1SY2A

1.0 a crystal structure of d129a/l130a mutant of nitrophorin 4
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
184
structure length
184
Chain Sequence
ACTKNAIAQTGFNKDKYFNGDVWYVTDYLDLEPDDVPKRYCAALAAGTASGKLKEALYHYDPKTQDTFYDVSELQVESLGKYTANFKKVDKNGNVKVAVTAGNYYTFTVMYADDSSALIHTCLHKGNKAAGDLYAVLNRNKDAAAGDKVKSAVSAATLEFSKFISTKENNCAYDNDSLKSLLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of binding site loops in controlling nitric oxide release: structure and kinetics of mutant forms of nitrophorin 4
pubmed doi rcsb
molecule keywords Nitrophorin 4
molecule tags Transport protein
source organism Rhodnius prolixus
total genus 47
structure length 184
sequence length 184
ec nomenclature ec 1.7.6.1: Nitrite dismutase.
pdb deposition date 2004-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1sy2A00
3BU9A 3STNA 5LJCA 4ZH9A 3QKGA 2OVDA 5EPQA 5H9AA 1ZNLA 1KXOA 2RCTA 3P6EA 2QOSC 1YP6A 1S44A 5F1EA 5HZ5A 4ORXA 1DZPA 3FEPA 3JS1A 3C77X 1NP4A 2X46A 4IB7A 3RSWA 1KT7A 4AZPA 1B0OA 2HNXA 1LNMA 1OEJA 3DSZA 1LFOA 2CM4A 3APVA 5JR8A 1L6MA 3VG2A 5HCEC 2FR2A 1X8PA 1BLRA 2L67A 3APWA 4TKBA 1Z24A 2X45A 3WJBA 3NR3A 4HPCA 3FIQA 2E4JA 3BLGA 3FA9A 4AZQA 1GT4A 1OEKA 2AMMX 3FMZA 4M7MA 2A2UA 5L8NA 3UEWA 3HWGA 1CBQA 1IFBA 1TXLA 4AYHA 3TF6A 3VG5A 4TJZA 1FDQA 1X8NA 3OJYC 4IB9A 1ERXA 2AKQA 4YKMA 3WJGA 2FR3A 2WEXA 5LJDA 1I04A 2LKKA 4AZMA 4ODDA 2FT9A 4I9SA 3ZUIA 3WJFA 1LKEA 3ELXA 1LIBA 2YG2A 1XKIA 5BVSA 1I4UA 3CMPA 1RBPA 1SXUA 5HA1A 1ZNKA 4LKPA 1UREA 3L4RA 3APUA 1ZNGA 4EFGA 4Y0PA 1BRPA 1ICNA 5HCCC 4A1HA 5H9LA 4QGWA 3P6FA 3VG6A 3WJDA 1PMPA 4N7DA 3D97A 3STKA 1A57A 1HMRA 4OS0A 3EMMA 3KQ0A 3S26A 4ORWA 1FTPA 3C76X 5C0NA 1TW4A 1LICA 4NYRA 3G7XA 4UU3A 1H91A 1XCAA 2FRSA 1FENA 1EXSA 5LJKA 1G5WA 3WBGA 1LPJA 1GT1A 1OBPA 4YBPA 3EBWA 3CQNA 3NX1A 2RA6A 4DQ4A 1JZUA 1U0XA 2XSTA 4I3DA 4ALOA 4AZOA 3PECA 4R0BA 3CBSA 4WFVA 3TGCA 1JV4A 4NLJA 3FW4A 4YCEA 5D8JA 1EIIA 4MVKA 3TGBA 1RLBE 4IB8A 3NPOA 3I0AA 3MVFA 3VG3A 1TVQA 5HTEA 1JJJA 5H8TA 1GXAA 4TKHA 4IAWA 3CBCA 3VG4A 4YFQA 1KT5A 1IKJA 1G85A 2WQ9A 2AT8X 1EW3A 5L8OA 2OFRX 4OS3A 4I3CA 2GC9A 3WVMA 4XMGA 2AT6X 4QGXA 1FELA 3TGAA 1BEBA 3AKMA 4ORSA 1I06A 1YWCA 1BRQA 4YFPA 1A2DA 2G79A 1IIUA 2AT3X 4MVIA 2AT0X 2RD7C 3C78X 1JBHA 3FELA 4K19A 2CZTA 1KT3A 1OEEA 1NP1A 1QABE 4ARHA 1IW2A 2KTDA 1DF3A 4YDAA 2A13A 1ACDA 1VYGA 1LIEA 4YFRA 3HWEA 4Y0QA 1FEMA 3ZUOA 3P6DA 2QO5A 2MO5A 1JYDA 4EEJA 1BWYA 1P6PA 4RUUA 5K06A 5HZ9A 2A0AA 1X89A 3U03A 1E02A 3BS2A 3P6HA 1AQBA 4O9SA 2RQ0A 4ZHFA 4TKJA 2MJIA 2R74A 3NX2A 2R56A 5EDBA 3HK1A 4ORUA 3JSQA 1DZKA 4ORYA 3F9DA 5D48A 2Q39A 1GT3A 1OBUA 3FLLA 4TQ2A 3IFBA 4ZH6A 3BDRA 5H9NA 4RUNA 1QQSA 2OVAA 3APXA 2EU7X 5HAEA 5LKEA 2JU7A 1QG5A 4IAXA 1KT6A 1X71A 1KQXA 1ZNHA 1QFTA 5BVTA 3BY0A 4YMYA 2P8GA 5FAZA 4ORRA 2AH7X 5IO7A 4XMHA 1E06A 1YIVA 4I9RA 3EM0A 4ALBA 3I17A 3WJEA 1MX7A 1AVGI 1SXYA 2WWPA 5D47A 4EDEA 1X8QA 3KFIA 1BM5A 4ZHDA 3D96A 2DM5A 3UEXA 2QM9A 1O1VA 4ZHCA 5B27A 2CZUA 3FW5A 2IFBA 3B2JA 2CBSA 1LIFA 3GAQA 5F6ZA 4UU2A 3K3LA 4NNSA 1HN2A 4D6BA 3FEKA 1QY1A 1MDCA 5HCDC 4ZR2A 5CE4A 1GX9A 2OVEA 5D45A 4CK4A 1LIDA 1ZNEA 1S7DA 1O8VA 4IMNA 4AZRA 1A3YA 3HWDA 3U0DA 5LJGA 4A1YA 2L68A 5BVQA 3KFHA 1QFVA 1UZ2X 4MVLA 1GM6A 5LJEA 2WQAE 2HMBA 3ZQ3A 5IO6A 2Q4NA 1QY0A 1HMTA 1U17A 3PH5A 5HTDA 1EIOA 5KICA 3KFFA 2MM3A 3P6GA 1MUPA 1ADLA 2OZQA 2NNQA 2ACOA 1KZXA 2OFMX 2R73A 4IMOA 3Q6LA 4HPBA 2A2GA 2K23A 4WBKA 2FLJA 1KQWA 2Q2PA 4HFOA 4ZCBA 1ZRYA 3PPTA 5HA0A 5HZQA 1CBSA 1ERBA 1VYFA 1S2PA 2F73A 4GETA 4QAEA 3BSZE 3FENA 1SY0A 4XMFA 1PBOA 1BSYA 4QYPA 1B56A 2HYSA 2CBRA 2W2AA 3B2KA 3FA7A 4YH0A 5KHPA 1B4MA 5F58A 3FA6A 4DQ3A 2JU8A 4NNTA 4GKCA 1GT5A 2JOZA 4KIIA 2LB6A 1HBQA 4OS8A 2XKLA 1TOWA 3B2IA 1AB0A 3BRNA 4LZUA 2Q9SA 1IFCA 1B8EA 1R0UA 2G78A 2FS6A 4BOEA 3NADA 1N0SA 1SA8A 1E5PA 4XMCA 1EUOA 1DC9A 1IKEA 5L8IA 2JN3A 3CWKA 5LKFA 3UEUA 2QO4A 4OMXA 1DFVA 2HLVA 2WR6A 2WUTA 3PP6A 2PY1A 5DG4A 1U18A 4GH7A 4GNWA 5IO5A 5HBSA 3FA8A 3IA8A 2ALLX 1BJ7A 4D6AA 5HWZA 5D4AA 2QO6A 1JYJA 1YWBA 1SY1A 1MX8A 2WEWA 4NLIA 4Y0RA 3PEDA 4BQUA 1CBIA 5DPQA 4ZGUA 2HZRA 1QY2A 5F7GA 3T1DA 3BU1A 1KT4A 2O62A 4QGVA 2K62A 4GE1A 3EBKA 3KZAA 3VG7A 4Y0SA 1VPRA 5AQ6A 5EEEA 2GJ5A 4ZHHA 2LBAA 3FR5A 1EQDA 1GKAA 2KT4B 1D2UA 1KGLA 4XMEA 4BVMA 5F6BA 3NQ3A 1YP7A 4QZTA 1MVGA 1BSQA 1FE3A 1A18A 4WFUA 1T0VA 1CBRA 1EPAA 1DZMA 2NNEA 3UEVA 1YUPA 3F8AA 2NP1A 2LBVA 4ZHGA 1OBQA 2LFOA 3O19A 1BSOA 4GRJA 1GKAB 5B29A 2GTFX 5FFHA 4YGHA 1HMSA 3BX8A 2L5PA 3O22A 2NNDA 4NP1A 1OPBA 5EZ2A 4A60A 2RCQA 1X8OA 4HPAA 1ML7A 2WSJA 4EXZA 5EDCA 5HZ8A 3NQ9A 4YCHA 1GX8A 1KOIA 2FTBA 1QWDA 1GGLA 2A3FX 1CRBA 3CR6A 3HWFA 5LJHA 1G74A 4PSQA 4ZFXA 1HBPA 3PH6A 5EEDA 2ANSA 1YWDA 4QZUA 5H9KA 5LJBA 4AZNA 4TLJA 2G7BA 4HPDA 5KIDA 2ASNX 1TOUA 1JJXA 1EPBA 1SY2A 4YKOA 1G7NA 3FR2A 2POAA 2HZQA 1E00A 4QYNA 1KZWA 4GNYA 4M6SA 3B2LA 4YDBA 3WXQA 3CQRA 3D95A 2AL0X 2AT5X 3TZSA 4LKTA 2W2BA 2Q2MA 3AKNA 4IB6A 4XMDA 4I3BA 2FWVA 3SAOA 3NP1A 3P6CA 3KFGA 4NYQA 4N7CA 1I05A 3FR4A 1ICMA 1PM1X 3B2HA 4YGGA 1HQPA 3BX7A 3O2YA 3U9PC 3RZYA 4OMWA 1SXXA 2L9CA 4IBAA 5HZ6A 1T8VA 5FENA 1EALA 4YGZA 4ZJ0A 2CM9A 1PEEA 1ZNDA 1SXWA 4AW8A 1AELA 1CJ5A 1T68X 2JU3A 2FS7A 1X8UA 2ACPX 3MBTA 3STMX 2BLGA 1D3SA 2W2FA 3WJCA 4A8ZA 1DV9A 3ELZA 4ES7A 1YWAA 1DZJA 3EYCA 1O1UA 1ALBA 4YBUA 4LZVA 4TNNA 1OPAA 2N93A 3DTQA 1NGLA 1LF7A 1BBPA 1SY3A
chains in the Genus database with same CATH superfamily
