 3HS0A 3PWVB 3L4TA 4TQEL 4YZWA 5PAZA 2NTSP 1MCCA 3C5ZB 1BF2A 1V7ML 4OCYH 2HVJA 3UYRL 1UUSA 3LNFA 5EDXA 1RCYA 4J3XA 2VM4A 3VFTA 1QQDB 1VFOA 4BDVA 4A7QA 1J86A 2UUDH 1I7TA 1JCVA 4AYGA 2IQAA 2JCCB 4PJHA 1I4FB 1MFVA 1UT9A 3WN5C 4OT1L 4F33A 3ZRSA 4XPBL 1ORSB 1OE2A 4MA7H 2H2SD 1RULH 1NCCL 1QBAA 1T6BX 2Y0SA 3O2VL 5GS0D 3I9GL 1YJDL 3WBDA 3SE9H 1DBKL 1LILA 1UQSA 2CDFA 3L1GA 3BT2H 4KXBA 2FECL 3G04B 4FLRA 4O9HH 3RWIA 3WSQL 3V0HA 5CBAB 2AS5M 5CZKA 5SV3A 3QUXC 3LEYL 4GUCA 1ZSHA 3RVVD 4PR5A 4IEFA 2R69H 5TFSL 3AACA 4YSOA 4ES8A 2EQDA 2TSBA 4UQEA 5B39B 3TWCL 3W0WB 3UYRH 5E9NA 1HQRA 2NX5A 1N3NA 4HUUB 4Y5XA 3RI5F 3S8GB 3ARDB 2WB7A 1FZKB 1FNSH 4KVCH 3PQYE 4XPHH 1RIUL 5AZ2H 1KTLB 2M8XA 5LQBH 5FA4B 2XTJC 3R4RA 3ULVD 4IGBA 3ESUF 4LCIL 1ZANH 2LTQC 1FDLL 4X0NA 3LKOA 2Y3NA 4RSYA 4W68A 3IYLW 4K9JA 4OM1L 3OLIA 2IPTL 1NBYA 3MRCA 4FOMA 5HHNB 4Y9FA 4ZX6A 5J5EA 3EHBB 1RL1A 4AWJC 4WFHD 3CH1A 4X7EC 5DVLA 2ICWA 3D2UA 3NN8B 1X5ZA 3MLYH 3L3GA 5F3BA 1H6EA 1FFTB 4MMZA 1ZA3A 1EZLA 1BOGB 3WAJA 5J6GB 1NDMB 1FBIL 1XAKA 5C0BA 1OEZW 3FQTA 3KLAA 2BVUA 4KKLD 2PPDA 5E6IA 4R84A 1IL1B 4LSPL 2NXYB 1MAML 3L48A 3GHBH 4LCCC 3LKSB 3QUKB 1MAJA 4RH4A 5EN3A 4IRSB 3CPLB 5EOTA 4J39A 1WZ1H 5EIIG 1ACZA 3VE0A 1M6OB 3DXAA 1OANA 4HIJA 4I7ZC 3VXUA 2ALAA 2VH5L 3KLKA 4P5MA 4BFNA 3I6GA 5DGRA 5CEXB 4XN2A 2GK2A 3EBGA 3NQIA 1IB5A 4JDZB 3QS3A 3MRKB 1YEHL 2ZF8A 2ESVD 2X88A 4QDGA 4BE5A 3HI1B 3JTBA 2GJZB 5EZJA 4AEIH 4K94C 4P5TC 4LPUA 3ULUF 1AMYA 4HSCX 4LLUB 4BK5C 2BIIA 2Y6SD 1HYSD 2CAKA 2VDNL 4JFOA 4YE4H 3VYOA 5EEZA 3A6CH 5J4MA 4FI7A 1S9XB 4FRWA 5GRXG 1HHGA 3OQRA 4N1EA 2WLZA 5DI8A 4WVRA 4JFUA 3MA9H 2OMNA 3KW7A 3QR0A 1S7WA 1JPST 3NP3A 4XB7A 2X6BA 3FUNA 2M83A 1MCPL 1WZ1L 2PCFB 2DYPB 3D25A 4ZQKB 3N6YA 3UZQA 3UZEC 1Y1UA 3WEXA 2GBAA 4TQ8A 3DETC 5ERWA 2OTPA 1BQ5A 2WLHA 4X98B 1VPOH 1GMIA 4E5XG 1CTNA 4YGVA 1B2WL 2A9MH 1Z7JA 5DMJB 2KZKA 1IGYB 4FQ1L 3ILPA 3QQ4B 1UWXK 2B4CL 2LT9A 3Q0HA 4XI5D 2WXRA 3B2DC 3UFIA 2GITB 1AAJA 1JE6A 1USZA 2JKRM 5BRZE 5D6CB 4G80B 1WBXA 2WBJC 5BS0B 1W0YT 2MHAA 4IOIA 5HHXL 2HT4C 5IQ7H 2QKIA 4HHGA 4JPWL 3CGTA 3QH3A 5E2WL 1T20A 3RY4A 3VRLF 1RK1B 3BESR 5E8OA 3K5RA 1MSPA 3QIUC 4NQDE 4F58L 5FGCE 4DN3H 1E9PA 2C7UB 4HIEB 5DQ9A 5GS3A 5GGTL 4RQQA 5GISH 1IM3B 1I85C 1I8LC 3GBNH 3QJOA 1GGUA 5IMKB 4X0KA 1S9WB 2R2EA 4JFQA 3T71A 4F8PA 4JM2C 1ZE3H 2BDNH 4UMGA 5DQJA 1AACA 1E3XA 3CC5B 4IOFD 3V52L 3AM8C 5F9JB 2G2PA 1XF3B 4Z9KB 3ATFA 4JFTA 5I5IA 3KZ8A 2DTML 1HXMB 4D0DA 2NYKA 4I13B 3G6DL 1NKOA 1ZHBA 2HLEB 4RLDA 2GUOA 5DHVA 2VXUH 2LU7A 4AQZA 5K59E 2FBOJ 3WFBL 1TYEB 3VWKD 3PL6C 5IK3A 4FKHA 4YXKL 4PLNC 1KBBA 1QSFA 3L3JB 4M6AA 4P5KA 4AXWA 4ETQA 4ZZKA 5B38B 3DSFH 2DJSA 4JRXA 3KR3L 4W6WB 4JFHE 3U2JA 3MV7E 5SWSD 5TDPA 1RLWA 4HK3N 2CA3A 3LZRA 2VDKH 3S35H 4ODXA 3SQOL 3MJ8A 5CBEA 3U4EB 1L6PA 4HUWA 4N0UB 4OF6A 4JHVA 1Q8MA 2NNCA 4OLZH 4PJGE 2L4OA 3VRJA 3RB7A 1CICA 3B2VH 1J0ZA 1ET5A 1XF5A 3EYFA 5G2NA 3VRLE 4FLSA 3IMRA 2K8QA 3ZZLA 5I76A 4L4VB 3N9GH 1WZKA 2V37A 1ASQA 4Q52A 2IG2L 3R7QA 4BFIB 1MRCH 2YSSA 3RGHA 4WGVB 2JLLA 3MLXH 5ENWA 3TU6A 3JV5A 3WTWA 4TV3A 2IF7A 3JV4A 3QB7C 1F6FB 4JB9L 5A2BA 1CL7L 1LVEA 4IJTA 1UXWB 1WZLA 3BPCA 4XPAH 4MZRA 3STLB 4AGQA 2GBUA 3QNXA 2XZAH 2VW6A 1RFDH 2EABA 4JGJA 5D1ZB 1E5BA 5I8EB 3HKZA 3N1GC 3T0AA 2IDCA 2OX5A 1L3NA 3O4LD 4L05A 3EYOA 4LLQA 4POUB 2BCKB 2DQDL 3DYPA 3SDDD 5JQHC 2P4AB 2VR8A 3BFOA 3U30C 2JKLA 3KH3A 2D9QB 2WLYA 1SPDA 1H3UA 2F7PA 1T6WA 3PDDA 4LP5A 2AFNA 4PJBA 2YR3A 2DLEA 1AS8A 4XP4H 4M9OA 3GXFA 2OW7A 4IRJC 1P4LB 3V0AC 5I8CB 5CUSH 4X9GA 5GIRA 2PPAA 2B8OT 2B0SH 3ZKXC 1A1NB 1UC6A 5TE7H 3KG5A 1OCOB 3VQ2C 5HP5A 2UUDK 4H1LH 1YNTB 1XD0A 1QLRB 1KBVA 1TKWB 2ZCHL 4XAWH 2D9CA 1TJIL 4NAJA 3EYSH 3FFCB 1BIHA 1QR1B 3D85A 2LV4A 1LP9B 1ZS8B 5IF0B 4JZOB 3OKEA 4IKIA 1BZQK 2Z92A 5DFVD 2FNBA 2WVVA 3U0WL 3BZFB 1HHKA 4TYUA 2ZX9A 4JVWA 5A16B 2X1WL 4P4KB 3QNZA 3IGKA 2PP7A 4K4KA 4EI6B 1A4JA 3TYFB 3NIDF 3IGFA 2FLRT 3BKJH 4BK8A 1WBXB 3BP6B 4WW1B 1S9KC 4TPRH 5T1LD 4MQ7A 1T1YB 4TSCL 1AO7D 1CE6B 3A0OA 4OQTH 3GNMH 4UV4H 2R0LL 5C0JA 2YLKA 3BQUA 3DMMB 2VZ1A 4PV1C 4QRSA 4K7PX 3DV6A 4H2AA 5TQ0H 3B1UA 3CSTA 1H0DB 4S1DC 1FGVL 1ZLVK 4OLEA 3EGDA 4H0HB 3TO4B 3BDYL 5ECGA 3P2BA 3BMWA 1VFAB 4EUPA 1RULL 5HHMB 5FDWA 3S36L 1AD0A 4JFFB 5MP6L 3AABA 5D6DA 4HLEA 3MNVA 1NGZB 3MRFB 3U0WH 3VD2A 3CFIC 5SWZD 3MLZL 5L4FA 2X09A 3L6FB 3O2WL 5HTSA 4DO6A 1BFVL 4ZXBB 5DTFB 5J1TC 1IBZA 3LSOB 1E5YA 1FZMB 1JVLA 2R27A 2H32B 4FX5A 4TNFA 2IAMC 1LDSA 5EBWB 3VXOA 2BJML 3GMPB 8FABA 4OAWB 2JCCE 3VI4B 2F54D 2FEEL 1BA9A 