1SY6A

Crystal structure of cd3gammaepsilon heterodimer in complex with okt3 fab fragment
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
204
structure length
168
Chain Sequence
MQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human T cell receptor CD3(epsilon)(gamma) heterodimer complexed to the therapeutic mAb OKT3.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/antibiotic
molecule keywords OKT3 Fab light chain
total genus 34
structure length 168
sequence length 204
ec nomenclature
pdb deposition date 2004-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1sy6A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1sy6A01
1ZT1A 1HHIA 4PBVC 5DS8A 2ADFL 1NCAH 5KSUB 1E4KC 1TQBC 4EI6B 1IMHC 4AENB 1KJ2H 3F7RA 3TZVB 4KK6D 2HH0L 1E4WH 2D7NA 1GIGL 4HXAL 4DWHA 2GSIA 3AREA 2FCBA 3I3DA 2D4DA 4WEUD 4AMKL 3RAJH 1WZ1H 1NAMH 1RZ7H 5EZIH 4HV8A 3S7GA 1C5DB 4Z77B 2GAZB 3MJ6A 5HPMA 1GC1H 1L9MA 1VA9A 4JFYB 3JVGA 4I2XA 5K9QI 3NA9H 3FN9A 4TNWK 2VDOL 4N9GB 1T5WB 4X7TB 1WGOA 3H42L 2OSLA 2DIJA 2LE9A 1AGEB 3PL6A 2HFEA 4YJZL 1HEZA 4U7MA 5ALCL 3HCVB 3X11A 2VABB 1F58H 1PAMA 1MHHA 4Y4HA 5CD3A 1U8LA 1T7XA 4UV7H 5E2WH 5A1AA 5IFHL 5IOPA 3RDTD 3SBWC 4GG6E 4D2NA 4X8XA 2FX7L 4YHLH 2OR9L 3S96B 3PQYB 4XNUL 3S88H 2YBRB 5HY9A 4BQ9A 3RNKA 3V9FA 3MZTA 3T2PA 3IDGA 2ESVE 4WI4A 4WHCA 1RHFA 4H1LG 1C16A 1RZIB 5HDOA 3UJIL 3ARUA 3QQ3A 4RFNB 2OTWB 5DFVC 2QSVA 2F58L 1GAFH 1RK1B 2WBJD 4I5BB 3BDYL 1DZBA 2H6PB 1JGDA 5TQ2H 2IGFH 3DSFL 1YMHA 4OGXH 5HHVL 4OZHE 4YDVB 4WFGD 2XTJB 1PKOA 4ZPTA 4DKFL 1U9KA 4Z0XB 5IB4A 3KYOA 4RISL 1EGJL 1Z2KA 1P6AB 1PLGH 3JWOL 1AQKL 1UB5A 5MEQB 4D0CB 4HUUB 1BD2A 2WUBH 1ZWIA 3EO9H 3ARED 5KSBE 3UPAA 3GSWA 4K9EH 3REWA 5INCA 5DA4A 5BO1H 4GLRI 3K2UH 3KJ4C 4R2GD 1RURH 3KDMA 2VISA 3B9DA 3G6DL 2R0WL 1DL7H 1T83A 1YNTB 5TPWL 2XI9A 4KK9D 4G6ML 4LP5A 2MWCA 