2X56A 3BU9A 2QMIA 3STNA 5LJCA 4ZH9A 3QKGA 2QOMA 2OVDA 1JMXA 5EPQA 5H9AA 2RTIB 3ZW0A 2RTNB 3EW2A 1ZNLA 3ZWEA 2Y3EA 1KXOA 4BX6A 1SWCA 2RCTA 3P6EA 5AJCA 2QOSC 3WZOA 2IZHB 1YP6A 1S44A 2FGSA 5F1EA 2BC3A 1K3BA 5HZ5A 4ORXA 1DZPA 2QCBA 3FEPA 3JS1A 3VE1A 3C77X 1N7YA 1NP4A 2X46A 4IB7A 1FJ1E 3RSWA 4KC7A 1KT7A 4AZPA 1B0OA 2HNXA 1LNMA 2IZLB 3S60A 1OEJA 3DSZA 1LFOA 2CM4A 1VWMB 3APVA 5JR8A 1Y55X 4IABA 4O3YA 4U3QA 1L6MA 2GTLO 3VG2A 1SWGA 4GUZA 1E2TA 2C1QA 5HCEC 3ZW0B 2FR2A 4L3RA 1X8PA 4FGIB 5BYPA 1VWJB 1BLRA 2L67A 3APWA 4TKBA 5B11O 1NQMA 1Z24A 2X45A 3WJBA 1PBYA 3NR3A 4HPCA 3FIQA 2E4JA 3BLGA 3PDFA 3FA9A 4AZQA 1GT4A 1OEKA 2AMMX 1AVDA 3FMZA 2YMSA 2A2UA 3N91A 4M7MA 3NBXX 3UEWA 3HWGA 5L8NA 1CBQA 1IFBA 1TXLA 4AYHA 2VDFA 3TF6A 3VG5A 4TJZA 1FDQA 1X8NA 2WPUA 3OJYC 1KL3A 4IB9A 3D4RA 1ERXA 3ZW1A 2AKQA 4YKMA 3WJGA 2FR3A 2WEXA 5LJDA 2IZIA 4CPEA 3RDSA 2FKGA 1I04A 1SWSA 1VWRB 2LKKA 2X4MA 4GU8A 3D9WA 4O3WA 4AZMA 3JQOA 4ODDA 2FT9A 4I9SA 3ZUIA 3WJFA 1LKEA 2OY8A 3ELXA 2IZCB 4U8UM 1LIBA 2YG2A 1XKIA 5BVSA 2I5ZO 1I4UA 3CMPA 1RBPA 1SWHA 1SXUA 1VWFB 2MWHA 5HA1A 1ZNKA 4LKPA 1KL5A 1UREA 3L4RA 3VPJE 4I95A 3APUA 3ZW1B 3PK2A 1VWBB 2RTPB 4GDZA 1ZNGA 3T6LA 4Y0PA 4EFGA 2Y32A 1BRPA 1ICNA 5HCCC 4GZVA 4A1HA 5H9LA 2G5LA 4QGWA 3P6FA 3VG6A 2GH7A 3WJDA 1PMPA 4N7DA 3D97A 3STKA 3SZHA 1A57A 1HMRA 4OS0A 1HXZA 3EMMA 3KQ0A 1SWBA 1FTPA 4ORWA 3C76X 3S26A 4Z6JA 2FHLA 1PTSA 3LHNA 4GD9A 4MEEA 1SWTA 1TW4A 1LICA 4NYRA 3VHIA 1VWHB 3G7XA 3MM0A 2AVIA 4UU3A 4B55A 1H91A 1XCAA 1SMPI 1FENA 1VWGB 2FRSA 4PJ2A 1EXSA 4Z28A 4GK9A 3SLOA 5LJKA 2I5VO 5CSEA 1SWQA 4QQ1A 1G5WA 3WBGA 5AEOA 1LPJA 1SRGA 2LA7A 4FQBB 1GT1A 1UYOX 4CDDA 1OBPA 4YBPA 3EBWA 5C0NA 3CQNA 3NX1A 2RA6A 4DQ4A 1JZUA 4INNA 4O49A 1U0XA 3PQSA 2OY5O 2XSTA 3LV4A 4I3DA 4ALOA 4AZOA 1KFFA 4BQUA 3PECA 4R0BA 3CBSA 4WFVA 3TGCA 1JV4A 4QRLA 4NLJA 1LCWA 3FW4A 4YCEA 1NDJA 5D8JA 1EIIA 4MVKA 3TGBA 1RLBE 4IB8A 3NPOA 3I0AA 3MVFA 3VG3A 1TVQA 5HTEA 4EQAC 3FDCA 2FKJA 1JJJA 2IZGB 2RTEB 5H8TA 1GXAA 4TKHA 4IAWA 3CBCA 2X55A 3VG4A 4YFQA 3EW1A 4BBOA 1KT5A 2UYWA 4MIRA 1IKJA 1G85A 2WQ9A 2AT8X 3RDOA 5FQ6E 1EW3A 5L8OA 2GTLN 2OFRX 1AVEA 2FHNX 4I3CA 4OS3A 2GC9A 3WVMA 4XMGA 2AT6X 4QGXA 1FELA 4Y5DA 1STRB 4LQZA 1IJ8A 3TGAA 1SRFA 4IRWA 1BEBA 3AKMA 4ORSA 2RTRB 1I06A 4JHQA 1YWCA 1BRQA 4YFPA 3NQKA 1A2DA 1UYNX 2G79A 1IIUA 2AT3X 4MVIA 4ZGFA 2AT0X 2RD7C 3C78X 4CPFA 1WUBA 4OKAA 3FYFA 1LDQA 3FELA 3WYQA 4EKVA 1JBHA 4K19A 2CZTA 2OL8O 1KT3A 1OEEA 1NP1A 1QABE 3RWXA 4ARHA 4GJVA 1IW2A 4JGLA 1VWQB 2KTDA 1DF3A 1HY2A 3RY1A 4YDAA 1JQPA 4DCBA 1KL4A 2A13A 1ACDA 1SLEB 1VYGA 1LIEA 4YFRA 3HWEA 2VFCA 1VYOA 4Y0QA 1SRJA 2F09A 1FEMA 4WHIA 5B2AO 3ZUOA 3P6DA 2QO5A 1LUQA 3OE3A 2MO5A 2DJGA 1JYDA 4EEJA 3VHMA 1JMZA 1BWYA 1P6PA 1SWLA 4RUUA 5K06A 5HZ9A 2A0AA 1X89A 2RTBB 1E02A 3BS2A 3U03A 3P6HA 1AQBA 4O9SA 5CYBA 2RQ0A 4ZHFA 4TKJA 2IZFB 2MJIA 2R74A 2X8SA 2G8CO 3NX2A 2R56A 5EDBA 3HK1A 4ORUA 3JSQA 3VHHA 1DZKA 4ORYA 3F9DA 5D48A 2Q39A 1GT3A 1OBUA 2RTQB 1VWLB 3FLLA 3IFBA 4ZH6A 4TQ2A 3BDRA 5H9NA 1RXHA 5K67A 3PQUA 1QQSA 2OVAA 3APXA 4RUNA 5IXGA 2EU7X 2X34A 5HAEA 2RN4A 4CPIA 5LKEA 2JU7A 1QG5A 4IAXA 1KT6A 1X71A 1KQXA 1ZNHA 3AEHA 1QFTA 2CAMA 4KCAA 3BY0A 3SLJA 2P8GA 3CKGA 5BVTA 4U9CA 4ORRA 5FAZA 2AH7X 4YMYA 5IO7A 4XMHA 4CSBA 1E06A 1YIVA 3LTWA 3EM0A 4I9RA 3V8UA 4O4OA 4ALBA 4BX7B 1LCVA 2X32A 3I17A 3WJEA 1MX7A 4DNEA 1Y9LA 3OBLA 1W6FA 2A8GA 1AVGI 1SRHA 1SXYA 2WWPA 1HXLA 1VWOB 5D47A 4CV7A 4EDEA 3HOEA 1X8QA 3KFIA 1BM5A 4ZHDA 3D96A 1W4TA 2DM5A 3RDMA 3WYPA 3UEXA 4COTA 4JO6A 2QM9A 1O1VA 3SLTA 2GTLM 5B27A 2CZUA 2RTAA 3FW5A 4ZHCA 2IFBA 3B2JA 4I60A 2X8TA 1LIFA 2CBSA 2IZDB 3EC5A 3GAQA 5F6ZA 1SWKA 1SWOA 4UU2A 3K3LA 4NNSA 1HN2A 4O3XB 4D6BA 3FEKA 1QY1A 5IRWA 1MDCA 5HCDC 1Y0GA 3RDUA 3HPEA 2BHVA 4Z2OA 4ZR2A 4BX5B 5CE4A 1GX9A 2OVEA 2Z4IA 1LCZA 5D45A 4O4UA 1LDOA 4NV7A 4CK4A 1LIDA 2AF5A 2JW1A 4KT5A 3SZJA 1ZNEA 1S7DA 1O8VA 1SWJA 4IMNA 5B5GA 4NV8A 3WZNA 4AZRA 1A3YA 3HWDA 3U0DA 5LJGA 4A1YA 2L68A 5BVQA 2Y3FA 1QFVA 1UZ2X 3KFHA 1GM6A 4MVLA 2WQAE 5FQ7E 2HMBA 3ZQ3A 5LJEA 5IO6A 5B5FA 2Q4NA 1QY0A 1HMTA 1U17A 3PH5A 5CHKA 1RSUB 5HTDA 1EIOA 5KICA 3KFFA 2MM3A 3P6GA 1MUPA 1MOYA 1VWAB 1ADLA 2OZQA 2NNQA 2ACOA 1KZXA 2OFMX 2R73A 4BJ8A 1SWEA 3Q6LA 4HPBA 2A2GA 1VWPB 4IMOA 2K23A 4MISA 2X8FA 4WBKA 2FLJA 4GGTA 5B10O 1MM9A 1KQWA 2Q2PA 4HFOA 4O3ZA 4ZCBA 1ZRYA 3PPTA 5HA0A 5HZQA 3S5VA 1CBSA 3ZZVA 1ERBA 1VYFA 1S2PA 2F73A 4GETA 1NBXA 2VFBA 4QAEA 3BSZE 1JJUA 3FENA 3H3IA 1SWAA 1SY0A 1PBOA 4KC8A 4XMFA 5JD2A 4CDCA 1BSYA 4QYPA 4HWMA 1B56A 2HYSA 2CBRA 2W2AA 3B2KA 4U46A 3FA7A 2BSZA 1VWEB 4YH0A 5KHPA 5B3MO 1B4MA 1WBIA 5F58A 4MVEA 2OL7A 3FA6A 4DQ3A 2JU8A 4NNTA 1MEPA 1Y52X 4GKCA 1GT5A 2JOZA 1K24A 2LB6A 1HBQA 4KIIA 2XKLA 4O4SA 4OS8A 1SRIA 3RDXA 1SLFB 5F2BA 2ZAGA 1TOWA 3B2IA 2OVSA 1AB0A 3BRNA 4LZUA 2Q9SA 3WZPA 1MK5A 1IFCA 2DJFA 1B8EA 4OELA 1R0UA 2G78A 2FS6A 4BOEA 1DF8A 3MX7A 3NADA 1N0SA 1SA8A 1E5PA 2Z4HA 2RTCB 4XMCA 1EUOA 1DC9A 1IKEA 4FBVA 5L8IA 3X00A 2JN3A 3CWKA 5LKFA 3UEUA 2QO4A 4OMXA 4ON1A 1DFVA 2HLVA 2WR6A 1HQQA 2WUTA 3PP6A 2PY1A 3ZW2A 2RTKA 5DG4A 3SZIA 1U18A 4GH7A 4GNWA 3VE2A 1RXKA 2JGSA 5HBSA 5IO5A 3FA8A 3IA8A 2ALLX 1BJ7A 4D6AA 3T6FA 2RTJA 5D4AA 5HWZA 1JYJA 2QO6A 1YWBA 1SY1A 3RY2A 1MX8A 2WEWA 4NLIA 4Y0RA 3E3CA 3PEDA 4GDAA 1Y53X 1CBIA 5IRAA 5DPQA 5L3YA 4ML7B 3S5XA 2HZRA 4GGZA 4ZGUA 1QY2A 5F7GA 4Y59A 3T1DA 3BU1A 1JIWI 1SLDB 1KT4A 3RE5A 2O62A 5AJBA 4QGVA 2K62A 3P24A 4GE1A 3EBKA 4BX7A 3KZAA 4GGRA 4GJSA 3VG7A 4QNIA 4Y0SA 1VPRA 2BS6A 5EEEA 2GJ5A 2BS5A 3OD9A 4U8UO 5AQ6A 4ZHHA 2LBAA 3FR5A 1EQDA 3F6ZB 2MHDA 2OF9A 1GKAA 1NQNA 2KT4B 4CDFA 3MG5A 2RTFB 1D2UA 2KW1A 2ZSCA 1KGLA 1SWFA 4XMEA 1I78A 1VWCB 4BVMA 5F6BA 2OL6O 3NQ3A 4JNJA 4BX6B 3VGWA 3CKFA 1YP7A 