1QFWI 2PPCA 5TQ0L 2WXOA 1ETJA 4N87A 1ZEAL 3VGEA 3WS3A 1CFQA 32C2B 4AZ8A 4B9GA 2R15A 3FTVA 4TXVB 2NZ9C 2MNWA 4M7JL 2WYZA 4P0DA 2F0CA 2EVIA 1I8AA 1G7QB 2NR6A 3DK0A 3V52H 1SLWA 2AJXH 4XN1A 3T08A 4Q89A 1IC5L 5FO8A 3LVEA 1A7RL 5JDJA 4MMZB 1NA8A 1FYHB 4GLRH 4P46B 3EO0B 4J1UA 4J4PC 3WXVH 5ERWB 2JI2A 3FSWA 1HE7A 4B0MM 1CFMA 2APFA 3BIKA 4HUVA 2L7JA 5AW7B 1XIWB 1GGYA 1ZVHA 3QWRD 3A47A 1OW0C 2OL3B 3MLUL 3U0TA 3V6ZB 1YEDB 3S4SG 3N04A 1IAOA 4L9LA 5FGCB 1N0LB 1RJZA 4WV1A 2Z4QA 2WOYA 1FSKC 3AWGA 4D8PB 2NUPA 3CSFA 3M46A 1PVHA 1Z9LA 1KY6A 2G9HB 4PRHA 2O30A 5B7FA 3P02A 5D7IA 1BWWA 2HX9A 1QSEA 4N6QA 1U8IB 4BSVB 3QFDA 1UCBH 3IWUA 3AW5A 5EOCH 5EU3B 1I7UA 3SPGA 3NT0A 3BUQA 1UYWL 1SM3H 1HH6B 2J20A 2LLNA 4PJEF 3UX9B 4M6NL 3CSGA 4GBXC 4RFNC 4WNSA 3GKWH 3BWAA 3EO9H 5DEZA 1PF3A 1DJIA 4DP1X 4N2MA 4HJ0C 4B5EA 4JQIH 4JKKA 2X1XR 4P3DB 5AW6B 5EU4A 1ZY9A 4ACPA 4NBZB 4B97A 4FTVD 4MQTB 3MRQB 4KZEL 2VGLM 3A4DA 2MIZA 2XQYA 2GJJA 3ET9F 2HKFH 4HPYL 3Q01A 2HTKC 3H55A 2F6AA 3KPRB 3TN0A 3PS6A 1FVDA 1G9HA 1JYWA 3UG4A 5MI0C 1A9EA 3SGDH 1KV3A 2OAAA 2M1KA 4PRDB 5IB5B 1SXCA 5CSZB 4KK6C 2W0LA 4JKPH 2Q2EB 4JG9A 4K5MA 3BH9B 2FNWA 5LN4A 2CRMA 4EN3D 1LTXA 1HCYA 3ZSTA 1HFUA 1WBZB 5DD5H 5LDUA 2VUOA 1TQSA 3TNNB 4OF8A 5G5DB 5H4YA 4LCCB 2V2XA 4PJ9A 5K33A 3EAKA 4WW2B 5I19L 2MEJB 1BFTA 5DEFA 4F2MB 2V8LA 5FUOH 1PL3A 5GZOD 4KUCD 4UU9B 2R8SH 3U1SH 1HQRB 2HPOA 3TCTA 5JMOC 4X8JA 3UIZA 2FX9L 3HJ0A 1HL5A 4AY0A 2DKUA 2HJFA 3QIWB 5FM4A 5C0EB 1IM3D 1CDGA 5E8DL 3HN8A 2C7FA 3QJTB 1PJWA 3GMOB 3KBFA 3ZKMD 1FF5A 1XIWC 1VSCA 2VDRL 1T5XB 5ALBL 4AQ8C 4OIBA 4FG6C 5GQBA 2GCYA 4O5LH 1TTCA 4X4KA 4Z78A 2AQNA 4KHTL 4ZPTA 5I9QC 5JXEA 1KULA 1FPTH 2P80A 3MFGB 2XXCB 2YOAA 3BPNC 2P42B 4OKVA 1UZ6E 1XIWA 4Z7NB 2WNWA 4OBSA 2X40A 3RZCC 2IXQA 3EJQA 1UM6H 4U0RB 1FI8C 3MXVL 1V8HA 4P23A 3FBKA 3GIZH 4G8FB 1UKTA 1IRAY 1CLCA 5MEPA 5I6OA 3D85D 2WZ6A 1MCLA 3QCUH 4WI4A 3WL9B 2C9SA 1K8DA 2HT3D 4ZNEE 1CTMA 5LCVA 5EU4B 3ZJAA 1T4KB 1TVBA 3S96A 4MTMA 4OLUH 4LSRL 3HIZA 4PVMA 3QDGB 3ZE2B 4DGWC 1JRHL 1FNEB 3SE8H 1RZ7L 5SWQA 5L7XL 1EHKB 1KBGL 2VLJA 4ZUSA 1IKFH 1MH5B 1PY0A 3MV8D 4FQXB 4FZEL 4M56A 5DRZA 2X4OA 3ISRA 2F74B 5SWSB 3RPIB 5E24E 4LNVA 4OV6F 1QHPA 3UTZB 3IRZA 4DN4L 3L7EB 3IPBA 1MFAL 2BHYA 5GZNA 5BVPL 1CYWA 1TVHA 1XTMA 3ARGD 3GGWA 4EDXA 4UUJB 2H32A 2P80D 5EORL 1FZMA 2X6CA 3LSOA 1N70A 4X83A 3SJVA 2R4RH 3OD3A 4JE0A 2HG5A 3WD5H 1FFOB 1NUDA 2ODHA 5CEYA 1HJBC 3NTCL 3GSOB 4K7FB 3MBEA 1SMDA 1NCJA 2AJZB 1KIQB 1U33A 3DTDA 4TUOA 4KZDL 2VDQH 2FWOA 4YDNA 3SSGA 3N1FC 1E4JA 5B1JC 1S9VA 4S1RL 1MRFH 1QEXA 1EEQA 4OCSH 3CUPB 3FB7A 3GSXA 4KPHH 3F7VB 1YJDC 4HZAA 4NQEB 3CFBA 1OZTG 3UBXB 1H9DA 1JWSA 4JDEB 3QPKA 4PJFA 4TLTA 5HI3C 3HBPA 3EO0A 1GOHA 1UURA 5HGAB 4QRUA 2VMJA 3GLDA 3MRBB 5EULV 1OP9A 3QIUA 4BKTC 5BPPA 3QULA 4QXGL 1AHMA 4OKDA 2Z8WC 2H1LM 2X53A 4F7MA 5H4ZA 3P30L 3CPUA 4LO9A 3DOSB 1UGNA 3V6BR 1WEJL 4MB5A 3ROLB 3ARQA 3ILQC 1OT2A 4YO0A 5I17A 2YOCA 4P5TB 1XX9C 3AWEA 3IB4A 4CW1B 2CIIA 3REVA 4YFEA 1HHKB 2ZXWB 5I1IL 3TYGH 2YQ3A 3SYAA 2EXWC 2YBRB 1W72L 4KMTH 4JDTH 1E8WA 1JF5A 4J3OH 3AS3A 4PRNB 1ZGLA 2W95A 5KYWB 1QSFE 4J4PA 3DX7A 3M17A 3S0PA 3IS1X 1JCKA 3V9FA 5C97A 2B14A 3GM0A 3MJ9A 1I3GH 2XIIA 3BSZH 4GS7B 4HIQA 1KB5L 1P4IH 1G84A 2WOBA 3PREA 4FQIL 5C09A 3ETBJ 3ML8A 3OAZH 3CN4A 1A6TB 1R5VB 4M62H 3W82A 4GEJA 4GMSL 5DHMC 5MI0B 3FHAA 1IC7H 2A6IA 5TH2B 2YRBA 1BYOA 4YHZL 3GWJA 4A66A 5J12B 2X9ZA 1M1XB 4YC2C 4R7VA 2D8KA 4YDLB 1OAKH 1MLBB 1BV8A 3BYTA 1QR1A 3STZB 4AITA 3CDFA 2EKJA 3CZEA 1A4CA 1OF2B 3ESOA 3ARBD 2IAMA 3VGBA 5JPMA 5K1NA 2WXJA 3VD0A 4XMWA 4HOWA 4GI8A 4I77L 4QJ5B 2QVMA 2HRGA 4RGMB 4S0TD 3CLFL 4UTBH 4MQ7B 5AVUB 4FJZA 3II2A 3L7FB 3QNYB 1KZYA 2HUEA 2N3JA 2MOVA 2YGPA 5BRZA 1FL5A 1NMAH 1T04B 4AMKH 2HN7A 4YSEA 2XWBB 1N6QL 1HN1A 1LNUA 4FYRA 4FAAB 4D9RD 4L4TD 5TGBA 1G6RL 3BFQG 3DX8A 2IOOA 2I32A 1SJMA 3CVHB 3D85B 3ZHNA 5HHMD 2GHWB 2HWZH 4HETA 2VDMB 1ORQB 3O3AB 1Z3GH 1KCUL 4XMKH 2AKRB 2WM0A 3HMXA 5CCKL 3VNZA 1CIUA 3VTMA 3OHXA 3FTUA 1HNGA 1VFBB 4L4TE 4AGLA 1QWNA 2AKRA 2ICWJ 4M5YL 3LV3A 3Q5TA 4Q6IB 1FNHA 1H3PL 4KDTA 4AJVA 3LZQA 3WFHA 4NKIH 1FN4B 1S5HB 2Y9RT 2YLHA 3AUVA 4W4NA 3BP4B 4MMYA 5EBGA 3ES6A 5J13C 4WENB 3NGBC 1N6VA 5D8JL 5LXGL 4Y4FC 4YGAB 3OR7B 4HXAH 5GGQH 1MFEL 4JCWA 4J2XA 1JNNH 4GQ9H 1OAXH 4PTTB 5DA0B 4YS4A 1ECYA 1PIFA 1RZ7H 4YFLF 1E4KC 1P7HL 4FQPA 3RWDA 4MCZB 5E9DA 5BZWB 1D5MA 2GSIB 1E6JH 3KPNA 4FQ2H 3TVMD 3WJMA 4BHUI 2AEQL 3GI8H 1QATA 2CNYA 2ITCA 3D6GA 3TXAA 3IVKA 1CCZA 1PCSA 3LJ3A 1IM3A 2E56A 5IFHL 4QPEA 1OGSA 4KXZH 