3AAZB 4HFUH 5TDNB 4QCIA 5I1HL 4B41A 1GVIA 5MP6H 2PXYD 3TA3D 1HXYA 4G8FA 1X5GA 4Z6AT 1T4KB 4GUPB 4AH2A 25C8H 5KSAC 3P9LB 3DO7B 1DBKL 4N0CD 4XC1H 4L29A 5IOPB 2D2OA 4GAYB 3BP4B 2I07B 4ODTH 1UCBL 3NPZB 3OGCA 1CLZH 3CZFA 2GJZA 4MX7B 4N9OB 1JL8A 1MH5A 3QI9C 3CFCH 2FGWH 3MRHB 1A3LH 4JB9L 4JHWH 4U2YA 1AQKH 1QRKA 1UJ3B 5D72L 1JRHH 2XA8H 2APBA 5CHNA 1CD1A 1LDPH 2ORBH 2BNQE 1QEWB 1CD8A 3S88L 1P5VA 3QRGH 5SWQB 1N2RA 5BO1L 4Y5YA 3FB6A 4DZBB 3A67H 4JM4H 4R2GB 2IALB 3QDME 3RBSA 5TGBA 1P53A 1XAUA 1G9MH 1AH1A 3CDCA 1UH3A 4KRMB 3I6GA 2EYRA 4LKCA 4AENA 4ZSOB 4QY8B 5F9WB 5E8EA 1IT9L 2ITCB 3O9WA 3C8HA 2JJUA 3EYVB 4D9LL 3PIQA 3B43A 3NAAL 4FZ8L 5SWSD 1HZHL 3DSFH 4WDIB 4G8GE 1S7QA 1UYWH 3B5HA 1EZVY 3P3YA 4XH2A 5I1AA 3RI5F 3PXJA 3GSWB 1IGYA 1GRWA 1XIWC 4JE4B 4IHOB 4N8CH 43C9A 2NTFA 1NL0L 2P24A 4Y4FB 4PRDB 5L9DH 3WFEH 5DJDB 2VLJD 1UH2A 1Y6MR 1RD6A 4URTB 3QXTA 5IB4B 2DL9A 4K3EL 2XYCA 3UTZB 3LQAL 1NC2B 2IPTL 3DNKA 1R6VA 4YDVA 5DR5L 3R0MA 4BFIA 5IB3B 5TF1L 3VRLF 3VG0H 3NA9L 3GHBH 3IAPA 1J1XL 2Y7QA 3NOIA 4KK5D 1KLUB 3H0TB 2OK0H 4KHTL 3LB6C 4NOFA 4ELME 2AQ1A 3MA7B 4YDIH 1MQ8A 5F7NC 5TE4L 3QCUH 4KRPC 4KY1L 1H3VA 3G5ZA 4PLNC 1GGCL 1M05B 5ETUB 4HGMA 4Z7UA 4NRZB 1URLA 3O3BA 4XP1H 2FGWL 1IEBA 3HB3C 5EC1B 4HJGA 2CKBA 2XWJA 1FFRA 4C58B 2NY0B 1BMGA 4FQLH 4X7SL 5GRUL 1A1MB 3CIQA 1OTTC 1VGEH 2YK1L 1T2JA 3C2AH 2CPCA 4IS6A 3OG6B 2AJYH 2VABA 4DEPB 5L7XL 4PJHA 1II4E 3VH8A 4X4YB 2DIBA 2IPTH 3SQOL 1JIBA 1A6WL 4DN3L 1GAFL 5C0EA 3QG6A 2V5TA 1HQ4B 4JFDE 3NFPA 4ZQKA 2YD3A 1I7TA 3VXMB 2OMNA 5JHDE 1PSKH 4HT1H 4J8RB 4OD1H 1NMCB 1QP1A 1P7HL 1VKXB 3I75B 3GSNL 1KTLB 3DRQA 2ZWLT 4ZMAT 1RJLA 4JPWL 4L9LA 2VXVL 4FP8L 4F15B 3C60C 4X4MA 2ICWB 5J06A 4YBLC 3DIFA 2Y36L 2O5YH 1N0LA 2DQTH 2BVOB 4PJDF 4K07A 4WI5A 3SO5A 1N6VA 3K81A 4FXGB 4OBSA 4WUUE 4L4VD 5FDWA 3KR3L 3QQ9D 5L88H 4X7DC 3ULSA 4ENEC 1JN6A 