4QZTA 1RXJA 1MVGA 1VWIB 1BSQA 2C1SA 1FE3A 2IZJA 1A18A 4WFUA 1T0VA 3GE2A 1CBRA 1EI5A 1EPAA 1DZMA 2NNEA 1N9YA 3UEVA 3ZI8A 1YUPA 3F8AA 2NP1A 2LBVA 3VU1A 4ZHGA 1SREA 1SWPA 4BX5A 1OBQA 1SWRA 1GX3A 2LFOA 3O19A 2OYBO 1BSOA 4GRJA 4CDEA 1GKAB 2JMBA 5B29A 4BGFA 2GTFX 1VWNB 2MF6A 1HMSA 4YGHA 5FFHA 4NW4A 3BX8A 2OFBA 2L5PA 3O22A 2NNDA 3HOLA 1OPBA 4NP1A 5EZ2A 4A60A 2RCQA 1X8OA 1SWDA 4HPAA 3T2WA 1ML7A 2WSJA 4EXZA 5EDCA 5HZ8A 3NQ9A 4YCHA 2RTOB 4OEMA 1GX8A 1KOIA 2FTBA 1I9HA 1QWDA 1GGLA 2A3FX 1CRBA 3CR6A 3HWFA 4L1NA 2A5BA 4O4XA 1G74A 5LJHA 4PSQA 4ZFXA 1HBPA 3WOVA 2RTDB 1SWUA 2ANSA 3PH6A 5EEDA 1YWDA 1VWDB 4QZUA 2KD2A 5H9KA 5LJBA 3T2XA 4AZNA 4TLJA 1N9MA 2G7BA 1RSTB 1VWKB 4HPDA 5KIDA 2RTGB 2ASNX 1TOUA 1SWNA 1JJXA 1EPBA 1SY2A 4YKOA 1G7NA 3FR2A 3P02A 2POAA 4YVBA 2HZQA 1E00A 4QYNA 2IZAA 4GNYA 2M4LA 1KZWA 4M6SA 5FQ8E 1NC9A 3RDQA 4Z2VA 1STSB 3B2LA 4YDBA 4KH8A 5K68A 3Q34A 3WXQA 3CQRA 2RTHB 3D95A 4C5PA 1Y9TA 2AL0X 2AT5X 4LKTA 2RTLA 3TZSA 2W2BA 2Q2MA 3AKNA 4IB6A 4XMDA 2IZKA 4I3BA 2FWVA 3RKGA 1STPA 3NP1A 3P6CA 3KFGA 3SAOA 3RBYA 2IZEB 4NYQA 2OF8A 4N7CA 1I05A 3FR4A 1ICMA 1PM1X 3B2HA 3UAQA 4YGGA 1HQPA 3BX7A 2KTSA 3O2YA 4I6SA 3U9PC 1RAVA 4FBOA 3RZYA 2HKDA 4OMWA 1SXXA 2L9CA 4IBAA 5IRUA 3WZQA 5HZ6A 1T8VA 5FENA 1EALA 2OY1O 4YGZA 4CPHA 4ZJ0A 2CM9A 1PEEA 1ZNDA 1SXWA 3FIDA 4AW8A 4FBRA 1AELA 1CJ5A 1T68X 3KVNA 2JU3A 4U8UN 2FS7A 1OSPO 1X8UA 2C4IA 2ACPX 3MBTA 1N4JA 1SLGB 2ZAIA 2RTMA 4Z2PA 4ID2A 3AUMO 4Z27A 3STMX 2BLGA 3HTYA 1D3SA 2PI3O 2W2FA 3WJCA 4A8ZA 1DV9A 3RE6A 2OY7A 2BT9A 2OFAA 3ELZA 4ES7A 1YWAA 4BCSA 1DZJA 3EYCA 1W5RA 2IZBA 1O1UA 1ALBA 4YBUA 2F01A 4LZVA 4TNNA 1N43A 3SOTA 2UZ2A 1OPAA 2N93A 1LELA 2A5CA 3DTQA 4CPHB 1NGLA 1LF7A 1BBPA 3QQ2A 1SY3A
chains in the Genus database with same CATH topology
3BU9A 3STNA 2QMIA 5LJCA 4ZH9A 3QKGA 2OVDA 5EPQA 5H9AA 3ZW0A 1ZNLA 3ZWEA 1KXOA 5AJCA 2RCTA 3P6EA 2QOSC 1YP6A 1S44A 5F1EA 5HZ5A 4ORXA 1DZPA 3FEPA 3JS1A 3VE1A 3C77X 1NP4A 2X46A 4IB7A 3RSWA 4KC7A 1KT7A 4AZPA 1B0OA 2HNXA 1LNMA 3S60A 1OEJA 3DSZA 1LFOA 2CM4A 3APVA 5JR8A 4IABA 4O3YA 4U3QA 1L6MA 2GTLO 3VG2A 3ZW0B 5HCEC 2FR2A 4L3RA 1X8PA 4FGIB 5BYPA 1BLRA 2L67A 3APWA 4TKBA 1Z24A 2X45A 3WJBA 3NR3A 4HPCA 3FIQA 2E4JA 3BLGA 3FA9A 4AZQA 1GT4A 1OEKA 2AMMX 3FMZA 4M7MA 2YMSA 2A2UA 3N91A 5L8NA 3NBXX 3UEWA 3HWGA 1CBQA 1IFBA 1TXLA 4AYHA 3TF6A 3VG5A 4TJZA 1FDQA 1X8NA 3OJYC 4IB9A 3D4RA 1ERXA 3ZW1A 2AKQA 4YKMA 3WJGA 2FR3A 2WEXA 5LJDA 1I04A 2LKKA 4GU8A 4O3WA 4AZMA 3JQOA 4ODDA 2FT9A 4I9SA 3ZUIA 3WJFA 1LKEA 3ELXA 4U8UM 1LIBA 2YG2A 1XKIA 5BVSA 1I4UA 3CMPA 1RBPA 1SXUA 2MWHA 5HA1A 1ZNKA 4LKPA 1UREA 3L4RA 3VPJE 4I95A 3APUA 3ZW1B 4GDZA 1ZNGA 4EFGA 4Y0PA 1BRPA 1ICNA 5HCCC 4GZVA 4A1HA 5H9LA 4QGWA 3P6FA 3VG6A 3WJDA 1PMPA 4N7DA 3D97A 3STKA 1A57A 1HMRA 4OS0A 3EMMA 3KQ0A 3S26A 4ORWA 1FTPA 3ZI8A 3C76X 5C0NA 3LHNA 1TW4A 1LICA 4NYRA 3G7XA 4UU3A 1H91A 1XCAA 1SMPI 1FENA 2FRSA 4PJ2A 1EXSA 4GK9A 5LJKA 4QQ1A 1G5WA 3WBGA 5AEOA 1LPJA 2LA7A 4FQBB 1GT1A 1OBPA 4YBPA 3EBWA 3CQNA 3NX1A 2RA6A 4DQ4A 1JZUA 4INNA 4O49A 1U0XA 3PQSA 2XSTA 3LV4A 4I3DA 4ALOA 4AZOA 3PECA 4R0BA 3CBSA 4WFVA 3TGCA 1JV4A 4QRLA 4NLJA 3FW4A 4YCEA 5D8JA 1EIIA 4MVKA 3TGBA 1RLBE 4IB8A 3NPOA 3I0AA 3MVFA 3VG3A 1TVQA 5HTEA 4EQAC 1JJJA 5H8TA 1GXAA 4TKHA 4IAWA 3CBCA 3VG4A 4YFQA 1KT5A 4MIRA 1IKJA 1G85A 2WQ9A 2AT8X 5FQ6E 1EW3A 5L8OA 2GTLN 2OFRX 4OS3A 4I3CA 2GC9A 3WVMA 4XMGA 2AT6X 4QGXA 1FELA 4LQZA 3TGAA 1BEBA 3AKMA 4ORSA 1I06A 1YWCA 1BRQA 4YFPA 3NQKA 1A2DA 2G79A 1IIUA 2AT3X 4MVIA 4ZGFA 2AT0X 2RD7C 3C78X 3FYFA 3FELA 1JBHA 4K19A 2CZTA 1KT3A 1OEEA 1NP1A 1QABE 3RWXA 4ARHA 1IW2A 4JGLA 2KTDA 1DF3A 4YDAA 2A13A 1ACDA 1VYGA 1LIEA 4YFRA 3HWEA 4Y0QA 2F09A 1FEMA 4WHIA 3ZUOA 3P6DA 2QO5A 3OE3A 2MO5A 1JYDA 4EEJA 1BWYA 1P6PA 4RUUA 5K06A 5HZ9A 2A0AA 1X89A 3U03A 1E02A 3BS2A 3P6HA 1AQBA 4O9SA 5CYBA 2RQ0A 4ZHFA 4TKJA 2MJIA 2R74A 2X8SA 3NX2A 2R56A 5EDBA 3HK1A 4ORUA 3JSQA 1DZKA 4ORYA 3F9DA 5D48A 2Q39A 1GT3A 1OBUA 3FLLA 4TQ2A 3IFBA 4ZH6A 3BDRA 5H9NA 3PQUA 1QQSA 2OVAA 3APXA 4RUNA 2EU7X 5HAEA 2RN4A 5LKEA 2JU7A 1QG5A 4IAXA 1KT6A 1X71A 1KQXA 1ZNHA 4KCAA 1QFTA 5BVTA 3BY0A 4YMYA 2P8GA 4U9CA 4ORRA 5FAZA 2AH7X 5IO7A 4XMHA 4CSBA 1E06A 1YIVA 4I9RA 3EM0A 3V8UA 4ALBA 4O4OA 3I17A 3WJEA 1MX7A 1Y9LA 3OBLA 1AVGI 1SXYA 2WWPA 4CV7A 5D47A 4EDEA 3HOEA 1X8QA 3KFIA 1BM5A 4ZHDA 3D96A 2DM5A 3UEXA 4COTA 2QM9A 1O1VA 4ZHCA 2GTLM 5B27A 2CZUA 3FW5A 2IFBA 3B2JA 2X8TA 2CBSA 1LIFA 3GAQA 5F6ZA 4UU2A 3K3LA 4NNSA 1HN2A 4O3XB 4D6BA 3FEKA 1QY1A 1MDCA 5HCDC 2BHVA 4ZR2A 5CE4A 1GX9A 2OVEA 2Z4IA 5D45A 4O4UA 4CK4A 1LIDA 4KT5A 2JW1A 1ZNEA 1S7DA 1O8VA 4IMNA 4AZRA 1A3YA 3HWDA 3U0DA 5LJGA 4A1YA 2L68A 5BVQA 3KFHA 1QFVA 1UZ2X 4MVLA 1GM6A 5FQ7E 2WQAE 5LJEA 2HMBA 3ZQ3A 5IO6A 2Q4NA 1QY0A 1HMTA 1U17A 3PH5A 5HTDA 1EIOA 5KICA 3KFFA 2MM3A 3P6GA 1MUPA 1ADLA 2OZQA 2NNQA 2ACOA 1KZXA 2OFMX 2R73A 4IMOA 3Q6LA 4HPBA 2A2GA 2K23A 4MISA 2X8FA 4WBKA 2FLJA 1KQWA 2Q2PA 4HFOA 4O3ZA 4ZCBA 1ZRYA 3PPTA 5HA0A 5HZQA 3S5VA 1CBSA 3ZZVA 1ERBA 1VYFA 1S2PA 2F73A 4GETA 4QAEA 3BSZE 3H3IA 3FENA 4KC8A 1SY0A 4XMFA 1PBOA 1BSYA 4QYPA 4HWMA 1B56A 2HYSA 2CBRA 2W2AA 3B2KA 3FA7A 4YH0A 5KHPA 1B4MA 5F58A 4MVEA 3FA6A 4DQ3A 2JU8A 4NNTA 4GKCA 1GT5A 2JOZA 4KIIA 2LB6A 1HBQA 4O4SA 2XKLA 4OS8A 2ZAGA 1TOWA 3B2IA 2OVSA 1AB0A 3BRNA 4LZUA 2Q9SA 1IFCA 1B8EA 1R0UA 2G78A 2FS6A 4BOEA 3MX7A 3NADA 1N0SA 1SA8A 1E5PA 2Z4HA 4XMCA 1EUOA 1DC9A 1IKEA 4FBVA 5L8IA 2JN3A 3CWKA 5LKFA 3UEUA 2QO4A 4OMXA 4ON1A 1DFVA 2HLVA 2WR6A 2WUTA 3PP6A 2PY1A 3ZW2A 5DG4A 1U18A 4GH7A 4GNWA 3VE2A 5HBSA 5IO5A 3FA8A 3IA8A 2ALLX 1BJ7A 4D6AA 5HWZA 