1A7OH 4XPBH 4CC1A 3QQ3A 3DX2A 4M7JH 4QCIA 2FGWH 4LEXL 3RFZC 4DUVA 3F2LA 3V7AE 2R29A 4MJ6A 5TD4A 2QQNH 2QKIB 4H4NA 2R29H 3W5NA 3GRWL 3VXPB 4Q56A 2E47A 4JLRA 1TEGA 5KYNA 4B9FA 3O2DA 4TRPH 3VGDA 2R69L 4P9HL 5C0CA 4ZAKB 3U1PA 3E9UA 2VABB 5H8DA 2A73A 2SEBB 4BE6A 1YVLA 4OCSL 4AH2A 3AQXA 2WWNA 1L0QA 2WWMC 3PHOB 2DEXX 5IFJA 2F7QA 4RRPG 3C5JA 1J48A 1YHPA 4E2OA 2XWXA 5EUOA 4XBPA 3UG3A 3CFNA 1OY3B 3RY6C 2BSTB 3X3FH 1HL8A 4X6CB 4JM4L 3DBSA 4Z0XB 4C59B 3K72B 2XTJB 3RL2A 1U8KB 2XVLA 4ZRGA 1BM3L 1EO8H 3DHMA 2J8UF 2WW8A 2YAMA 4JFFE 3WFCL 3CFCH 3IN2A 3RL2B 5JTWA 1FUNA 2Z0BA 1XL6A 3EYQC 3N85L 3QS2A 4IK6A 1AXSB 4AE1A 4FNRA 5E7FA 1VCBC 1XF2A 1S9WA 1A47A 2EICA 5EU5A 3GTVA 3CXDH 4I85A 4Q6IA 5D7JB 2GK0A 4BH8A 1AY1H 2BERA 2WSPA 4OLWL 3OJMB 2B08A 1WFJA 1OCWL 3QAZC 5ESQA 1VFBA 4UT7L 3P4NA 1T2QH 2AXHA 5D5MF 3MRNA 3QEQE 2XV2A 1ORQA 4UQAA 3WO4B 2Z93A 4PWIA 4JFYB 2QFPA 1P84K 4PAZA 4Z8FL 3DA0A 4HPOH 3RIAK 2J6WA 4HLZH 4Q9RL 1S3RA 2A6DB 1T4WA 4XC1L 5CKAA 1BQHG 1XIWD 1HILA 5I0DA 1E28A 3ZKXB 5AYUL 2XWBA 2CCLA 4HKJB 5LB1A 4AIZB 3GRGA 5EO1B 1T22B 2EH7L 2ZG2A 3H4FA 2CO7A 4I18A 5KBPA 4WCYL 2X38A 3LQMA 3QDMD 3ZIYA 1DTUA 5DZLA 2X70A 3WEXB 2X4PA 1OB0A 1ICTA 4YUEH 4YSCA 3MTXA 4NFCA 1TU2A 3MV8E 4QF1A 4ELMB 4PJFE 3BPOC 4CMMA 5DD5L 2WGXA 3LQAL 1RU9L 4ZMAT 1OT1A 4JMNA 1XCTB 3HVNA 3O9WB 1F90L 4N3TA 3SE8L 2WLNA 4PJ8C 1I8KB 1WD9A 1E6OH 1KTLA 2ZPKL 3CBRA 2K7PA 5CD3A 3HFFA 4FQCL 4AT6A 5E6SB 2AK1L 5LBSH 3V4LA 3ARFA 5FM5M 1C08A 2IMMA 2EDEA 2WMPB 1HHHA 1NUFA 2ZXEB 1GRWA 2HH0L 1H8LA 5E1AA 4JMXA 5DD6B 1SVCP 3WNOA 2FX8L 5I15L 3UO1H 4PJGF 3MGOA 2NY0C 2M26A 3NTCH 3O6KH 3OHXB 1V7NL 2GTWB 1F86A 4UILL 1FGNH 2BIMA 3CJJA 5HDBF 3AT9A 1U9KA 3X1BA 1PCXA 1UQSB 2FL5A 1FHNA 2ICEA 4HJ0D 4YQXL 5FF6B 4U1SA 5AD0A 4A6YH 5C6PB 1K9TA 3I9GH 1BWMA 5DJAA 4UV7L 2VLRB 3OWRA 4F7PB 4Y9GA 5T5NG 1DVUA 2R59A 3PAZA 4AUJA 1Z0NA 1PYWA 1A7QL 4P5TA 5ESVB 2IQAB 4P2AA 3SKJL 4L29B 2LU3A 4PJ7A 3JUZA 1EFXA 5C0AB 3KWVA 5IQ9A 3QUZA 4EIUA 3P40A 4RGMC 2ITDB 3QJHB 4XO4A 5FO7A 12E8L 2W9EH 2DTSA 3QZLA 2WQ8A 4WJKB 5D7SH 3VW3H 4Z7QE 1JNHA 4UOW1 3CHQA 3HHSB 4OB5L 2XKUA 4TNWK 3HFML 2CMRL 1QKZH 3WEBA 4X7TB 1CGWA 3O6LL 4LCCA 1K3IA 1OAJA 3RJDA 4JR9H 4LLMB 3BUTA 4ZMWA 3BIBX 5E6IC 1RHHA 3F7YB 3KGRA 3SY0B 2ZCZA 4MQXD 4X80L 4X6EB 1QO3A 4Y5XB 4C56B 3RWHA 4XVTH 1I1AB 2GT9B 3X1EA 2VLKB 2QGBA 1AANA 4KZDH 1E7VA 2W0FB 2J5WA 2EC9U 5JHLL 1TJGH 1VDGA 4QRPA 4XH2B 4XMPH 5E00B 5C09D 1KCKA 4RWYH 5FV1L 3GBDA 3N40P 4XN7A 3ZE0B 4FQIH 3S5LA 3DI2B 2NY4C 3KPLB 4CKVX 4LCVA 2V9QA 4G82A 1F97A 3CAFA 5BS0D 4DKTA 3AGWA 3VH8G 3MV7A 1FZJA 1ZLWK 1YNKL 2EYTA 4G83A 3MLWH 1DFBL 4JFZL 4XCFH 4UB0L 4ZUSB 3J27A 1QNIA 4LLVA 2EDRA 2OMUA 1DLHB 2YGQA 3GBMH 5DJ8A 2Y5QA 3BWAB 3L16A 4NKQB 4YR6B 2ZP8A 3GMRA 4BELD 1AP2A 1UM4L 3P3UA 4UQIM 1T1WB 4KX8A 2YPLE 2DYSB 5DZNA 3QULB 4PLOB 5L0QB 1DBJL 5IUSA 2PCPB 1GYAA 2LW3A 4S2SA 1DQTA 3RTQC 2AABL 4TVPH 1NPNA 2GSGB 3CFMA 4LPTA 4P2QB 2UVEA 3JVGC 1WYJA 1Z1WA 1O7VA 1GGIH 2ZOLA 4YE4L 2JELH 4UAOB 4DFIA 2DD8H 3IPEA 4K8RD 2FT6A 2CU9A 4MNHA 4FI6A 3TZVC 2WWKO 4OZFA 4BFRA 1C8QA 1R1CA 2IFFL 2YD5A 3MHZA 4E9WA 3ZE1E 3VXSE 1P69B 1TNNA 1MY7A 3E2HC 2XIBA 3MODL 1Z3GL 2ZCLL 1ND0A 2B16A 1VPOL 2BIPA 2QPFA 3BIAX 3ZUNC 1ADQH 4FKKA 5EZOH 3TA4D 4AG4L 1Q72H 3RZCB 2D4FA 3QE5A 3SO5A 3KPMB 3ZKNC 4GSDH 4RVBA 5ID0A 4EDXB 5JXAH 1QWUA 1EPFA 3AS2A 1C1EH 1J1XL 1D6VH 4NC2B 1KPUA 3HI5L 2OTWA 3UTZA 3WLBA 2OMYB 2WO4A 2B3RA 4I89A 3P77A 5CM1A 1GGTA 2XQYK 4DFHA 2X6MA 1EDYA 3AQZA 2F54E 4ZS7L 4YBQD 3VFUA 3HHRB 1ETZB 5KTEL 4HISA 2P8MA 1PZ5A 2ICCA 4GW5A 4UQ9A 4QLRA 4H0LC 4ZX3A 5LAPA 1JZ6A 4OAWA 4RGND 3BOVA 2IPKA 3EBIA 5HI5D 1NGQH 1NMAL 5KBMA 1WVZA 5HVHB 1RK0A 3LZNA 3IF1B 4X4YB 2G60H 3F58H 2FZ3A 2YWZA 3OMAB 4PS3A 1TDQA 4QLWA 4NNXB 4ZFFA 4HP5A 1L4IA 1H3XA 5D1QC 4DQOL 1VRSA 5K9KB 4JZJB 4NJAL 3MRFA 5IMOB 4W4OC 2UYLB 2XPZA 2R0KL 3GMQA 4A7TA 8PAZA 1Q90A 4G59C 3OAWA 4FEMA 3U83A 1C5DA 2LHAA 3QDMA 3FCSB 3FONA 4YDVB 3T0EB 4JFDD 3N2JA 1BFSA 2HJFB 3OZ9H 5ITFA 1FIGH 1A7QH 4WUUE 5JNYB 4KJWC 4WHDA 4UQDA 2OJZL 2FQEA 1THCA 3X3FL 3DYOA 4LLYA 2VXQA 1PJ9A 1RZKC 2VL4A 1QSEB 3D4ZA 2XY2A 1MZZA 4TS6A 3QYCA 1ZTMA 3KYNB 4XZ4A 4BSVA 1KJ2B 3WGUB 2V2WA 2XZCH 5ABDE 1I1AD 4ZMLA 4GPVA 3ECWA 3BDBA 4DP5X 2J1ZA 2NUPB 4HGWA 4JY5L 4U1HB 4EI6A 4U6VL 1IGMH 2C9QA 3G5ZB 4ICWA 1FO0B 2Y2YA 4NQEE 4L9LB 3D0VB 2I60L 4AEFA 5F71A 1J5OL 3FQWA 4MAYB 1KC5H 1GZQA 2WAHA 1OVZA 3CXDL 4JKMA 2AAAA 4XAKD 3OKKB 4TULL 4PRIB 2JMRA 4HCIA 3LS4L 3OMNB 4GJTB 1DBMH 1KYOJ 1G7MA 4EBQL 2G75B 4JHUA 4Q6YA 1B0RA 5LCVL 1EWHA 