3D2UD 4MXQD 2PUQT 1SEQL 2FLBT 1N0XH 2DLGA 3UAJD 3ZSSA 5C0CE 2DQFB 3T0EA 3F6IA 5T3XD 5J56B 2MCPL 2AJZA 4JM2C 1BEYH 3OZ9L 1OQXA 2X7LA 4P2QB 4N0UE 1HH6B 3UROR 2V5YA 4I4WB 4M1CD 5HHXH 3P9WB 3L5HA 1U41A 4TRPH 1S9KC 4LF3A 4XXDA 3H7BB 4R8WL 2D03L 4AJ0A 5IT2L 3KPMA 4V2BA 3VW3H 2OK0L 1HSAA 3UCRA 1E0OB 1IQDB 1B0RA 2P45B 2VLRE 4YLQT 2VL4A 4PJAF 4DAGH 4N8CL 4BUGA 5CEZE 5D2NC 3W39B 4ODUB 2C1OB 2X4TA 1MNUL 2I9LB 3KR3H 5I8OH 3SKOB 3S37X 4L4VB 1TCRA 1JNHA 3DX9B 3HNVL 5IMLA 5J1TC 5I1CH 5HD8C 3UTQA 4G42A 3G5YB 5KBNC 2X42A 2VDPH 2B1AL 4TTDC 2C4XA 4XNYH 1F8TH 2IQAA 3BGFB 5F9DC 3RHWK 4WU5A 5C0GA 1F45A 4OT1H 5E8PB 5IBLD 4D94A 1Q9WB 1UXSA 3TGXA 5HVGB 3T0ED 4QRTB 3RZCB 3IGAB 2H32H 2K9UA 3NTCH 1GPOL 2YD9A 2VNCA 3MRDB 3BAEL 4NQCA 3MLZL 4BZ2H 2ATPB 4ZTPL 1UYWL 2IAND 1ZEAL 2X4UB 4KJYB 5CS7A 1GXEA 2J12B 1BQLL 2YPLD 2VL5B 2PW1B 4GW1B 4ONGH 5HGAA 4HPOH 4I77L 3F7VA 2VZOA 5HVHB 3FB8A 1I1CA 1KXVC 4PLJC 5DJ0A 5JA8B 4JN1H 2NLJA 4RGOH 3WXVH 2ICEA 3TN0B 2X41A 3BP6A 1J88A 1OARH 5DQ9B 4OZFH 4DGIH 1TVDA 5FO7B 1XF1A 2VC2H 5HDBF 4XC3H 1T1XB 5AAWA 5IG7A 5H2BA 4PY8J 2HFFA 5I19H 3BHBB 5F70A 3VWJD 2BFVH 1G7QA 5JMRA 4F8TA 4PP1C 1JNNH 1VFOA 2APVA 2LVCA 4LFHG 5GRZA 5HBBA 4RMVA 4RFOH 1JP5A 3BQUC 4APQA 3SDDA 3TESA 3SKUD 5FDWB 1KCVH 3T04D 1D6VL 1WC7A 2ZUVA 5DA0B 3ZTJG 3IU4H 1UM4H 3QUZA 3DECA 3PDOB 2D7TH 2FGZA 3U48A 3VRIA 5GS0C 4PRPA 1V3KA 4NDMB 1DLHB 5MI0B 5KSAD 4NNPH 5EG6C 2VXVH 4FP8H 4G8GB 2ENSA 4HEME 2P44B 4NP4L 1FL6B 4TRPL 2OYPA 4YDIL 1MJ8H 1CU4H 1UT9A 4LLDA 1OP3H 2J6EA 4LNRB 2KPNA 3GKWH 5E03A 3QXAA 2Y5TB 3JWOC 3QEHB 3PABB 3AU1A 4V1DD 2X44D 5KANI 3OKYA 3BPCA 4WCYL 3V7MA 5F96L 2F54D 4LSVL 3CH8A 5DUBB 4XCEA 1EAJA 2QADB 2B5IC 3MNZA 3KXFB 4WENB 4HMDA 3SHSA 2VDRH 3HE6A 1QLEH 2V9QA 1TQCC 1RJCA 1BJMA 5EPMA 2C3VA 1AD0A 2VITB 1JFQL 3FQUA 3U4EA 4JFDA 4U49A 1X7QB 2XN9D 4I2XE 5ISZD 3VFMA 3VFTA 1EFXA 