5D4AA 1JYJA 2QO6A 1YWBA 1SY1A 1MX8A 2WEWA 4NLIA 4Y0RA 3E3CA 3PEDA 4BQUA 1CBIA 5DPQA 4ML7B 3S5XA 2HZRA 4ZGUA 1QY2A 5F7GA 3T1DA 3BU1A 1JIWI 1KT4A 2O62A 5AJBA 4QGVA 2K62A 3P24A 4GE1A 3EBKA 3KZAA 3VG7A 4QNIA 4Y0SA 1VPRA 2BS6A 5EEEA 2GJ5A 2BS5A 3OD9A 4U8UO 5AQ6A 4ZHHA 2LBAA 3FR5A 1EQDA 3F6ZB 2MHDA 1GKAA 2KT4B 1D2UA 2KW1A 1KGLA 4XMEA 4BVMA 5F6BA 3NQ3A 1YP7A 4QZTA 1MVGA 1BSQA 1FE3A 1A18A 4WFUA 1T0VA 3GE2A 1CBRA 1EI5A 1EPAA 1DZMA 2NNEA 3UEVA 1YUPA 3F8AA 2NP1A 2LBVA 3VU1A 4ZHGA 1OBQA 2LFOA 3O19A 1BSOA 4GRJA 1GKAB 2JMBA 5B29A 2GTFX 5FFHA 4YGHA 1HMSA 4NW4A 3BX8A 2L5PA 3O22A 2NNDA 3HOLA 1OPBA 4NP1A 5EZ2A 4A60A 2RCQA 1X8OA 4HPAA 1ML7A 2WSJA 4EXZA 5EDCA 5HZ8A 3NQ9A 4YCHA 1GX8A 1KOIA 2FTBA 1QWDA 1GGLA 2A3FX 1CRBA 3CR6A 3HWFA 4L1NA 4O4XA 5LJHA 1G74A 4PSQA 4ZFXA 1HBPA 3WOVA 3PH6A 5EEDA 2ANSA 1YWDA 4QZUA 2KD2A 5H9KA 5LJBA 4AZNA 4TLJA 2G7BA 4HPDA 5KIDA 2ASNX 1TOUA 1JJXA 1EPBA 1SY2A 4YKOA 1G7NA 3FR2A 3P02A 2POAA 2HZQA 1E00A 4QYNA 1KZWA 4GNYA 2M4LA 4M6SA 5FQ8E 3B2LA 4YDBA 4KH8A 3WXQA 3CQRA 3D95A 1Y9TA 2AL0X 2AT5X 4LKTA 3TZSA 2W2BA 2Q2MA 3AKNA 4IB6A 4XMDA 4I3BA 2FWVA 3RKGA 3NP1A 3P6CA 3SAOA 3KFGA 3RBYA 4NYQA 4N7CA 1I05A 3FR4A 1ICMA 1PM1X 3B2HA 3UAQA 4YGGA 1HQPA 3BX7A 2KTSA 3O2YA 4I6SA 3U9PC 4FBOA 3RZYA 4OMWA 1SXXA 2L9CA 4IBAA 5HZ6A 1T8VA 5FENA 1EALA 4YGZA 4ZJ0A 2CM9A 1PEEA 1ZNDA 1SXWA 4AW8A 4FBRA 1AELA 1CJ5A 1T68X 2JU3A 4U8UN 2FS7A 1X8UA 2ACPX 3MBTA 2ZAIA 4ID2A 3STMX 2BLGA 3HTYA 1D3SA 2W2FA 3WJCA 4A8ZA 1DV9A 2BT9A 3ELZA 4ES7A 1YWAA 1DZJA 3EYCA 1O1UA 1ALBA 4YBUA 4LZVA 4TNNA 3SOTA 1OPAA 2N93A 3DTQA 1NGLA 1LF7A 1BBPA 1SY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BU9 A;  3STN A;  5LJC A;  4ZH9 A;  3QKG A;  2OVD A;  5EPQ A;  5H9A A;  1ZNL A;  1KXO A;  2RCT A;  3P6E A;  2QOS C;  1YP6 A;  1S44 A;  5F1E A;  5HZ5 A;  4ORX A;  1DZP A;  3FEP A;  3JS1 A;  3C77 X;  1NP4 A;  2X46 A;  4IB7 A;  3RSW A;  1KT7 A;  4AZP A;  1B0O A;  2HNX A;  1LNM A;  1OEJ A;  3DSZ A;  1LFO A;  2CM4 A;  3APV A;  5JR8 A;  1L6M A;  3VG2 A;  5HCE C;  2FR2 A;  1X8P A;  1BLR A;  2L67 A;  3APW A;  4TKB A;  1Z24 A;  2X45 A;  3WJB A;  3NR3 A;  4HPC A;  3FIQ A;  2E4J A;  3BLG A;  3FA9 A;  4AZQ A;  1GT4 A;  1OEK A;  2AMM X;  3FMZ A;  4M7M A;  2A2U A;  5L8N A;  3UEW A;  3HWG A;  1CBQ A;  1IFB A;  1TXL A;  4AYH A;  3TF6 A;  3VG5 A;  4TJZ A;  1FDQ A;  1X8N A;  3OJY C;  4IB9 A;  1ERX A;  2AKQ A;  4YKM A;  3WJG A;  2FR3 A;  2WEX A;  5LJD A;  1I04 A;  2LKK A;  4AZM A;  4ODD A;  2FT9 A;  4I9S A;  3ZUI A;  3WJF A;  1LKE A;  3ELX A;  1LIB A;  2YG2 A;  1XKI A;  5BVS A;  1I4U A;  3CMP A;  1RBP A;  1SXU A;  5HA1 A;  1ZNK A;  4LKP A;  1URE A;  3L4R A;  3APU A;  1ZNG A;  4EFG A;  4Y0P A;  1BRP A;  1ICN A;  5HCC C;  4A1H A;  5H9L A;  4QGW A;  3P6F A;  3VG6 A;  3WJD A;  1PMP A;  4N7D A;  3D97 A;  3STK A;  1A57 A;  1HMR A;  4OS0 A;  3EMM A;  3KQ0 A;  3S26 A;  4ORW A;  1FTP A;  3C76 X;  5C0N A;  1TW4 A;  1LIC A;  4NYR A;  3G7X A;  4UU3 A;  1H91 A;  1XCA A;  2FRS A;  1FEN A;  1EXS A;  5LJK A;  1G5W A;  3WBG A;  1LPJ A;  1GT1 A;  1OBP A;  4YBP A;  3EBW A;  3CQN A;  3NX1 A;  2RA6 A;  4DQ4 A;  1JZU A;  1U0X A;  2XST A;  4I3D A;  4ALO A;  4AZO A;  3PEC A;  4R0B A;  3CBS A;  4WFV A;  3TGC A;  1JV4 A;  4NLJ A;  3FW4 A;  4YCE A;  5D8J A;  1EII A;  4MVK A;  3TGB A;  1RLB E;  4IB8 A;  3NPO A;  3I0A A;  3MVF A;  3VG3 A;  1TVQ A;  5HTE A;  1JJJ A;  5H8T A;  1GXA A;  4TKH A;  4IAW A;  3CBC A;  3VG4 A;  4YFQ A;  1KT5 A;  1IKJ A;  1G85 A;  2WQ9 A;  2AT8 X;  1EW3 A;  5L8O A;  2OFR X;  4OS3 A;  4I3C A;  2GC9 A;  3WVM A;  4XMG A;  2AT6 X;  4QGX A;  1FEL A;  3TGA A;  1BEB A;  3AKM A;  4ORS A;  1I06 A;  1YWC A;  1BRQ A;  4YFP A;  1A2D A;  2G79 A;  1IIU A;  2AT3 X;  4MVI A;  2AT0 X;  2RD7 C;  3C78 X;  1JBH A;  3FEL A;  4K19 A;  2CZT A;  1KT3 A;  1OEE A;  1NP1 A;  1QAB E;  4ARH A;  1IW2 A;  2KTD A;  1DF3 A;  4YDA A;  2A13 A;  1ACD A;  1VYG A;  1LIE A;  4YFR A;  3HWE A;  4Y0Q A;  1FEM A;  3ZUO A;  3P6D A;  2QO5 A;  2MO5 A;  1JYD A;  4EEJ A;  1BWY A;  1P6P A;  4RUU A;  5K06 A;  5HZ9 A;  2A0A A;  1X89 A;  3U03 A;  1E02 A;  3BS2 A;  3P6H A;  1AQB A;  4O9S A;  2RQ0 A;  4ZHF A;  4TKJ A;  2MJI A;  2R74 A;  3NX2 A;  2R56 A;  5EDB A;  3HK1 A;  4ORU A;  3JSQ A;  1DZK A;  4ORY A;  3F9D A;  5D48 A;  2Q39 A;  1GT3 A;  1OBU A;  3FLL A;  4TQ2 A;  3IFB A;  4ZH6 A;  3BDR A;  5H9N A;  4RUN A;  1QQS A;  2OVA A;  3APX A;  2EU7 X;  5HAE A;  5LKE A;  2JU7 A;  1QG5 A;  4IAX A;  1KT6 A;  1X71 A;  1KQX A;  1ZNH A;  1QFT A;  5BVT A;  3BY0 A;  4YMY A;  2P8G A;  5FAZ A;  4ORR A;  2AH7 X;  5IO7 A;  4XMH A;  1E06 A;  1YIV A;  4I9R A;  3EM0 A;  4ALB A;  3I17 A;  3WJE A;  1MX7 A;  1AVG I;  1SXY A;  2WWP A;  5D47 A;  4EDE A;  1X8Q A;  3KFI A;  1BM5 A;  4ZHD A;  3D96 A;  2DM5 A;  3UEX A;  2QM9 A;  1O1V A;  4ZHC A;  5B27 A;  2CZU A;  3FW5 A;  2IFB A;  3B2J A;  2CBS A;  1LIF A;  3GAQ A;  5F6Z A;  4UU2 A;  3K3L A;  4NNS A;  1HN2 A;  4D6B A;  3FEK A;  1QY1 A;  1MDC A;  5HCD C;  4ZR2 A;  5CE4 A;  1GX9 A;  2OVE A;  5D45 A;  4CK4 A;  1LID A;  1ZNE A;  1S7D A;  1O8V A;  4IMN A;  4AZR A;  1A3Y A;  3HWD A;  3U0D A;  5LJG A;  4A1Y A;  2L68 A;  5BVQ A;  3KFH A;  1QFV A;  1UZ2 X;  4MVL A;  1GM6 A;  5LJE A;  2WQA E;  2HMB A;  3ZQ3 A;  5IO6 A;  2Q4N A;  1QY0 A;  1HMT A;  1U17 A;  3PH5 A;  5HTD A;  1EIO A;  5KIC A;  3KFF A;  2MM3 A;  3P6G A;  1MUP A;  1ADL A;  2OZQ A;  2NNQ A;  2ACO A;  1KZX A;  2OFM X;  2R73 A;  4IMO A;  3Q6L A;  4HPB A;  2A2G A;  2K23 A;  4WBK A;  2FLJ A;  1KQW A;  2Q2P A;  4HFO