2DYRB 1EFXD 2RACA 4ZD3L 1DVFD 5IBLD 2QT6A 2CLVA 3EUUA 3EZ8A 1JZEA 4EF3A 1G6VK 1UOKA 3MUHL 3SE4C 1NLDL 3ASNB 2O5YL 4L3AA 1UH3A 4N2GA 2WB1A 4YXLH 4PM1A 5AZEL 4KRMB 1U91B 1JGIA 4GEIA 4PGCB 3F6JA 4QHUA 2OI9B 3HB3C 4GAGL 4EI5C 3JVGA 4ZXBD 3VMOA 1V54B 1E4XI 3EUDA 3IU4H 4C54A 1O7DE 4ZPVB 5I16A 4GBXA 5DR5L 2J5LC 3D39E 5JIHA 1XB6A 5J11C 3CCHA 5DVOA 1IBGL 5DZVA 5AVRB 3VXOB 1MAKA 3S2AA 1Z66A 3LD8B 1T66C 4H88L 3G5WA 3TJEL 3UBXG 1T1XB 3APMA 4XCCH 1T0NB 2WBJD 5CD3B 5KN5B 5IB2A 4GRLA 4R7NA 3SDAC 4ES9A 1K3ZA 4J3VA 1P1ZA 4XI5C 3KYKL 3G6JB 4KDWA 4QD2E 3HI6L 3U2SB 1I8KA 3UMNA 1RPKA 1E67A 4PRBB 3GF8A 4GQZA 5ADOL 3ROOA 3N9GL 4DK3A 3V6ZA 4QRTB 4KTGA 4AIOA 1ZWIA 3GXDA 2ETWA 4UAHA 1K4DB 4G7QB 4ZUUA 1GW0A 1UZ8B 3FQ4A 4N0UA 4LP8A 5MERB 2FBJH 1KEML 1EZVX 4LGSB 4UQ3A 3S98A 4ZAKD 1DLFH 4ODWA 5FIEA 2WN3A 3OXRA 3HR5B 3W3BA 1KXHA 1B9KA 1YPZF 2WQRA 5EO1A 4AJ0A 1AGEA 3KYAA 5T1LA 2A0LC 1N8OE 5EO9A 4I0PB 4KQ4L 1V3MA 5KSAD 3DPDA 3EGSA 5D72H 1HILB 1JDCA 2FIRT 1AZCA 4GRMB 2Y6SC 4WW1A 4MNGB 2X4NA 4RFEB 5EIIB 3L1OH 4L3EB 3FQRB 4UANA 1TEYA 2PR4H 1D6VL 3FQNA 3H4HA 4WO4B 5DFWH 2LAGB 3EOBB 2VLKD 2KYIA 4JY6A 3V0VB 1QABA 5A16A 4H2CA 1QEWA 2V7NB 4NUJA 4Y1AD 1UEYA 3PHSA 4G5AA 4HIXL 3DURB 1BD2E 4KKAD 2R2EB 3U48A 4X0KB 5C0DB 3T65B 2QJDA 3M8OL 3T4YB 2DJ4A 5KSBB 3HUJF 3L4CA 4JX0A 2ESVA 3D7PA 3QRBA 5AOMA 4KK9C 3CDZB 1F4AA 2EIKB 2QQLH 3PXHA 3GSUA 4FFZH 3NZHH 2HX8A 3EJSA 4PUBL 2AXFA 4CBZA 5D2LE 4Z7WA 1F0LA 3VGAB 4NOFA 4G1MA 4APQA 3A6OA 2EYSB 3BPLC 1DVSA 2FD6L 5IJKC 1TG8A 4FQ1H 1PG7L 4OF7A 5L2KE 1J8HD 2Z8VC 4B0MB 1CUOA 3C60C 5IOKA 3EGSB 4JHAL 4ERSH 2FO1A 3CFQA 4PJDA 4YN3A 4FA8A 3WIFB 4FXKC 5F88A 3VFWA 4NNPL 3HR5A 4QTIL 2HFFA 5LGKA 1OTTD 4IHBA 3VI4E 1RSFA 3PFQA 5D2NC 2X4QA 4K8RH 3T1WA 4KUCF 4NQSB 2JH2A 3S6CA 4ZSOA 2CLZA 4ZQKA 4WK4B 5C0CB 3P3YA 5I1LB 2ZUTA 3OG4B 4XCEA 2ICES 3PE9A 2FO4A 2I27N 3QEUA 4I2XA 4JFZH 1ZWIB 4AJWA 3DX4A 1JG9A 2VSKB 3GSQB 2B59A 4ZO9A 4GQRA 4XNQB 1SN0A 4PRBA 5E94B 3HC4H 3OSVA 1NBZB 2HVBA 5T3XH 1JZ4A 3K6FA 4PJIF 4CVWA 3JWOC 4BRVA 2A9BA 3PNRB 3CXFA 2O6EA 4F1SA 1MCIA 1CGVA 3KS0H 4P99A 1J0YA 2QQNL 4G2AA 1LK3L 4UTCA 3R0MA 4ZDHA 1IGML 3DHJA 3U4BL 5L8LB 4HFUH 2R83A 5KSAB 1CGUA 3MRKA 1TKWA 3IJ8A 5ILTH 3C6EA 3P4OB 5C8JA 1SHXA 3KPPA 5DYFA 4FTDA 4UM8B 2DH2A 1KENL 1OM9A 3GLZA 5GXBB 3C12A 2K78A 4HWBL 1I1RA 1FQ9C 2YPVL 3IJYB 5F7UA 1H19A 4YEFA 3Q2LA 4M1DH 5EOTB 5F6IC 1DEDA 1EDHA 5DEGA 3CX5J 4N2AA 1R3HB 1SUHA 4B9KC 1LGVA 5D8JH 1HWWA 4B5ZA 3UG5A 4UDTA 5F7YC 2ZCLH 2GBTA 1IARB 2P44B 2PO6B 1AIFB 3PGDB 2GPZA 4W9JC 1NFIA 1SHWA 1ZAGA 4RDQG 3MV8B 3CK0L 4CC4A 4Y4KA 3A67L 4LOVA 1JPFA 1QRNA 2A9NH 5CIPH 5GJSH 2WTOA 2BCKA 2FUTA 3BPNB 3FCTA 3MROA 2H6UA 1QNZH 3A4EA 1NFDF 4Y8AA 2DWSA 3U9WA 4Z6AT 2PCXA 2VCOA 4GG8B 5IROA 1HCFX 1FDLH 3OX8A 4QRPE 3HEIB 5ILTL 1SJXA 4A7VA 2NY2D 3HZ3A 1KCRL 2PWDA 4KJPC 2WLLA 2ZKMX 4WI6A 4Z3GA 2JB6B 3IFPA 3M1BB 1EH9A 5EMYA 1U8OA 1TQTA 4G43B 1T2QL 1XQ4A 3HVDA 2C9UA 4U1HA 4WQOA 5I1CH 1MRDH 1FRGL 4PV8B 5DHYB 1LEGB 2NNAB 5JOPE 2MPAL 1DN0A 5BO0D 4B3EA 1P4IL 2O61A 3SDCB 2H9GA 5HY9A 3ZYZA 2WCSA 5GZND 3CCHB 1KN2L 4OFYA 1BQLL 1UXSA 3V5HA 4EIZC 1B2WH 2A9ML 2P9RA 5TDPB 3OJDA 4G7VL 1Q94A 1KIPA 5HGHA 2VC2B 3WY2A 4NKDA 2VXQH 3G04A 3T0DA 2W88A 4Y4KC 1UYWH 4WHCA 4WI5A 1KB3A 3D39A 5D7HA 5E6ZA 3H42L 1JGUH 2QGEA 3OGCB 5JLZB 1I1CA 2DM4A 5BOPA 5CCJA 2Z91A 3ROOB 4WDIA 2Z7YA 3WKMH 4HMDA 1LE5A 3G6JA 2NX5E 3IFOA 4OU3A 5INCA 1Y6NR 1OK8A 1CD1B 5KSBA 5BRQA 1ZE3C 2X05A 2NY0B 4HG4J 2YUXA 3DX7B 2YC1B 1P9MA 3M17B 2JKXA 3ME0B 4HAFA 4I88A 4PRNA 1GL4B 4N8UA 1ZGLB 2BDNL 4PRIA 5CILH 1G7IA 4FNLH 2EDKA 4B95C 4ZTOL 5JPNA 3TGXA 3QXVA 5DUML 3DJSA 4NO2B 3OV6A 3QVAA 3DV4A 5IW1B 4KY1L 5GGUA 1DQVA 1IM9B 4PPTA 2H6PA 4U6VH 5F3HB 2V5SA 3JWNG 1FE8H 1G7LB 2AEOA 3FQRA 2WBJB 4PJEE 1BD2D 2E3VA 4KI5D 4RZCA 3T0BA 1RPUA 3ARGB 3H9SA 4KRNA 5KVEH 1BP3B 1CMOA 4Y2DD 1IT9L 4U31A 4Y2OB 3QC5X 3QORA 1KPUB 1LP9F 5AVXB 4BIKA 4ELKB 1B4RA 4N3UA 2EEXA 2EZ0C 4NT6B 3D2UD 4GKOA 1D3CA 4Z7QB 3DRQA 4FCHA 5LVEA 1EMTH 1VIWA 3P11L 3BVVA 4PJAB 3MRRA 4OZ4B 3ULSA 3NJMA 2G75A 5JQIB 1C5DB 4NQEA 3A21A 3BUBA 1P7KA 1IX2A 4AMWA 3T09A 3L3KA 4GXVH 4KROB 1BPLB 4JEGB 4PHZA 4XOAA 1MFBL 3F01A 2ZKWA 4U1NB 4LHJB 2ZOLB 1SJEA 4YHNA 2YPLD 2GTQA 4MA8H 1RURH 1ZT7A 3OKLB 1R33A 4H88H 4L5FH 4E41E 2YA0A 5AW8B 1YEJH 2QTEA 4PTUB 2X4OB 3H0TA 3MUJA 4J8RA 3VVVA 1M6OA 2NY7L 3DXAB 1JD9A 4XBGB 4LAQL 5I1KH 4CA4A 5E4AA 4WO4D 3FO9A 1EIBA 5C0ND 5CBAA 1TZHA 3PWNA 1L5GB 4QRQB 1LP9E 1WGVA 1YN6A 1KG0A 2VMFA 4R2GB 2IWKA 4UNVA 2Y72A 5F6IB 3MRPB 4WSJA 