1X4XA 5E94B 3LV3B 4Z7UB 3OAZK 3VXTB 3GI8L 5L2KD 1MRCL 3JWDH 3H9SB 4PBXA 3S9DB 4MCZA 1O7VA 4LCWE 4ZFOB 2R56H 1R24B 1FO0H 3ARGC 3P4OB 1RI8A 3SKNB 1IAMA 3VE0B 4H0GA 1BVZA 1J0KA 4Z5RA 5JOFB 1QBAA 4PJXE 1IEAB 1NC4D 2DQDH 5IVXB 1T7WA 5IQ7L 4UAOB 1DQJB 5EOCL 3QNYA 3KHOA 5FIEA 3C5JA 4BA8A 1RV6X 3WNKA 4Y5VB 4HBCL 1ZHBA 2AJ3A 3VGEA 1NAKH 4UT9L 3MV9A 1OAYL 2WMPA 5HDLA 3FT4B 5DD6B 4H0HB 1RHHB 1EMTH 4XI5C 5IV2A 1KB9J 4Y4KD 1AXIB 3D0VA 2AEPL 2CSPA 3AB0B 4XPBL 1WICA 2BCKB 2BNUA 5CUSL 1HXMA 1NGQL 1KCUL 4G9FE 3FFDA 4MDJB 3NN8B 3RIFF 4O02H 5HD8D 1LNUA 4PJBF 3GMPB 5EUKA 4P9MH 1A7OH 4WHTB 1SHMA 4NHCH 5KS9E 2BXYA 4NFBA 2EC9U 2FH8A 4UU9B 4EI5B 5L2KA 3BFOA 5FB8B 4KI5E 3BEWB 3RVTC 1UFUA 5JQHC 4YEEA 3B83A 3LKSB 1TZGL 2EDLA 4JANA 4LKCB 1TPXB 3EBAA 5JXEC 1JZ4A 1FGNH 2WUCH 1J1OH 2EDBA 3OHXA 5ITFB 4NM4H 1T04B 2AK4A 1ACYL 1WCQA 1HYSC 4ZUSB 5CJBA 4Y5YB 3BP7B 2H45A 3QUYB 3S6CA 1EX0A 3E6HB 3BXNA 3E3QC 4NGHL 4KZEL 1PJ9A 5FO9A 1ZHLB 1CD1B 4UTAL 1NCBH 2X09A 4DVBB 5LVEA 3RWDB 1WBYB 1XZ0B 4RBPK 1QRNB 1RZ8A 4XRCB 5T1KB 3RJDA 1UQSA 1S9VA 1SJHA 1TZHA 4KHXL 4YO0B 3GJFH 5E95B 3ESUF 1J8HA 1I9JL 3PGCA 1QSEB 3P30L 3DTXA 3K1KC 4ETQB 3KLAB 2Y06L 3QR2A 1EIBA 3QDMB 3CZFB 3ZT5A 1D7FA 2V2XB 4LPYA 2C7UA 5KZCB 4F9PC 4TUKH 4LCYA 3BEVB 2R56L 2P8MB 4JHZA 4HPOL 2DDQL 4YE4H 1H3PH 2CJUL 4XP5H 4TQEL 1BQHG 2APFA 4HIJA 3GSXA 3VFGL 4EEEA 5DC4B 2HFTA 4XZUA 1BLNB 3O2DL 2JELH 1BM3L 3BZEA 4ZXBA 4TN9A 3QPQD 5D96B 2KZWA 4RGNB 1S7VB 1ACYH 2WQ8A 3QSKB 4WJ5A 3U9PL 3GSXB 4G3YL 4ZUVB 4EKXA 3CFEB 3G6JA 4G7VH 3O6ML 1Z9MA 5LWYH 3ESVF 5CEZH 2FX9H 3MTRA 2J4WH 4FQ2L 4BFGA 1HHKA 1IZJA 5FYJL 3RUGB 1J0JA 4TOYH 2GITB 5DYOA 5CSGA 3QPXH 1YYML 4OFYD 5J12B 4S1RL 5HI5C 4I0PC 4N8VG 2HJFB 5FHBH 1LO0H 1U8OA 5CEXB 3RL1A 4JKKA 1H5BC 1RUKH 2I5YH 1J8KA 5D7IA 2EO1A 1JCKA 2Z4QB 3TCXA 1YA5A 1T0MA 4LRIA 1CR9H 2HT3C 1J9CT 1ZHLA 3WS6A 