A;  4ZCB A;  1ZRY A;  3PPT A;  5HA0 A;  5HZQ A;  1CBS A;  1ERB A;  1VYF A;  1S2P A;  2F73 A;  4GET A;  4QAE A;  3BSZ E;  3FEN A;  1SY0 A;  4XMF A;  1PBO A;  1BSY A;  4QYP A;  1B56 A;  2HYS A;  2CBR A;  2W2A A;  3B2K A;  3FA7 A;  4YH0 A;  5KHP A;  1B4M A;  5F58 A;  3FA6 A;  4DQ3 A;  2JU8 A;  4NNT A;  4GKC A;  1GT5 A;  2JOZ A;  4KII A;  2LB6 A;  1HBQ A;  4OS8 A;  2XKL A;  1TOW A;  3B2I A;  1AB0 A;  3BRN A;  4LZU A;  2Q9S A;  1IFC A;  1B8E A;  1R0U A;  2G78 A;  2FS6 A;  4BOE A;  3NAD A;  1N0S A;  1SA8 A;  1E5P A;  4XMC A;  1EUO A;  1DC9 A;  1IKE A;  5L8I A;  2JN3 A;  3CWK A;  5LKF A;  3UEU A;  2QO4 A;  4OMX A;  1DFV A;  2HLV A;  2WR6 A;  2WUT A;  3PP6 A;  2PY1 A;  5DG4 A;  1U18 A;  4GH7 A;  4GNW A;  5IO5 A;  5HBS A;  3FA8 A;  3IA8 A;  2ALL X;  1BJ7 A;  4D6A A;  5HWZ A;  5D4A A;  2QO6 A;  1JYJ A;  1YWB A;  1SY1 A;  1MX8 A;  2WEW A;  4NLI A;  4Y0R A;  3PED A;  4BQU A;  1CBI A;  5DPQ A;  4ZGU A;  2HZR A;  1QY2 A;  5F7G A;  3T1D A;  3BU1 A;  1KT4 A;  2O62 A;  4QGV A;  2K62 A;  4GE1 A;  3EBK A;  3KZA A;  3VG7 A;  4Y0S A;  1VPR A;  5AQ6 A;  5EEE A;  2GJ5 A;  4ZHH A;  2LBA A;  3FR5 A;  1EQD A;  1GKA A;  2KT4 B;  1D2U A;  1KGL A;  4XME A;  4BVM A;  5F6B A;  3NQ3 A;  1YP7 A;  4QZT A;  1MVG A;  1BSQ A;  1FE3 A;  1A18 A;  4WFU A;  1T0V A;  1CBR A;  1EPA A;  1DZM A;  2NNE A;  3UEV A;  1YUP A;  3F8A A;  2NP1 A;  2LBV A;  4ZHG A;  1OBQ A;  2LFO A;  3O19 A;  1BSO A;  4GRJ A;  1GKA B;  5B29 A;  2GTF X;  5FFH A;  4YGH A;  1HMS A;  3BX8 A;  2L5P A;  3O22 A;  2NND A;  4NP1 A;  1OPB A;  5EZ2 A;  4A60 A;  2RCQ A;  1X8O A;  4HPA A;  1ML7 A;  2WSJ A;  4EXZ A;  5EDC A;  5HZ8 A;  3NQ9 A;  4YCH A;  1GX8 A;  1KOI A;  2FTB A;  1QWD A;  1GGL A;  2A3F X;  1CRB A;  3CR6 A;  3HWF A;  5LJH A;  1G74 A;  4PSQ A;  4ZFX A;  1HBP A;  3PH6 A;  5EED A;  2ANS A;  1YWD A;  4QZU A;  5H9K A;  5LJB A;  4AZN A;  4TLJ A;  2G7B A;  4HPD A;  5KID A;  2ASN X;  1TOU A;  1JJX A;  1EPB A;  1SY2 A;  4YKO A;  1G7N A;  3FR2 A;  2POA A;  2HZQ A;  1E00 A;  4QYN A;  1KZW A;  4GNY A;  4M6S A;  3B2L A;  4YDB A;  3WXQ A;  3CQR A;  3D95 A;  2AL0 X;  2AT5 X;  3TZS A;  4LKT A;  2W2B A;  2Q2M A;  3AKN A;  4IB6 A;  4XMD A;  4I3B A;  2FWV A;  3SAO A;  3NP1 A;  3P6C A;  3KFG A;  4NYQ A;  4N7C A;  1I05 A;  3FR4 A;  1ICM A;  1PM1 X;  3B2H A;  4YGG A;  1HQP A;  3BX7 A;  3O2Y A;  3U9P C;  3RZY A;  4OMW A;  1SXX A;  2L9C A;  4IBA A;  5HZ6 A;  1T8V A;  5FEN A;  1EAL A;  4YGZ A;  4ZJ0 A;  2CM9 A;  1PEE A;  1ZND A;  1SXW A;  4AW8 A;  1AEL A;  1CJ5 A;  1T68 X;  2JU3 A;  2FS7 A;  1X8U A;  2ACP X;  3MBT A;  3STM X;  2BLG A;  1D3S A;  2W2F A;  3WJC A;  4A8Z A;  1DV9 A;  3ELZ A;  4ES7 A;  1YWA A;  1DZJ A;  3EYC A;  1O1U A;  1ALB A;  4YBU A;  4LZV A;  4TNN A;  1OPA A;  2N93 A;  3DTQ A;  1NGL A;  1LF7 A;  1BBP A;  1SY3 A; 
#chains in the Genus database with same CATH topology
 2X56 A;  3BU9 A;  2QMI A;  3STN A;  5LJC A;  4ZH9 A;  3QKG A;  2QOM A;  2OVD A;  1JMX A;  5EPQ A;  5H9A A;  2RTI B;  3ZW0 A;  2RTN B;  3EW2 A;  1ZNL A;  3ZWE A;  2Y3E A;  1KXO A;  4BX6 A;  1SWC A;  2RCT A;  3P6E A;  5AJC A;  2QOS C;  3WZO A;  2IZH B;  1YP6 A;  1S44 A;  2FGS A;  5F1E A;  2BC3 A;  1K3B A;  5HZ5 A;  4ORX A;  1DZP A;  2QCB A;  3FEP A;  3JS1 A;  3VE1 A;  3C77 X;  1N7Y A;  1NP4 A;  2X46 A;  4IB7 A;  1FJ1 E;  3RSW A;  4KC7 A;  1KT7 A;  4AZP A;  1B0O A;  2HNX A;  1LNM A;  2IZL B;  3S60 A;  1OEJ A;  3DSZ A;  1LFO A;  2CM4 A;  1VWM B;  3APV A;  5JR8 A;  1Y55 X;  4IAB A;  4O3Y A;  4U3Q A;  1L6M A;  2GTL O;  3VG2 A;  1SWG A;  4GUZ A;  1E2T A;  2C1Q A;  5HCE C;  3ZW0 B;  2FR2 A;  4L3R A;  1X8P A;  4FGI B;  5BYP A;  1VWJ B;  1BLR A;  2L67 A;  3APW A;  4TKB A;  5B11 O;  1NQM A;  1Z24 A;  2X45 A;  3WJB A;  1PBY A;  3NR3 A;  4HPC A;  3FIQ A;  2E4J A;  3BLG A;  3PDF A;  3FA9 A;  4AZQ A;  1GT4 A;  1OEK A;  2AMM X;  1AVD A;  3FMZ A;  2YMS A;  2A2U A;  3N91 A;  4M7M A;  3NBX X;  3UEW A;  3HWG A;  5L8N A;  1CBQ A;  1IFB A;  1TXL A;  4AYH A;  2VDF A;  3TF6 A;  3VG5 A;  4TJZ A;  1FDQ A;  1X8N A;  2WPU A;  3OJY C;  1KL3 A;  4IB9 A;  3D4R A;  1ERX A;  3ZW1 A;  2AKQ A;  4YKM A;  3WJG A;  2FR3 A;  2WEX A;  5LJD A;  2IZI A;  4CPE A;  3RDS A;  2FKG A;  1I04 A;  1SWS A;  1VWR B;  2LKK A;  2X4M A;  4GU8 A;  3D9W A;  4O3W A;  4AZM A;  3JQO A;  4ODD A;  2FT9 A;  4I9S A;  3ZUI A;  3WJF A;  1LKE A;  2OY8 A;  3ELX A;  2IZC B;  4U8U M;  1LIB A;  2YG2 A;  1XKI A;  5BVS A;  2I5Z O;  1I4U A;  3CMP A;  1RBP A;  1SWH A;  1SXU A;  1VWF B;  2MWH A;  5HA1 A;  1ZNK A;  4LKP A;  1KL5 A;  1URE A;  3L4R A;  3VPJ E;  4I95 A;  3APU A;  3ZW1 B;  3PK2 A;  1VWB B;  2RTP B;  4GDZ A;  1ZNG A;  3T6L A;  4Y0P A;  4EFG A;  2Y32 A;  1BRP A;  1ICN A;  5HCC C;  4GZV A;  4A1H A;  5H9L A;  2G5L A;  4QGW A;  3P6F A;  3VG6 A;  2GH7 A;  3WJD A;  1PMP A;  4N7D A;  3D97 A;  3STK A;  3SZH A;  1A57 A;  1HMR A;  4OS0 A;  1HXZ A;  3EMM A;  3KQ0 A;  1SWB A;  1FTP A;  4ORW A;  3C76 X;  3S26 A;  4Z6J A;  2FHL A;  1PTS A;  3LHN A;  4GD9 A;  4MEE A;  1SWT A;  1TW4 A;  1LIC A;  4NYR A;  3VHI A;  1VWH B;  3G7X A;  3MM0 A;  2AVI A;  4UU3 A;  4B55 A;  1H91 A;  1XCA A;  1SMP I;  1FEN A;  1VWG B;  2FRS A;  4PJ2 A;  1EXS A;  4Z28 A;  4GK9 A;  3SLO A;  5LJK A;  2I5V O;  5CSE A;  1SWQ A;  4QQ1 A;  1G5W A;  3WBG A;  5AEO A;  1LPJ A;  1SRG A;  2LA7 A;  4FQB B;  1GT1 A;  1UYO X;  4CDD A;  1OBP A;  4YBP A;  3EBW A;  5C0N A;  3CQN A;  3NX1 A;  2RA6 A;  4DQ4 A;  1JZU A;  4INN A;  4O49 A;  1U0X A;  3PQS A;  2OY5 O;  2XST A;  3LV4 A;  4I3D