5L7XH 4N90E 4P2RE 4L8DB 1I75A 3W9EB 2EVFA 2E9IA 3QWQB 1T5WA 2AQ3A 4FLOA 4ZFFB 3T8XB 1I4FA 2XHNA 2CPUA 3DYMA 4JM0A 3TS8A 5HI4C 4X5RA 4WU7A 2IAND 4KUZH 3Q8FA 3BKMH 5E00A 5KSAC 2GG1A 3MGTA 3GMNB 3MU3A 3DSNA 2DN7A 2F1AA 5F1IB 2D7QA 1AI1H 2EEFA 4Y5VB 2ADGA 1YZZA 3IDJA 1HINH 4G1EA 2R39A 3MMEB 5SV4A 5JXED 1ODUA 3WKPA 2UY6A 5FA4A 3EOTL 4JPVH 3ARVA 3I02B 1ZLVH 2AHIA 4IDJL 2RBLA 2JELL 1UA3A 3QQ9C 4Z23A 1NBVH 2K4WA 3L9BA 2A38A 1SEBA 3PAVA 4ZOAA 3SE6A 2HT2C 5J7CC 2OMYA 3MRJA 2AGJH 5HDRA 4Y1AB 4GNKB 4ADGA 1OSZB 1SYSB 3UDWA 4C83B 3J7HA 1YEFL 2UZYA 3B2UC 5EPMA 3EH2A 1YCSA 2ZIDA 4LT7A 5FK9B 5IR1B 2KI6A 3GS4A 5F89A 3RHWF 5FCUL 3BLPX 2D03L 4XMLH 1HH9A 2PPEA 4JM2F 4Z7WE 4F7PA 3L08A 4JFDE 1WRFA 4O2EB 2P5WD 3NZ8B 3RE0A 2ZCHH 3WUWG 5A3ID 1BX2B 1A9EB 3SE4A 2CPCA 3O2WH 3VXTA 3P3TA 5TF0A 3TBSA 3CBJB 3TYGL 2TRHA 1WP6A 3HRZC 2XBTA 4FABH 3EOAB 1NQBA 3M7FB 2KDYA 4XBGA 4BDVB 1OCCB 4QRPB 2GW5A 3LEXB 4AQEB 5HGBA 2CDEA 5IBLC 3DWTA 3EYQD 3KBPA 4DKEH 2C4XA 2ALWA 3OKOB 2NR6D 2VN3A 5IWLA 1X4YA 3EO1A 3L9EA 2IBZX 4OLYH 2P5EB 5E56A 1N64H 1I3VA 1XGQB 4HBCL 2E74C 3GMRB 5CCGE 1MREH 4OJFH 1I8IA 1BVKA 1ETZA 2H8PB 3MN8A 5H37A 4O58H 1A3RH 3QG7H 3QDJB 2H2PD 4MJ2A 3VRIB 1HNFA 1A7RH 2BP0B 2CR0A 1FGVH 3NEOA 3NPSB 1NWOA 1SFDA 3IJ9A 4UMSA 4AVHA 5I71C 5KVEE 2ZUYA 1U8IA 5JIDA 2VL5A 4AK2A 1I1AC 4KKZA 2WLMA 3RZCA 5E03A 4ZS6C 1IT9H 3DNKA 4RA0C 2LABA 4OZ4A 1EJ6A 3ULSB 1WFUA 1AZRA 2UZIL 3O0LA 2LOEA 4M6ML 4WW2F 3WEOA 1DQLL 2XRAL 1VCAA 3NFNB 5BVJB 1BZ8A 1U42A 2B2XH 1N0LA 7TAAA 3QEQD 3BH4A 1JF1A 3G5VB 3GZQA 2FVNA 4OFDA 6PCYA 5JHBA 4YC2B 1E40A 2F1BA 2YD8A 2OP4L 5D2LF 3TO2A 4TUJA 3W56A 3WUZA 3IETA 3UOAB 4FNUA 1A64A 4AOFA 2WXIA 3NIGE 1TT6A 3BIKB 1SDDB 4F2FA 1VADA 4LSTH 1CGYA 3FB8A 3VFVB 4Y2LA 3WIAA 2PXYD 3PL6B 5B39G 2BZCA 5CJXA 5D1QD 2O5ZL 5GRUL 3RG1C 3HFMH 3TVMC 2K6YA 3P4LA 5JPNB 3QWNA 4KI1A 3HN3A 1W0WB 1A8JH 2J5LB 5J11B 1RZKL 1UWGH 3ZE0E 5CGBA 1EEZA 3ARFB 3GMMA 3UTTE 2GABA 1XF2B 1U93A 2YJQA 3K6SA 1LK2A 1ZHLB 1RAMA 1B2YA 1ID2A 5DJ0A 2AEPL 5DJ8B 3BT0A 1R3JB 2XYCA 2X6AA 1TEFA 2Y3AA 3RX8A 2VLRA 2Q86B 4LKXA 3QJUB 4MYWB 4PU2A 1R5WB 1QBMH 2Z31D 4LARL 4MMXB 4FQXC 3D5OF 3EYVB 4AGOA 3Q6GL 2VDPB 1QPKA 3B7RL 2CXGA 5I24A 4HF5H 1AGDB 4KRPC 2ZX7A 3T3PF 3OJDB 4MAUH 5E0FA 4FMFA 4MNGE 2VN5A 3BZEB 1NKRA 4HKJA 4AIZA 2JXMB 4FS0A 3SDAB 5B3JE 2EUZA 1NUNB 4PJ8B 4P05A 1JZHA 4YHPA 3SDCA 4LOFA 2B77A 4RA3A 4IJ3B 3OPZL 4TSAH 2RAMA 3B9KA 4O02L 5CEZL 1ZXKA 3RVTC 4N68A 5I19H 3T8VA 3O4LB 3NP4A 4ONHB 3U9UB 5SWZB 4NKMA 3VAEA 2GEEA 4R7LA 5E1QA 1JVKA 3O9WA 3E7JA 4YEEA 3UCRA 1KF9B 5CFHA 1BVOA 3QEGH 1CFSB 3OPUA 3TIDB 4LVHC 4PWGA 2OZ4H 3IFNH 2X1OA 4K7PY 4LLWB 4Z7OE 5D7JA 3ZT5A 4JG1L 3WJMB 4TL5A 4PLJD 3RY5A 3SJVE 4MRBA 5JZ7D 2X4RA 4I18B 1D2OA 2NY3D 4A6YA 4G8EB 2IBZY 4ONGL 4RMWA 5I1JH 1M56B 1AC0A 1KEMH 1JK9A 1HL9A 2DJMA 3TPUB 1TZAA 2Q3ZA 3L8QA 5C07B 1ZJAA 2YPVA 1TQUA 2YRZA 2VLJE 3L4VA 4JRLA 4LFHG 1BLNA 2R0ZH 2AF2A 4NP4H 4R2GD 1MELA 1IBDA 1CF1A 4GG6F 4G42B 2WLIA 4OV5B 3NAAL 2PWGA 2OKMA 4JHWH 5IBTL 3B8SA 5JDSB 3CSPA 1CXFA 2WPGA 1X5GA 1GS7A 2NY4D 2ORBH 2HSIA 5I8CA 1MVUB 4XP6H 4N24A 4LL1A 5FLUA 2KZWA 1WSST 4PWFA 3HZVA 2UZXB 4OD3H 4TUUA 1S46A 4ONGH 3TJHC 1AVAA 1BGXL 4W9KC 5AAMC 2FR4A 5KAQF 1OAZL 4NRZA 2DQUH 3QUMB 3FN9A 4Z7VF 5J9PB 2ZICA 1D5ZA 4GKLA 4XP4L 4A6YB 1QSED 3LMJH 5HGGS 1HIML 3WFDH 2APVA 3DDGA 3BJLA 3HCVB 5HI3D 3DTXB 2FYVA 4OBRA 1X7SA 1HWGB 2PKDA 3C6LA 3QDHA 4TTDD 5I6PA 2OR9L 4MCZA 3ZQWA 1KTDA 5B22A 3L4ZA 4N5ED 4AV0A 5DMGD 2KHAA 4WTZG 1D5ZB 1BF8A 3C75A 5IUCA 4TNVK 2ZX6A 3ESVF 4HQQH 4CVZB 3GSNL 3FAWA 4IBSA 2YSSB 4XPTL 5GSRB 1A7PH 1E28B 1X5MA 5ITBH 4X6DF 5E9DE 1OALA 2GQHA 3BKCL 3SY6A 2G9KA 2H1PL 4AVKA 2Q8BL 3ZDXF 4JLRB 3MXVH 1KGCE 4OGAD 2MCPL 1H3PH 1FYTA 1MW1A 2ADIA 3JTTA 3OZ9L 3CN2A 3IMTA 4QXVA 5EA0L 4W9FC 3MI6A 3QUXB 4GUOA 1G1CA 3LIZA 2Y5TA 3GQFA 2CM6A 1YDPA 1N5YL 3RTQB 3ARBA 4FP8H 3DXAD 3CC1A 1NCBL 5AWNL 2GFBB 5C86A 2VXTL 1KBKA 4G9FB 3IJHA 5JYLA 4W9CC 2ODIA 4HZLB 5F7EH 3A6BL 2NT0A 1MFBH 3HC2A 4UIKL 2NY0D 3X3GL 3FW6A 4MDRA 1FG2B 3VVWA 2Q86A 5BV7C 2DQHL 1MCEA 4E9YA 4DEWA 3EZJB 4I4WA 2IH8A 2HT3C 2W80C 3GSNH 4I3RH 1R3JA 1T04A 2AZAA 3FCGA 2GC7C 2HRPL 2VZ3A 4NQQA 4WO4A 5E2VH 1BBDH 4WF7A 1LWRA 1B0WA 3BP4A 3KPRD 4MMYB 4BSWB 3U46B 2LGNA 1S8DB 4PV9B 2YFNA 5DT1H 2V8MA 4P04A 3MLYL 1A3QA 2NTFA 5J0BA 1S3KH 3OXRB 5I26A 5L9DL 5FKAA 1R19A 5IEHB 3L3IA 3ZDXE 1EO5A 5MERA 5D96C 5AWNH 1NEZA 4JDEA 4PJFB 4OGXL 3KL5A 4IIQA 3B9EA 4WEMB 4XVUD 5E4OA 2G0KA 3G3LA 1J1PH 5AB1A 2CQVA 1FAIL 2FHBA 4ZI8A 1OB1B 1K4DA 1QA9A 4PVLA 