A;  4ALO A;  4AZO A;  1KFF A;  4BQU A;  3PEC A;  4R0B A;  3CBS A;  4WFV A;  3TGC A;  1JV4 A;  4QRL A;  4NLJ A;  1LCW A;  3FW4 A;  4YCE A;  1NDJ A;  5D8J A;  1EII A;  4MVK A;  3TGB A;  1RLB E;  4IB8 A;  3NPO A;  3I0A A;  3MVF A;  3VG3 A;  1TVQ A;  5HTE A;  4EQA C;  3FDC A;  2FKJ A;  1JJJ A;  2IZG B;  2RTE B;  5H8T A;  1GXA A;  4TKH A;  4IAW A;  3CBC A;  2X55 A;  3VG4 A;  4YFQ A;  3EW1 A;  4BBO A;  1KT5 A;  2UYW A;  4MIR A;  1IKJ A;  1G85 A;  2WQ9 A;  2AT8 X;  3RDO A;  5FQ6 E;  1EW3 A;  5L8O A;  2GTL N;  2OFR X;  1AVE A;  2FHN X;  4I3C A;  4OS3 A;  2GC9 A;  3WVM A;  4XMG A;  2AT6 X;  4QGX A;  1FEL A;  4Y5D A;  1STR B;  4LQZ A;  1IJ8 A;  3TGA A;  1SRF A;  4IRW A;  1BEB A;  3AKM A;  4ORS A;  2RTR B;  1I06 A;  4JHQ A;  1YWC A;  1BRQ A;  4YFP A;  3NQK A;  1A2D A;  1UYN X;  2G79 A;  1IIU A;  2AT3 X;  4MVI A;  4ZGF A;  2AT0 X;  2RD7 C;  3C78 X;  4CPF A;  1WUB A;  4OKA A;  3FYF A;  1LDQ A;  3FEL A;  3WYQ A;  4EKV A;  1JBH A;  4K19 A;  2CZT A;  2OL8 O;  1KT3 A;  1OEE A;  1NP1 A;  1QAB E;  3RWX A;  4ARH A;  4GJV A;  1IW2 A;  4JGL A;  1VWQ B;  2KTD A;  1DF3 A;  1HY2 A;  3RY1 A;  4YDA A;  1JQP A;  4DCB A;  1KL4 A;  2A13 A;  1ACD A;  1SLE B;  1VYG A;  1LIE A;  4YFR A;  3HWE A;  2VFC A;  1VYO A;  4Y0Q A;  1SRJ A;  2F09 A;  1FEM A;  4WHI A;  5B2A O;  3ZUO A;  3P6D A;  2QO5 A;  1LUQ A;  3OE3 A;  2MO5 A;  2DJG A;  1JYD A;  4EEJ A;  3VHM A;  1JMZ A;  1BWY A;  1P6P A;  1SWL A;  4RUU A;  5K06 A;  5HZ9 A;  2A0A A;  1X89 A;  2RTB B;  1E02 A;  3BS2 A;  3U03 A;  3P6H A;  1AQB A;  4O9S A;  5CYB A;  2RQ0 A;  4ZHF A;  4TKJ A;  2IZF B;  2MJI A;  2R74 A;  2X8S A;  2G8C O;  3NX2 A;  2R56 A;  5EDB A;  3HK1 A;  4ORU A;  3JSQ A;  3VHH A;  1DZK A;  4ORY A;  3F9D A;  5D48 A;  2Q39 A;  1GT3 A;  1OBU A;  2RTQ B;  1VWL B;  3FLL A;  3IFB A;  4ZH6 A;  4TQ2 A;  3BDR A;  5H9N A;  1RXH A;  5K67 A;  3PQU A;  1QQS A;  2OVA A;  3APX A;  4RUN A;  5IXG A;  2EU7 X;  2X34 A;  5HAE A;  2RN4 A;  4CPI A;  5LKE A;  2JU7 A;  1QG5 A;  4IAX A;  1KT6 A;  1X71 A;  1KQX A;  1ZNH A;  3AEH A;  1QFT A;  2CAM A;  4KCA A;  3BY0 A;  3SLJ A;  2P8G A;  3CKG A;  5BVT A;  4U9C A;  4ORR A;  5FAZ A;  2AH7 X;  4YMY A;  5IO7 A;  4XMH A;  4CSB A;  1E06 A;  1YIV A;  3LTW A;  3EM0 A;  4I9R A;  3V8U A;  4O4O A;  4ALB A;  4BX7 B;  1LCV A;  2X32 A;  3I17 A;  3WJE A;  1MX7 A;  4DNE A;  1Y9L A;  3OBL A;  1W6F A;  2A8G A;  1AVG I;  1SRH A;  1SXY A;  2WWP A;  1HXL A;  1VWO B;  5D47 A;  4CV7 A;  4EDE A;  3HOE A;  1X8Q A;  3KFI A;  1BM5 A;  4ZHD A;  3D96 A;  1W4T A;  2DM5 A;  3RDM A;  3WYP A;  3UEX A;  4COT A;  4JO6 A;  2QM9 A;  1O1V A;  3SLT A;  2GTL M;  5B27 A;  2CZU A;  2RTA A;  3FW5 A;  4ZHC A;  2IFB A;  3B2J A;  4I60 A;  2X8T A;  1LIF A;  2CBS A;  2IZD B;  3EC5 A;  3GAQ A;  5F6Z A;  1SWK A;  1SWO A;  4UU2 A;  3K3L A;  4NNS A;  1HN2 A;  4O3X B;  4D6B A;  3FEK A;  1QY1 A;  5IRW A;  1MDC A;  5HCD C;  1Y0G A;  3RDU A;  3HPE A;  2BHV A;  4Z2O A;  4ZR2 A;  4BX5 B;  5CE4 A;  1GX9 A;  2OVE A;  2Z4I A;  1LCZ A;  5D45 A;  4O4U A;  1LDO A;  4NV7 A;  4CK4 A;  1LID A;  2AF5 A;  2JW1 A;  4KT5 A;  3SZJ A;  1ZNE A;  1S7D A;  1O8V A;  1SWJ A;  4IMN A;  5B5G A;  4NV8 A;  3WZN A;  4AZR A;  1A3Y A;  3HWD A;  3U0D A;  5LJG A;  4A1Y A;  2L68 A;  5BVQ A;  2Y3F A;  1QFV A;  1UZ2 X;  3KFH A;  1GM6 A;  4MVL A;  2WQA E;  5FQ7 E;  2HMB A;  3ZQ3 A;  5LJE A;  5IO6 A;  5B5F A;  2Q4N A;  1QY0 A;  1HMT A;  1U17 A;  3PH5 A;  5CHK A;  1RSU B;  5HTD A;  1EIO A;  5KIC A;  3KFF A;  2MM3 A;  3P6G A;  1MUP A;  1MOY A;  1VWA B;  1ADL A;  2OZQ A;  2NNQ A;  2ACO A;  1KZX A;  2OFM X;  2R73 A;  4BJ8 A;  1SWE A;  3Q6L A;  4HPB A;  2A2G A;  1VWP B;  4IMO A;  2K23 A;  4MIS A;  2X8F A;  4WBK A;  2FLJ A;  4GGT A;  5B10 O;  1MM9 A;  1KQW A;  2Q2P A;  4HFO A;  4O3Z A;  4ZCB A;  1ZRY A;  3PPT A;  5HA0 A;  5HZQ A;  3S5V A;  1CBS A;  3ZZV A;  1ERB A;  1VYF A;  1S2P A;  2F73 A;  4GET A;  1NBX A;  2VFB A;  4QAE A;  3BSZ E;  1JJU A;  3FEN A;  3H3I A;  1SWA A;  1SY0 A;  1PBO A;  4KC8 A;  4XMF A;  5JD2 A;  4CDC A;  1BSY A;  4QYP A;  4HWM A;  1B56 A;  2HYS A;  2CBR A;  2W2A A;  3B2K A;  4U46 A;  3FA7 A;  2BSZ A;  1VWE B;  4YH0 A;  5KHP A;  5B3M O;  1B4M A;  1WBI A;  5F58 A;  4MVE A;  2OL7 A;  3FA6 A;  4DQ3 A;  2JU8 A;  4NNT A;  1MEP A;  1Y52 X;  4GKC A;  1GT5 A;  2JOZ A;  1K24 A;  2LB6 A;  1HBQ A;  4KII A;  2XKL A;  4O4S A;  4OS8 A;  1SRI A;  3RDX A;  1SLF B;  5F2B A;  2ZAG A;  1TOW A;  3B2I A;  2OVS A;  1AB0 A;  3BRN A;  4LZU A;  2Q9S A;  3WZP A;  1MK5 A;  1IFC A;  2DJF A;  1B8E A;  4OEL A;  1R0U A;  2G78 A;  2FS6 A;  4BOE A;  1DF8 A;  3MX7 A;  3NAD A;  1N0S A;  1SA8 A;  1E5P A;  2Z4H A;  2RTC B;  4XMC A;  1EUO A;  1DC9 A;  1IKE A;  4FBV A;  5L8I A;  3X00 A;  2JN3 A;  3CWK A;  5LKF A;  3UEU A;  2QO4 A;  4OMX A;  4ON1 A;  1DFV A;  2HLV A;  2WR6 A;  1HQQ A;  2WUT A;  3PP6 A;  2PY1 A;  3ZW2 A;  2RTK A;  5DG4 A;  3SZI A;  1U18 A;  4GH7 A;  4GNW A;  3VE2 A;  1RXK A;  2JGS A;  5HBS A;  5IO5 A;  3FA8 A;  3IA8 A;  2ALL X;  1BJ7 A;  4D6A A;  3T6F A;  2RTJ A;  5D4A A;  5HWZ A;  1JYJ A;  2QO6 A;  1YWB A;  1SY1 A;  3RY2 A;  1MX8 A;  2WEW A;  4NLI A;  4Y0R A;  3E3C A;  3PED A;  4GDA A;  1Y53 X;  1CBI A;  5IRA A;  5DPQ A;  5L3Y A;  4ML7 B;  3S5X A;  2HZR A;  4GGZ A;  4ZGU A;  1QY2 A;  5F7G A;  4Y59 A;  3T1D A;  3BU1 A;  1JIW I;  1SLD B;  1KT4 A;  3RE5 A;  2O62 A;  5AJB A;  4QGV A;  2K62 A;  3P24 A;  4GE1 A;  3EBK A;  4BX7 A;  3KZA A;  4GGR A;  4GJS A;  3VG7 A;  4QNI A;  4Y0S A;  1VPR A;  2BS6 A;  5EEE A;  2GJ5 A;  2BS5 A;  3OD9 A;  4U8U O;  5AQ6 A;  4ZHH A;  2LBA A;  3FR5 A;  1EQD A;  3F6Z B;  2MHD A;  2OF9 A;  1GKA A;  1NQN A;  2KT4 B;  4CDF A;  3MG5 A;  2RTF B;  1D2U A;  2KW1 A;  2ZSC A;  1KGL A;  1SWF A;  4XME A;  1I78 A;  1VWC B;  4BVM A;  5F6B A;  2OL6 O;  3NQ3 A;  4JNJ A;  4BX6 B;  3VGW A;  3CKF A;  1YP7 A;  4QZT A;  1RXJ A;  1MVG A;  1VWI B;  1BSQ A;  2C1S A;  1FE3 A;  2IZJ A;  1A18 A;  4WFU A;  1T0V A;  3GE2 A;  1CBR A;  1EI5 A;  1EPA A;  1DZM A;  2NNE A;  1N9Y A;  3UEV A;  3ZI8 A;  1YUP A;  3F8A A;  2NP1 A;  2LBV A;  3VU1 A;  4ZHG A;  1SRE A;  1SWP A;  4BX5 A;  1OBQ A;  1SWR A;  1GX3 A;  2LFO A;  3O19 A;  2OYB O;  1BSO A;  4GRJ A;  4CDE A;  1GKA B;  2JMB A;  5B29 A;  4BGF A;  2GTF X;  1VWN B;  2MF6 A;  1HMS A;  4YGH A;  5FFH A;  4NW4 A;  3BX8 A;  2OFB A;  2L5P A;  3O22 A;  2NND A;  3HOL A;  1OPB A;  4NP1 A;  5EZ2 A;  4A60 A;  2RCQ A;  1X8O A;  1SWD A;  4HPA A;  3T2W A;  1ML7 A;  2WSJ A;  4EXZ A;  5EDC A;  5HZ8 A;  3NQ9 A;  4YCH A;  2RTO B;  4OEM A;  1GX8 A;  1KOI A;  2FTB A;  1I9H A;  1QWD A;  1GGL A;  2A3F X;  1CRB A;  3CR6 A;  3HWF A;  4L1N A;  2A5B A;  4O4X A;  1G74 A;  5LJH A;  4PSQ A;  4ZFX A;  1HBP A;  3WOV A;  2RTD B;  1SWU A;  2ANS A;  3PH6 A;  5EED A;  1YWD A;  1VWD B;  4QZU A;  2KD2 A;  5H9K A;  5LJB A;  3T2X A;  4AZN A;  4TLJ A;  1N9M A;  2G7B A;  1RST B;  1VWK B;  4HPD A;  5KID A;  2RTG B;  2ASN X;  1TOU A;  1SWN A;  1JJX A;  1EPB A;  1SY2 A;  4YKO A;  1G7N A;  3FR2 A;  3P02 A;  2POA A;  4YVB A;  2HZQ A;  1E00 A;  4QYN A;  2IZA A;  4GNY A;  2M4L A;  1KZW A;  4M6S A;  5FQ8 E;  1NC9 A;  3RDQ A;  4Z2V A;  1STS B;  3B2L A;  4YDB A;  4KH8 A;  5K68 A;  3Q34 A;  3WXQ A;  3CQR A;  2RTH B;  3D95 A;  4C5P A;  1Y9T A;  2AL0 X;  2AT5 X;  4LKT A;  2RTL A;  3TZS A;  2W2B A;  2Q2M A;  3AKN A;  4IB6 A;  4XMD A;  2IZK A;  4I3B A;  2FWV A;  3RKG A;  1STP A;  3NP1 A;  3P6C A;  3KFG A;  3SAO A;  3RBY A;  2IZE B;  4NYQ A;  2OF8 A;  4N7C A;  1I05 A;  3FR4 A;  1ICM A;  1PM1 X;  3B2H A;  3UAQ A;  4YGG A;  1HQP A;  3BX7 A;  2KTS A;  3O2Y A;  4I6S A;  3U9P C;  1RAV A;  4FBO A;  3RZY A;  2HKD A;  4OMW A;  1SXX A;  2L9C A;  4IBA A;  5IRU A;  3WZQ A;  5HZ6 A;  1T8V A;  5FEN A;  1EAL A;  2OY1 O;  4YGZ A;  4CPH A;  4ZJ0 A;  2CM9 A;  1PEE A;  1ZND A;  1SXW A;  3FID A;  4AW8 A;  4FBR A;  1AEL A;  1CJ5 A;  1T68 X;  3KVN A;  2JU3 A;  4U8U N;  2FS7 A;  1OSP O;  1X8U A;  2C4I A;  2ACP X;  3MBT A;  1N4J A;  1SLG B;  2ZAI A;  2RTM A;  4Z2P A;  4ID2 A;  3AUM O;  4Z27 A;  3STM X;  2BLG A;  3HTY A;  1D3S A;  2PI3 O;  2W2F A;  3WJC A;  4A8Z A;  1DV9 A;  3RE6 A;  2OY7 A;  2BT9 A;  2OFA A;  3ELZ A;  4ES7 A;  1YWA A;  4BCS A;  1DZJ A;  3EYC A;  1W5R A;  2IZB A;  1O1U A;  1ALB A;  4YBU A;  2F01 A;  4LZV A;  4TNN A;  1N43 A;  3SOT A;  2UZ2 A;  1OPA A;  2N93 A;  1LEL A;  2A5C A;  3DTQ A;  4CPH B;  1NGL A;  1LF7 A;  1BBP A;  3QQ2 A;  1SY3 A; 
#chains in the Genus database with same CATH homology
 3BU9 A;  3STN A;  2QMI A;  5LJC A;  4ZH9 A;  3QKG A;  2OVD A;  5EPQ A;  5H9A A;  3ZW0 A;  1ZNL A;  3ZWE A;  1KXO A;  5AJC A;  2RCT A;  3P6E A;  2QOS C;  1YP6 A;  1S44 A;  5F1E A;  5HZ5 A;  4ORX A;  1DZP A;  3FEP A;  3JS1 A;  3VE1 A;  3C77 X;  1NP4 A;  2X46 A;  4IB7 A;  3RSW A;  4KC7 A;  1KT7 A;  4AZP A;  1B0O A;  2HNX A;  1LNM A;  3S60 A;  1OEJ A;  3DSZ A;  1LFO A;  2CM4 A;  3APV A;  5JR8 A;  4IAB A;  4O3Y A;  4U3Q A;  1L6M A;  2GTL O;  3VG2 A;  3ZW0 B;  5HCE C;  2FR2 A;  4L3R A;  1X8P A;  4FGI B;  5BYP A;  1BLR A;  2L67 A;  3APW A;  4TKB A;  1Z24 A;  2X45 A;  3WJB A;  3NR3 A;  4HPC A;  3FIQ A;  2E4J A;  3BLG A;  3FA9 A;  4AZQ A;  1GT4 A;  1OEK A;  2AMM X;  3FMZ A;  4M7M A;  2YMS A;  2A2U A;  3N91 A;  5L8N A;  3NBX X;  3UEW A;  3HWG A;  1CBQ A;  1IFB A;  1TXL A;  4AYH A;  3TF6 A;  3VG5 A;  4TJZ A;  1FDQ A;  1X8N A;  3OJY C;  4IB9 A;  3D4R A;  1ERX A;  3ZW1 A;  2AKQ A;  4YKM A;  3WJG A;  2FR3 A;  2WEX A;  5LJD A;  1I04 A;  2LKK A;  4GU8 A;  4O3W A;  4AZM A;  3JQO A;  4ODD A;  2FT9 A;  4I9S A;  3ZUI A;  3WJF A;  1LKE A;  3ELX A;  4U8U M;  1LIB A;  2YG2 A;  1XKI A;  5BVS A;  1I4U A;  3CMP A;  1RBP A;  1SXU A;  2MWH A;  5HA1 A;  1ZNK A;  4LKP A;  1URE A;  3L4R A;  3VPJ E;  4I95 A;  3APU A;  3ZW1 B;  4GDZ A;  1ZNG A;  4EFG A;  4Y0P A;  1BRP A;  1ICN A;  5HCC C;  4GZV A;  4A1H A;  5H9L A;  4QGW A;  3P6F A;  3VG6 A;  3WJD A;  1PMP A;  4N7D A;  3D97 A;  3STK A;  1A57 A;  1HMR A;  4OS0 A;  3EMM A;  3KQ0 A;  3S26 A;  4ORW A;  1FTP A;  3ZI8 A;  3C76 X;  5C0N A;  3LHN A;  1TW4 A;  1LIC A;  4NYR A;  3G7X A;  4UU3 A;  1H91 A;  1XCA A;  1SMP I;  1FEN A;  2FRS A;  4PJ2 A;  1EXS A;  4GK9 A;  5LJK A;  4QQ1 A;  1G5W A;  3WBG A;  5AEO A;  1LPJ A;  2LA7 A;  4FQB B;  1GT1 A;  1OBP A;  4YBP A;  3EBW A;  3CQN A;  3NX1 A;  2RA6 A;  4DQ4 A;  1JZU A;  4INN A;  4O49 A;  1U0X A;  3PQS A;  2XST A;  3LV4 A;  4I3D A;  4ALO A;  4AZO A;  3PEC A;  4R0B A;  3CBS A;  4WFV A;  3TGC A;  1JV4 A;  4QRL A;  4NLJ A;  3FW4 A;  4YCE A;  5D8J A;  1EII A;  4MVK A;  3TGB A;  1RLB E;  4IB8 A;  3NPO A;  3I0A A;  3MVF A;  3VG3 A;  1TVQ A;  5HTE A;  4EQA C;  1JJJ A;  5H8T A;  1GXA A;  4TKH A;  4IAW A;  3CBC A;  3VG4 A;  4YFQ A;  1KT5 A;  4MIR A;  1IKJ A;  1G85 A;  2WQ9 A;  2AT8 X;  5FQ6 E;  1EW3 A;  5L8O A;  2GTL N;  2OFR X;  4OS3 A;  4I3C A;  2GC9 A;  3WVM A;  4XMG A;  2AT6 X;  4QGX A;  1FEL A;  4LQZ A;  3TGA A;  1BEB A;  3AKM A;  4ORS A;  1I06 A;  1YWC A;  1BRQ A;  4YFP A;  3NQK A;  1A2D A;  2G79 A;  1IIU A;  2AT3 X;  4MVI A;  4ZGF