1E43A 5TGBB 4N2DA 3Q2CA 1UD5A 1GXEA 1YEGH 2UWEE 4HCGA 2GTZA 4JRXD 4N28A 4I3SL 2C9XA 3F5WB 4OZIF 4GFTB 3HZKB 5EZPA 3VX1A 1W2KT 2DQEL 2HTLD 2FYYB 4XRCA 4MLSA 4Z7UB 1MJ8L 2R69A 5ICZA 4RWYL 4OLYL 1U3HA 1F8TH 3L7EA 4QXTB 4KJYB 2F5BH 2CKBL 4OJFL 5D93C 1XCQB 3LKPA 5A43C 3FT4A 1NGWB 3WS6C 4IRZH 3BISA 3ZDYB 3INUL 5IWLC 2OJEA 1MCQA 3E0GA 3ZHLA 4J3OF 4HKZA 1ZPUA 2A6IB 5HHOE 2HFGL 2N59A 4PGDB 5LGHH 5TH2A 2XV0A 3JXAA 2MKLC 3VM7A 1YAZA 2OMZB 4F7EA 5I1DA 4FFYH 2CBMA 3LEVH 4DKFL 4XNXL 4OD1L 5I0XA 5IY5B 2JTDA 3AITA 4GSUA 1DEEA 4PIBA 4M7ZB 3ULAB 5CJQL 5GS2H 5JDSA 4TQIA 2BVEA 2EH7H 3PL6A 4U2YA 3C87A 4BQBA 4HSQA 4ORGB 4LRIC 1BZ7B 4QOKD 3EOAA 4NGHL 5LGJB 1M71A 2QZQA 2OMXA 3ZTDC 4JHWL 3MO1B 1NCDL 3ZVVA 4NHUA 5ANMB 2WYHA 3KLDA 4RMBA 5G4NA 5T1DH 3JV6B 5CFAA 1NICA 5AW3B 1UADC 1T7XA 4XE0A 5CN3A 1KCRH 1WO2A 5L4MA 2IH9A 2V4LA 1LNUB 5BUPA 2WZ5A 5AAWA 4LVOC 3QJVB 2E6PA 3GO1L 2AJZA 4CJ1A 1HWHB 1T0OA 1ZT1A 4PP1C 4WUKH 3BDXA 3HAEH 4ODHL 2JJUA 5FB8A 5IEKA 3ULVL 4KQ3L 2VDOB 1KIUB 2HLFC 1QG3A 5MEQB 4AW4A 4TQPA 1SYSA 1LQBC 3V0IA 4TSBH 2EE2A 1BLIA 3V0FA 1OPOA 3E6HB 1A6PA 1GSMA 3Q8EA 4LEXH 1JZGA 5AG9A 4LPXA 2Q8AH 2NY6B 3FONB 4YDVA 1G0XA 1JWSB 4BYHA 4CGTA 1CDHA 2ITFA 1D7DA 1V7NH 1QUPA 4I5BB 3O8XA 4YHIB 3OZKA 4HXBL 3O3EB 1WUZA 1XSOA 4Y4FA 2P5EA 1MHPL 3QEQA 4G7YL 1V3KA 1M05A 5F9OL 5K9KA 4J4PD 3NK4A 5F7DA 2X4UB 4HJGB 5DD0H 3UJIL 2Z9TA 5F1IA 1JXFA 3ILDA 2QR0A 1DL7L 4IEFB 3NCFB 4P23B 15C8H 1NIBA 3UADA 2OTUA 2XWDA 3Q9QA 2AJYL 5I6XC 5D7LA 3RI5K 4X6FB 2D2CC 2DWEB 2XXFA 5DYOB 4CDHA 3T0XA 4GXUN 3SOTA 3OSKA 3ZMRA 1PX3A 3EXLA 3HMWL 2ILLA 3VW3L 2FLMA 5ALCL 3CXHJ 1N4XH 2DI9A 4B60A 2OYKA 5KYXA 4AL8L 2R7EB 3SGEI 2NW2B 4LFHD 3PJNA 3RVXD 3DVGB 4MD0A 1DE4A 4UT6A 1DANT 4R2GC 5B8CC 1T80A 2MH4A 5HDQL 3GB7A 4NJAH 2X2IA 1CD0A 2WQSA 4G7RB 5EBLB 1JF6A 1F4HA 2X1QA 4N2BA 4XNBA 3CVHL 3LNGA 3QUHA 2V9UA 3DOHA 2JQZA 4X8JB 1BAWA 3H9HB 3NACL 1NGPH 4IMKC 3EIFA 5FA3B 3C5ZA 4XVTL 2XNAA 1EHLL 3GEWB 3TA3B 1E2ZA 1E7UA 3S8WA 4JFDB 1A2YA 4J3OC 1D5XB 3PLYA 4NAMA 1AR1D 4F57L 3VFGL 3GJFH 3MRMB 1NOAA 2WLKA 4BUHA 4NUGL 4LEOB 5F9AC 1Q1JL 1CU4L 5E5MB 1AHKA 2LE9A 4Y1SA 1KGWA 4OZFH 1INEL 1VERA 4NP9A 1AGFB 3APFA 2JJSC 2VQUA 4X5WA 2BMKA 4LEOA 3RVTD 4Z5RB 1RD6A 2IADB 4AQ1A 4WCYH 4TLSA 1L0YA 4YWGL 1J5OH 3MRMA 1Z5LB 1YECH 1ZD6A 1ZANL 2WNKA 5HYQB 3UXFA 4OF5A 4JFSA 1KWKA 4BV1A 3QO0A 5BCAA 5TDOB 1A9BB 4FQQB 3WMQA 4L8DA 3FTGB 3U6RA 3OQ3B 5EEUA 3S88L 2OXHA 4EUPG 4EZKA 4BKSC 5E8EA 2NY7H 1L3WA 1U8MA 3LKNB 3UBGA 5BJTA 3PXJA 1DLHA 1PSKL 2EXWD 3SD2A 3BN9D 1KEGL 1AS7A 5KYYB 2IV9A 5DC9B 1DUYB 1E2WA 4LPCA 1DCEA 4HK0B 2V17H 1JRHI 1ZS2A 1XZ0B 5BXFA 1TZ8A 3OKOA 3UTSB 3QPQC 3FMGH 3INUH 3SBQA 1NEPA 2FEDC 1X5FA 4Z8FH 5D1ZI 2VKWA 2YC1A 2C26A 2HFGH 5LGHL 2EUXA 4KUZL 1ZOXA 3B43A 4I0CC 3IXAA 2MWCA 2B5IC 3P73A 3WN5B 3NZSA 2QKSA 1CI3M 4U3SB 5DFTA 3TV3L 2GAZB 2XBZA 4G70B 1MZYA 1J05A 3G6AA 3E6FB 3JWNH 4M29A 1JWUB 2FJFB 3ABGA 2PXYC 2FGZA 3O4OC 2Z91B 3IAGC 3TEXA 4KKRA 3FT2B 3HHMA 1KLGB 1OF0A 1U3HD 1PNCA 5FYKH 4ZMOA 3D39B 3HN5A 1BZEA 1U41A 4I5BA 1XR8B 1E90A 5C6TH 3VFOB 4FA6A 3IWVA 4LVOB 2K9UA 3B9DA 4OLXL 4WHTA 4ZS7H 1JPSL 5KZCB 4PRHE 3CN1A 3DRQB 1Y0LA 1A3LH 5DCCA 5FA3A 3QG7L 1UXSB 4XVSH 3V5HB 1I7UB 4HIIA 5I1EL 4UIKH 3PV7A 1YEFH 3TFKC 3AB0B 4AYBA 3OZLA 4PG9A 1NBCA 3QUZB 4Q6IC 4FYTA 3QG6B 5ABZA 3M1OA 2GJRA 4Y5VC 5J3HC 3F83A 1G7LA 5E2UH 2NSXA 4D9QE 4DF9A 2CD0A 4P2RA 4X80H 3NH7H 1EAOA 4XMTA 4HJJH 1C7SA 4HAGA 4FHKA 4BEIA 4JJHA 4HX1A 3WSQH 1YEDA 1JPTH 1QTPA 3ELAT 5IF0A 1KBWA 3DHUA 4KMQA 1W16A 2PO6D 4FL4C 4TVPE 4GG8A 4TMPA 1JHKH 1EJOL 2V2TB 2BC4B 4XPTH 1JGLH 4HXAL 3KPRA 2ZXDA 2WXLA 4XMVA 2AITA 2OTUB 4XHJD 4NUMA 5DMIL 2QFRA 3D12B 2HJKB 4QO1A 3D18B 3VWJC 2CUIA 3IFOB 4A2DA 4L3EE 1TO4A 1PDKA 1SXAA 3IDYB 2PTTA 1P0SE 1RIUH 5LAXB 3QPXL 4QTHB 3H85A 4JAMB 2WC7A 3BDYH 3B2XA 3MX0B 1QFHA 2VB5A 1GZPA 3WYRA 2CDGB 4CU6A 1BVZA 2WSDA 3S36H 1VEMA 3TT3L 3EGDB 5GS2D 3NRPA 3TO4A 3V6OC 4WWNA 5KEZA 3UPCA 3O8XD 4HJUA 4MDJB 5DO8A 1IJ9A 4LBAA 1BVNP 5J6SA 2ZYSA 3GJFB 1BYPA 1EJ8A 3LHPH 4P2CG 2DPKA 4NPKA 4YIQB 1HS6A 2VKXA 2BSED 4ADIA 3OB0H 4LP4A 3B6SA 1TCRA 2MCAA 4E41D 1M42A 3OC8A 2CO7B 2Z8SA 4DGIH 2DIBA 3BLBA 3LY6A 4H8PA 3ZSSA 3UYPB 1B4JL 1EQWA 1TJGL 1UZGA 3GSNB 4NQCE 2NT1A 5AG8A 3K4AA 5A2IH 2OL3A 1FNLA 3FTYA 5FGBC 3U0TB 1YYML 2ZCKL 1JZ2A 1UWEH 4FQHB 4GMTL 1NAMA 1KUMA 1CPUA 2F18A 1MFEH 3IMBA 4HS6A 4Z7IA 2EDOA 1QLRA 3CZKA 3MJ8B 2AQRA 4XNZB 3TO4D 4ECNA 5CBEB 3MRRB 1HT6A 4YL4A 3TN0C 3UZEA 1JPFB 4IK7A 3RAJH 4JRXB 5ETUA 4XCFL 3BUPA 3LHPL 1CICD 3FFDA 4Y0GA 