A;  2AT0 X;  2RD7 C;  3C78 X;  3FYF A;  3FEL A;  1JBH A;  4K19 A;  2CZT A;  1KT3 A;  1OEE A;  1NP1 A;  1QAB E;  3RWX A;  4ARH A;  1IW2 A;  4JGL A;  2KTD A;  1DF3 A;  4YDA A;  2A13 A;  1ACD A;  1VYG A;  1LIE A;  4YFR A;  3HWE A;  4Y0Q A;  2F09 A;  1FEM A;  4WHI A;  3ZUO A;  3P6D A;  2QO5 A;  3OE3 A;  2MO5 A;  1JYD A;  4EEJ A;  1BWY A;  1P6P A;  4RUU A;  5K06 A;  5HZ9 A;  2A0A A;  1X89 A;  3U03 A;  1E02 A;  3BS2 A;  3P6H A;  1AQB A;  4O9S A;  5CYB A;  2RQ0 A;  4ZHF A;  4TKJ A;  2MJI A;  2R74 A;  2X8S A;  3NX2 A;  2R56 A;  5EDB A;  3HK1 A;  4ORU A;  3JSQ A;  1DZK A;  4ORY A;  3F9D A;  5D48 A;  2Q39 A;  1GT3 A;  1OBU A;  3FLL A;  4TQ2 A;  3IFB A;  4ZH6 A;  3BDR A;  5H9N A;  3PQU A;  1QQS A;  2OVA A;  3APX A;  4RUN A;  2EU7 X;  5HAE A;  2RN4 A;  5LKE A;  2JU7 A;  1QG5 A;  4IAX A;  1KT6 A;  1X71 A;  1KQX A;  1ZNH A;  4KCA A;  1QFT A;  5BVT A;  3BY0 A;  4YMY A;  2P8G A;  4U9C A;  4ORR A;  5FAZ A;  2AH7 X;  5IO7 A;  4XMH A;  4CSB A;  1E06 A;  1YIV A;  4I9R A;  3EM0 A;  3V8U A;  4ALB A;  4O4O A;  3I17 A;  3WJE A;  1MX7 A;  1Y9L A;  3OBL A;  1AVG I;  1SXY A;  2WWP A;  4CV7 A;  5D47 A;  4EDE A;  3HOE A;  1X8Q A;  3KFI A;  1BM5 A;  4ZHD A;  3D96 A;  2DM5 A;  3UEX A;  4COT A;  2QM9 A;  1O1V A;  4ZHC A;  2GTL M;  5B27 A;  2CZU A;  3FW5 A;  2IFB A;  3B2J A;  2X8T A;  2CBS A;  1LIF A;  3GAQ A;  5F6Z A;  4UU2 A;  3K3L A;  4NNS A;  1HN2 A;  4O3X B;  4D6B A;  3FEK A;  1QY1 A;  1MDC A;  5HCD C;  2BHV A;  4ZR2 A;  5CE4 A;  1GX9 A;  2OVE A;  2Z4I A;  5D45 A;  4O4U A;  4CK4 A;  1LID A;  4KT5 A;  2JW1 A;  1ZNE A;  1S7D A;  1O8V A;  4IMN A;  4AZR A;  1A3Y A;  3HWD A;  3U0D A;  5LJG A;  4A1Y A;  2L68 A;  5BVQ A;  3KFH A;  1QFV A;  1UZ2 X;  4MVL A;  1GM6 A;  5FQ7 E;  2WQA E;  5LJE A;  2HMB A;  3ZQ3 A;  5IO6 A;  2Q4N A;  1QY0 A;  1HMT A;  1U17 A;  3PH5 A;  5HTD A;  1EIO A;  5KIC A;  3KFF A;  2MM3 A;  3P6G A;  1MUP A;  1ADL A;  2OZQ A;  2NNQ A;  2ACO A;  1KZX A;  2OFM X;  2R73 A;  4IMO A;  3Q6L A;  4HPB A;  2A2G A;  2K23 A;  4MIS A;  2X8F A;  4WBK A;  2FLJ A;  1KQW A;  2Q2P A;  4HFO A;  4O3Z A;  4ZCB A;  1ZRY A;  3PPT A;  5HA0 A;  5HZQ A;  3S5V A;  1CBS A;  3ZZV A;  1ERB A;  1VYF A;  1S2P A;  2F73 A;  4GET A;  4QAE A;  3BSZ E;  3H3I A;  3FEN A;  4KC8 A;  1SY0 A;  4XMF A;  1PBO A;  1BSY A;  4QYP A;  4HWM A;  1B56 A;  2HYS A;  2CBR A;  2W2A A;  3B2K A;  3FA7 A;  4YH0 A;  5KHP A;  1B4M A;  5F58 A;  4MVE A;  3FA6 A;  4DQ3 A;  2JU8 A;  4NNT A;  4GKC A;  1GT5 A;  2JOZ A;  4KII A;  2LB6 A;  1HBQ A;  4O4S A;  2XKL A;  4OS8 A;  2ZAG A;  1TOW A;  3B2I A;  2OVS A;  1AB0 A;  3BRN A;  4LZU A;  2Q9S A;  1IFC A;  1B8E A;  1R0U A;  2G78 A;  2FS6 A;  4BOE A;  3MX7 A;  3NAD A;  1N0S A;  1SA8 A;  1E5P A;  2Z4H A;  4XMC A;  1EUO A;  1DC9 A;  1IKE A;  4FBV A;  5L8I A;  2JN3 A;  3CWK A;  5LKF A;  3UEU A;  2QO4 A;  4OMX A;  4ON1 A;  1DFV A;  2HLV A;  2WR6 A;  2WUT A;  3PP6 A;  2PY1 A;  3ZW2 A;  5DG4 A;  1U18 A;  4GH7 A;  4GNW A;  3VE2 A;  5HBS A;  5IO5 A;  3FA8 A;  3IA8 A;  2ALL X;  1BJ7 A;  4D6A A;  5HWZ A;  5D4A A;  1JYJ A;  2QO6 A;  1YWB A;  1SY1 A;  1MX8 A;  2WEW A;  4NLI A;  4Y0R A;  3E3C A;  3PED A;  4BQU A;  1CBI A;  5DPQ A;  4ML7 B;  3S5X A;  2HZR A;  4ZGU A;  1QY2 A;  5F7G A;  3T1D A;  3BU1 A;  1JIW I;  1KT4 A;  2O62 A;  5AJB A;  4QGV A;  2K62 A;  3P24 A;  4GE1 A;  3EBK A;  3KZA A;  3VG7 A;  4QNI A;  4Y0S A;  1VPR A;  2BS6 A;  5EEE A;  2GJ5 A;  2BS5 A;  3OD9 A;  4U8U O;  5AQ6 A;  4ZHH A;  2LBA A;  3FR5 A;  1EQD A;  3F6Z B;  2MHD A;  1GKA A;  2KT4 B;  1D2U A;  2KW1 A;  1KGL A;  4XME A;  4BVM A;  5F6B A;  3NQ3 A;  1YP7 A;  4QZT A;  1MVG A;  1BSQ A;  1FE3 A;  1A18 A;  4WFU A;  1T0V A;  3GE2 A;  1CBR A;  1EI5 A;  1EPA A;  1DZM A;  2NNE A;  3UEV A;  1YUP A;  3F8A A;  2NP1 A;  2LBV A;  3VU1 A;  4ZHG A;  1OBQ A;  2LFO A;  3O19 A;  1BSO A;  4GRJ A;  1GKA B;  2JMB A;  5B29 A;  2GTF X;  5FFH A;  4YGH A;  1HMS A;  4NW4 A;  3BX8 A;  2L5P A;  3O22 A;  2NND A;  3HOL A;  1OPB A;  4NP1 A;  5EZ2 A;  4A60 A;  2RCQ A;  1X8O A;  4HPA A;  1ML7 A;  2WSJ A;  4EXZ A;  5EDC A;  5HZ8 A;  3NQ9 A;  4YCH A;  1GX8 A;  1KOI A;  2FTB A;  1QWD A;  1GGL A;  2A3F X;  1CRB A;  3CR6 A;  3HWF A;  4L1N A;  4O4X A;  5LJH A;  1G74 A;  4PSQ A;  4ZFX A;  1HBP A;  3WOV A;  3PH6 A;  5EED A;  2ANS A;  1YWD A;  4QZU A;  2KD2 A;  5H9K A;  5LJB A;  4AZN A;  4TLJ A;  2G7B A;  4HPD A;  5KID A;  2ASN X;  1TOU A;  1JJX A;  1EPB A;  1SY2 A;  4YKO A;  1G7N A;  3FR2 A;  3P02 A;  2POA A;  2HZQ A;  1E00 A;  4QYN A;  1KZW A;  4GNY A;  2M4L A;  4M6S A;  5FQ8 E;  3B2L A;  4YDB A;  4KH8 A;  3WXQ A;  3CQR A;  3D95 A;  1Y9T A;  2AL0 X;  2AT5 X;  4LKT A;  3TZS A;  2W2B A;  2Q2M A;  3AKN A;  4IB6 A;  4XMD A;  4I3B A;  2FWV A;  3RKG A;  3NP1 A;  3P6C A;  3SAO A;  3KFG A;  3RBY A;  4NYQ A;  4N7C A;  1I05 A;  3FR4 A;  1ICM A;  1PM1 X;  3B2H A;  3UAQ A;  4YGG A;  1HQP A;  3BX7 A;  2KTS A;  3O2Y A;  4I6S A;  3U9P C;  4FBO A;  3RZY A;  4OMW A;  1SXX A;  2L9C A;  4IBA A;  5HZ6 A;  1T8V A;  5FEN A;  1EAL A;  4YGZ A;  4ZJ0 A;  2CM9 A;  1PEE A;  1ZND A;  1SXW A;  4AW8 A;  4FBR A;  1AEL A;  1CJ5 A;  1T68 X;  2JU3 A;  4U8U N;  2FS7 A;  1X8U A;  2ACP X;  3MBT A;  2ZAI A;  4ID2 A;  3STM X;  2BLG A;  3HTY A;  1D3S A;  2W2F A;  3WJC A;  4A8Z A;  1DV9 A;  2BT9 A;  3ELZ A;  4ES7 A;  1YWA A;  1DZJ A;  3EYC A;  1O1U A;  1ALB A;  4YBU A;  4LZV A;  4TNN A;  3SOT A;  1OPA A;  2N93 A;  3DTQ A;  1NGL A;  1LF7 A;  1BBP A;  1SY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...