3SKMA 4QUOA 3KDPB 4M5ZH 1MFDL 3O41A 1ULVA 5CKGA 4FG2A 1HYSC 3WO4C 1SY6L 4GKNA 4KK5D 1J12A 2YXMA 3DUHA 5CN2A 4JN2B 1CXEA 1MCKA 3NBNA 1JOIA 2JJSA 4M1DL 4BQ8A 1UASA 4KXAA 5DRNA 2H6PB 32C2A 3P9LA 3LPOA 4WUKL 2Q0ZX 4J28A 5HD8D 5KW9L 2R8SL 2G3ZA 4KJYA 1E27B 4M1GH 4Z0XA 1F8TL 4XC1H 4PJHE 2FSDA 5C0NC 5CILL 1FZOB 2KPNA 4RISL 1HHIB 2BIQA 4R3SA 3ZDZF 4ENED 4ZDHB 1DBAL 1FNGA 1CD1A 2OJ1A 3AAZA 3FU8A 3LDBB 1O9WA 2Q7YA 2N7SA 1M7DA 1MCJA 2QZ5A 3HE7B 1L6XA 3LCYA 3EOBA 3U0PA 4KKLC 3V0WH 4AV5A 4YHOH 5FFLA 2VZSA 3IPFA 3QUMH 3R7RA 5DJCA 4OD1H 2MHAB 4BGDA 1CXIA 4MASA 1CLVA 4NRXB 2E9WA 3VSVA 3X2QB 3TCXA 3S36X 2DWYA 1JNLL 3ZE1B 1MCNA 1KFGA 2X4QB 5IEHA 2ZYHA 2OMWB 3P54A 3HAEA 3W9DA 3B4NA 3BQUB 2IH3B 2K7QA 2APBA 4Q0XH 2BP3A 1SMAA 1U8HA 3RVUC 5BOJA 3EDDA 5TK2A 4G7VH 3HMWH 1SRDA 1QBBA 4KO5A 3V2AR 1S8DA 1QRNE 5DJDA 3SDXA 4PV8A 5DHYA 1CG9A 1LO5A 2DTMH 4GW1A 4Y9BA 5FGRA 2W9DH 2DOCA 5D1QB 3LRMA 4GRLD 1XF3A 3ULUL 2AQSA 1EXUA 4GFXA 5DC2A 1TENA 1MCWM 1P1ZB 4AK1A 3KPOB 3BZFA 1YPZB 2H0EA 1BIIA 2NSQA 3PJLA 1VKXA 4KI5C 4DESA 2ADJB 3V6FB 1P6AB 1XR9B 3NH7L 2G60L 4G5ZH 1P5UA 3S5ZA 1GHFL 1OAQL 3ZLQC 1FG9C 1LMKA 3NAAH 1X9UA 5EU7C 3FQXA 1XGRB 1YDPB 4QRPD 5CEXA 3LHAA 1MHPH 3VXUB 5DMYA 1KWGA 3DIDA 3FSVA 3I2CH 2EIZA 2WINA 3TWYA 4MJ5A 4A7UA 4FG4A 3KGTA 2NYYD 4QKXB 2K70A 5AW1B 2ZKHL 1R3HA 3SGJA 3WELA 1IGCL 3MX0A 2BY0A 3WFEH 5C92A 1AMXA 4TNVF 4TNEA 5J56B 4MS8C 3BGFB 1GY2A 1MCDA 5AAWC 1J9CT 5F9JA 1TTFA 3FU3A 1ZA3B 2YXWA 2ED8A 2VERN 1O9ZA 2PYEE 3NJIA 5EC1A 5FYKU 1U58B 1P6WA 4A37A 4FYQA 1XWVA 3THML 3PGFL 3KHOA 5D7IE 3UPAA 1WA0X 4PB9H 5C7XL 4LRIA 5T3ZH 3D87B 4G5ZL 4CRPA 4JFXB 4OCNC 4TOYL 5IW3A 1BBJB 3HR6A 3IJ7A 4XWGH 5EZLB 3OKKA 3O0RL 1YMME 4GSXA 4P9HH 4QHLB 5GZNC 4N2IA 1BQRA 3K2MC 4ONHA 1CL7I 3TWCH 3EFOA 3HG2A 4YNYA 4XMUA 5FYLE 3P0VH 5IB2B 2ZKYA 4Y88A 1QBLH 1FZKA 3ERXA 5CIPA 2YGVA 4JVPA 4W6XB 3HI1A 5AOLA 2IFGA 3GMLA 2NX5B 4HUWB 2HYMA 1BXXA 3AZUA 1BFOB 3IGUA 1U21A 3CBKB 2DQIH 4LE8A 4KH9A 4APXA 3OJVC 3V5DB 4K73A 4WFGD 5AUMB 1CBVH 4XC3H 4LOUD 5JYMA 2XBDA 1EO8L 1OCZB 2APXA 1YC8A 4F8OA 3VE0B 5LBVA 2CDFB 3CZLA 4O2CB 2HB0A 3NSXA 4NZFA 3X3GH 1WF5A 5I0VA 1R4XA 5GS1C 1N7MH 4FLQA 1HHGB 4M5ZL 1JWUA 4CILA 4IRJD 4JDVA 2QADD 3OKMB 4K5PA 4FXLA 5FW7A 1NUGA 3VM5A 3D9AL 3KLSA 2NQDA 5E2VL 1LO4L 4U3SA 2X28A 4MD4A 5DURB 3JTSA 1LK2B 1ZHLA 3VH8B 1VACA 4FHJA 2XQ0A 2IFFH 3P0GB 4Y2DB 5HVWA 1NFAA 2NSMA 4S1SL 2V2TA 4WNQB 5E4EC 4K9EH 3II3A 4NQVA 2N0MA 3D69A 3S9DB 4Q9RH 1XZ0A 4B7LA 3FZUC 1PSKH 1TR7A 1AZUA 1KPVB 3LX9A 4XXWA 5E08H 4JNXA 1AZZC 4ODVH 4LDCA 4LSQH 5DO2C 1O7DC 3Q05A 4WJ5A 1DVXA 4KROC 1B6UA 1FNSL 1MLCB 3FH7A 2VR3A 3F12B 3QG6A 1PKQE 1P4UA 2P26A 4NQDD 4GRMA 3QI9B 4IOSD 1TJIH 3K2KA 3GBML 3FTGA 1NWPA 4EO5A 1NDMA 3FN0L 3W0WA 3BVXA 5ID0B 3QZWB 1KOAA 1F6AA 4OCWL 2ICWI 3DJTA 2R0WH 2YWYA 2AGJL 2X89D 3H3PH 3ATAA 4PR5B 1BSIA 2YPLB 3FUFA 4PS4L 5BRZD 1KJ2L 4OFIA 1DQDH 4JRYA 2UY7B 3U36A 4MA3A 1BGXH 3VFOA 4JANB 4WLCA 4TUKH 4MLIA 4Y5YA 5FKPA 4AUUA 3ZHDA 4ZUUB 4U6TA 3FT2A 1MDAA 1XSJA 1EV2E 4MGXA 4IBZA 1C16B 2QLVB 2X1PA 3EGXB 3QDJA 3LH2H 4L1HA 4NZTL 2F74A 5SWSA 2YXFA 4O2FA 1GIGH 5D55A 3RPIA 1S9XA 2BSSA 2PXYB 3PL6D 5DRZB 5F8RC 3U9PL 5HHOB 1BM7A 1SHSA 3MOQA 1KN4L 2H41A 1W8EA 3RIKA 4ALAH 4FN0A 1GCYA 1I8IB 4X4YA 1IC5H 1B0IA 2JCCF 3GMMB 1NM4A 3LKQA 5I66A 1NAMH 4HFUL 4F20A 2G5UA 3HMXL 1COBA 1RUML 2VITA 2ZXCA 3W1ZA 2Y22A 3QJFB 5GHWH 3F84A 3K74B 2PCPA 1A22B 5KSUA 3BKCH 5C9KA 1YEHH 2WANA 4H25A 4M7KH 5KJRL 2R9HC 3L5HA 1R34A 2O6CA 2X4TB 3K8LA 4IRSA 3GBNL 4LLVB 1BX2A 4CAGA 2RQ8A 5AQ0A 4QJ3B 5ICXB 3VDAA 2YGOA 4OTXL 4U6HB 4UQBA 1PS3A 3PHQA 2DMKA 4ZMQA 1BF5A 3JT0A 4L9LC 1F13A 1K6QH 1BVLB 4JFWA 4FQQA 5I0WA 2Y06L 7CGTA 3QO0B 5FCSH 4BZ2A 3CG8A 1OW0A 1Z6JT 3BWZA 4X9IA 2NY4B 4M7LH 4E41B 4E9QA 3EJCA 2K3HA 2A0LD 3QIWA 3WFBH 4HEPG 5C0EA 3H53A 5ISZB 1IO4C 1QLFA 2J72A 3ALPA 4OJCA 1KJMA 3LN4A 4IBLT 1ZA6A 3AS1A 4OCLC 1OWRM 2X4UA 3CVCA 4H13C 1BBDL 5IKCB 1WICA 2EXYD 3DRTA 2A1WL 1X7TA 1MVYA 1PFOA 1AGBB 2Z65C 1MLCA 3QR1A 2YEZB 4XAKE 4Z1PA 4N9OB 4ZG1A 3MBWA 5D2NE 1H6TA 3C09B 1Y07A 1KJ2A 1YYLH 4LLDB 4F7CA 4HPYH 3H9YA 5EOCJ 4RISH 3D48R 3T0VA 2Y06H 1OGAA 1L9PA 3Q44A 3VWJB 3WNKA 1SGKA 1XGTB 4R96B 3LEXA 4AQEA 4F2EA 2FATH 1HKLH 3GMNA 2VXQL 3K4DA 1M2OA 3T0EA 4O4YL 5CSBA 3CMGA 4N8VA 4PEEA 3S3PA 1PW3A 1C8PA 1ZK5A 35C8H 3C08L 1NIFA 3QUYC 4JKLA 2AJUL 3T04D 1M3IA 5C0IB 5E8NA 4IM8A 3ESMA 4OIAA 4JQIA 4EI5D 3DUUA 5JQ6H 2BRRH 5K9JL 1AXTL 1I9JH 1WIUA 1Z9SB 3D3VE 3ZDYE 3B9KC 1SM3L 1BEYL 5DYOA 1SXNA 5JHAA 3WTSA 1QZ1A 3S5LB 3TOPA 3MV9D 3QO1B 1Z5HA 4YDIH 4XTRD 4YJZL 3V5DA 1DEEB 2PUQT 3VFTB 2W0FA 3V4VH 2HXAA 3NACH 4WEUD 2VDMH 1MIEH 1WJ3A 3SQOH 5IHZB 1WDAA 1C08B 3QBTB 5KG9B 4N2OA 4Y4HD 3LKQB 3T2OA 2IPUG 4BH7A 5I66B 4POZD 4HH8A 2OULB 3VXNB 3KWXA 2BZDA 4RGNE 4TL4A 3IJEA 2YD0A 3ZGHA 4M62L 1BQLH 2AJUH 2NY1B 1TIUA 3FT9A 1CF8H 2VSCA 3CFDA 3BVUA 4M7ZC 4JO4L 1MKFA 4ZBJA 5BQ7B 4R4ND 1ZA6B 4U7SA 4WTXA 4LU5H 2MFNA 4PWJA 5F0PB 3E1F1 3S37X 3BVWA 4Y5YB 1T89C 1KIUA 3X14B 4MX7B 4PJDE 4K2UL 2WQAA 5CJBA 3TTSA 3PWLA 4QYAA 3TTYA 1OARH 3JWDH 3ZTNH 1IE5A 1AZVA 4UOW0 4LSRH 3H7BA 3M45A 3KLLA 4YK4B 4IKJA 3VXUD 4ELKA 2W0KA 3QUXD 5AL0A 3LQZB 3QI9A 3NDZE 4IRJA 2EE0A 1IAIM 4Y4HA 5CAYB 1A0QL 4JQVC 4XO9A 1MVFA 1MUJB 1OPGL 3GUTB 3I75B 2H47C 4FNLL 1CF8L 4PWEA 3KPTA 2P24A 1XD1A 2CBTA 2H2SC 2GTWA 3WKQA 4BHUA 1IE4A 2X7LB 5KJ4A 4U0RC 5EFIB 1J5IA 4PJXE 4S2SB 3WAKA 4D2NA 5H94B 3S34L 1JPTL 3VXUE 1DQIA 3TBWB 5IBTH 5JHDE 4HS3B 1XR9A 2GI0A 3P2TA 5FUCE 3U46A 4HKXB 3P69A 4AT6B 3VH8A 3PABB 3MPCA 5DJ6A 3QFJD 1YPZA 4RGNC 4DTGL 5KS9B 3L6FA 2LFEA 3MQIA 3KPSA 5DGQA 1DQLH 1J5DA 1ACYH 2EYTB 1CG9B 4GW1B 4P4RB 2PF6A 1FG2A 2OJZH 2DQUL 4PY7A 4Y7OC 5I18H 1A4AA 2XJKA 2MRYA 1VFAA 3HA0A 2X9YA 2E6JA 1G0YR 1URIA 5IROC 1RJYA 2W1NA 3LH8A 4OQTL 3GNML 4QWWC 1N4XL 2FRGP 5BS0E 4APXB 4WO0A 3VA2C 1CFVL 3SOBH 3WDIA 3QORB 1QVOA 2O61B 4XNMA 4CC4C 4PW9A 5ACZA 2QELA 3HRZA 4NQDB 1Z9MA 4OZFG 2KH2B 4LL9A 4YLCA 2XN2A 3TYFA 1MHHA 3VD5A 1BZOA 1HSAA 3GJFK 5KOVC 1L9NA 4X7TA 1ZCRA 3U0PB 1U6AL 3V9EA 1EFQA 5C0FB 5TPWL 4FLHA 1H3VA 2A1WH 3ESPA 2Q7YB 1WBYA 1T7WA 3Q3GA 4R90L 1N19A 1XXFC 4K8RC 4Z7VE 4D94A 2C8NA 1JDDA 1MJ8H 4A38A 5EU7E 3KJ4B 1AH1A 3FFCA 3CFTA 4WNQA 3WMSA 5D2LB 3T0EE 1UWEL 1UD3A 4H1LA 2DY2A 4N0RA 1FBIH 2BXYA 1H5BA 3GBLA 3UDWC 5I75B 1CYXA 3RTQD 1OGAE 5INCB 1G1KA 2B4CC 5MHSE 5JW4M 3SBWC 1XGYL 2JF1A 1AIFA 3PWPA 4GXFA 1YNTF 1P4LA 1Q9WA 2P5PA 4K3JL 4I9WE 4PCSA 4HUCA 3QDGE 4N9GA 4D0BB 2NQCA 4GUQA 4N0FB 5CD5C 3DX9B 4QWWD 4ZUWA 1TJMA 3V8OA 2YEQA 3RFRA 4DERA 3I84A 5IROD 1J9SA 4FXGA 3QYNA 4O02H 3FOMA 1D9KC 1LK3H 4B7IA 1KJ2H 2VAAB 1TFHA 1JK8B 1IAII 4QRRE 2AANA 1SJVA 1CWVA 3IDIB 1MQ8A 4LCYA 5GRVL 5KSAA 1RZGB 4LAJH 3FRUB 4J6RH 1NAMB 3D9AH 2CBQA 4X9FA 2NNAA 3CFJA 4B27A 2HKHL 1NMBH 1QZNA 3B7TA 1XV8A 1KN4H 3P1VA 4APQC 3MREB 4IKNA 5FFOA 4KXCA 1PQZB 1TETH 2X4RB 2J2ZB 2WXKA 2X41A 1BQKA 3TM6A 4U3XA 1A6AA 1XF5B 3EYFB 4QRRA 1Y18A 2G3MA 3CHXA 2OYMA 1BBJA 1FC2D 2R4SH 1CLZH 2AJVH 1XCXA 4N2EA 1S7QA 4OVUA 5GJSL 3QORD 3T0EC 5HYJA 4OFQA 1WAAA 2X4PB 1QR4A 3IJSB 2FWLB 2NNXA 2OL3L 1U58A 1JWMA 1TZGL 2KLSA 5D5MA 1JZ8A 1ZSDA 2KBGA 2JK5A 1XMWA 1HOCB 2YPKA 1HXYA 1ZXQA 2XYBA 2ZYIA 4ODSH 1QFWH 4UDTB 3GXNA 4WSGA 5LXGH 5MEOB 2I26N 3TBVA 1MJUH 4LNRB 5CP7A 2ORBL 3B9KB 4QAMB 3OKNB 5F1OB 1J9RA 3W2DH 3WFHB 3ARXA 4NYLA 4U4IA 4LSTL 3G6JE 4GKSA 1RZGA 3LV3B 4XN8A 3I3DA 3EKCA 4AQAB 1RXLA 2Z35B 4YAQA 2CKBA 4EQ3A 3D18A 1NOLA 1XGRA 2WXQA 2EDHA 3AAZB 2F68X 2VH5H 2B39A 3P4OA 4UM9A 2Q6WB 5C8JB 1JHLL 3ZYIA 1JGDA 4NZTH 5I2IA 5EF3A 3CLEL 2VLRD 4L23A 3EJZD 3IXTB 3FTZA 2OYLA 4HVBA 2R1YA 2DF3A 1T5KA 2AI0L 4Z0BL 4D0BA 5DQ9B 3NJGA 4XZUA 5C07A 1K72A 4M93B 4WWOA 4WWPA 4Y4HC 4DVRL 1RK1A 3QI9C 1F3RB 2FH8A 4EKXA 1FL5B 1VB9A 4HUXA 3OKDA 3DO4A 5EIIA 4FQJL 5GRZA 2IANB 5I6LA 3QIBA 5BS0A 1MJJB 2CUMA 5FYLH 4RNRA 1NFKA 2XWZA 3GO1H 2L8AA 2PLTA 4PJ8D 1YPZE 1M9WA 4ODHH 2F58H 4ZO8A 5DVPA 1Y0LB 5C2UB 4Z7VB 3EG9A 2Y36H 1KXTA 4OTXH 3MLSH 3Q2VA 1GH7A 2VERA 1JHLH 1CVRA 4R4FH 3VFVA 3UBXA 3BD5A 1U8JB 4URTB 1YLBB 2V5MA 5JMRA 4ZMTA 5HJGA 4N2NA 3L95B 1T0PB 2G0LA 4BA0A 2ED9A 5JW4N 4V1DD 3U2SA 4PJEB 3WIIH 2QV4A 1HSBB 5IMLB 4F15B 3MCLH 3OB8A 3VG0H 4GINA 4KBPA 3OF6A 4PJXA 3VXMB 3GSOA 4JRFA 2NY3B 4K7FA 2COVD 1IBGH 2WBKA 4PP2A 3AMLA 2BS8A 4KV5E 3V4VL 4PFEA 3OWEA 2VC2H 1MNUH 2RALA 4E5XA 3RGVC 4MMXA 4NZUL 3KPNB 1PD1A 2J6EA 4ESKA 1R5WA 2KMWA 4LSSL 2YBRA 3I6KB 1X4ZA 2EILB 4GBXB 2VJ0A 2AV7B 1WG3A 4HK0A 4RFNB 1BQHB 2J12B 3IM1A 1HZHH 4I0KA 2C9PA 1MH5A 2Q3XA 4YHMH 5BRPA 5KVMC 1CBVL 1NGYA 5KS9A 3SBRA 2A9NL 4JN2A 2BY1A 2CDGA 4ZFQA 1XGQA 5KYUA 1IGCH 5DHDA 3UTSD 4Y19E 1R0AH 3NFSH 4TKWA 1XGYH 3FPYA 5J8OA 1PNDA 4LASH 1F02I 4XXWC 3IEAA 2FQGA 2EAEA 4JS7A 5DUBB 5BNXD 2HUHA 1F45A 2CA4A 2WTRB 5I8OL 5ADPL 5KVDE 1PY4A 4N26A 5HGAA 1I7RA 2VDKB 3VFNB 1JGEA 1X9QA 1FORL 4UQ3B 3D2UB 1S7TA 2TRYA 4M43H 4XP5L 3L5WB 3ULUD 5I1GL 1O7SA 2CHXA 5GGRA 2IEPA 1VGEL 2QMJA 4U6XA 3TA3D 3US1A 3BP7A 4UIMB 1PLGL 3JVFC 4BFOA 5KBNC 1R3KB 1JI2A 2FBRA 2YD1A 4W4OA 1AR1B 5HHME 4F24A 1VFMA 1WFOA 2ZONA 4N0CC 1MPAL 5L2KA 5SX5K 3UJTH 4PJFF 1WE5A