5JHDD 2WBKA 2HT3D 4IRSC 3W81A 3PHOB 3BH9A 3O8XC 1IGCL 4NM8L 3B5TA 1F3DJ 5EN2A 3SDXB 3D39D 4FQCH 4U1GC 3MLYH 1U8NA 1FL5A 3HPLA 1NC4A 3ZYOA 4FQPA 4GQ9H 2GJJA 4NCDA 1OCWL 3V4VH 4GKZB 4MHHI 1XIWA 3WL9B 3UO1H 4ISVA 3K8LA 1KBGL 1MF2H 1F4XL 4PJAA 3KPPB 4QHKJ 3QQ9C 4PS4L 2DD8L 4HKZA 3WKMH 1RUQL 4XVSH 2EH7L 4NJAL 4KFZC 3CXDH 1LNUB 2FH6A 4RFNC 2PCPB 4OCNC 5EOTA 5C0CD 1EUUA 4QKXB 2JK5B 4JO3L 1CIDA 1X5IA 1Q1JH 4U2ZA 3OX8A 5JHLH 4WFHE 3ZKMC 1DBBL 2GSGB 3FOLB 3RY6C 4NC1C 1OGAA 4AIXA 5D7SL 1AR1C 5FYLE 4FTVD 5GIRB 3L7FB 1JZ8A 4PJ5E 4RMQA 4B53A 4KHTH 3MUJA 1AE6L 3AVEA 2KQMA 4YHMH 1IGIL 4Y5VA 3UTSD 4KK9C 2VLJA 2YA2A 5FO8A 3DYPA 3BYYA 4PRBB 3HR6A 3HPJB 5IVXA 3GRWL 4ZODA 5LBSL 2A74A 2B4CC 4LDLB 5CJQL 4MJ5B 5TE7L 4LGRB 5C0IB 5K33A 3G04B 1V7MH 1RIUL 4HMCA 4QNPF 5BZWB 2X70A 3MJ7B 2GTZA 1EFQA 2NY0D 5EU7C 1DUYB 3H9SA 4WFED 5HHOD 1FBIH 4PJ8B 3ZKNC 5IEHB 1F90L 4P4RA 4XWOD 4GMSH 3CFBB 1FZKA 5C0CB 2IG2L 2B1HH 1JMXA 5KTEH 3GNMH 5GJTL 1NFDA 5IEKA 4MQXD 4YHLL 4UOW0 4CVXA 3P73A 1CTNA 3BWAA 2FD6L 5D6DC 3LMJH 4LAQL 4G9DA 4MNHB 4MNQD 1MVUA 4FTVB 5E2UH 1IGCH 2CR6A 2OJEB 4GKSB 2Q6WB 4N5ED 3T0BA 2Q8AL 3IJHB 1L0YA 4OD3H 2JIXA 2SEBA 4NZRH 3ZKQD 2D4FA 5A16B 3IDYC 5KANG 3MYJB 4ZOBA 1F97A 2EDNA 3HZKA 4R3SA 2XN9A 1Z0NA 4OIIH 4B0MM 5CWSA 1YMMA 4OGXL 1F4YH 5FHBL 5ICZA 3RX7A 5JXAH 3I85A 1D9KD 3T08A 4WHYH 4UILH 3SDAD 3LH2H 2ED9A 1KCSH 2HT2C 4OUUA 1FVDB 4B7LA 4LPUA 3WD5H 5FGRA 4X80H 4OSUL 3AROA 1EUTA 4J2XA 4G80B 3SDCD 4NZUH 1S5IL 3W9EA 2OBGA 2MMXA 3LVEA 3V4UH 2GJ6E 1CICB 4UZGA 5IVZB 2FZ3B 1MWAA 2RHEA 1DQQA 4ODHL 4PJGF 4J3TA 2IQ9H 4OJFH 3TT3H 4Z7QE 1HH9A 2FIRT 2M2DA 3OV6A 3CAFA 4NBXB 4QGTA 3RVXC 2VDOH 2G9HA 2I26N 2ICEB 3HI6L 3TN0A 5I1GH 1CT8A 1PG7H 1T0NB 4K2UL 1T0NA 2PO6B 1ZOXA 5D5MB 5HGAB 1DANT 2PW1A 4UUJA 1MCOH 4ODWB 5C3TA 3RWFA 5IFJB 3LCYA 3S5LG 1F6AB 2EDQA 1OGTB 5D1XD 4IMLB 4OLUL 4RQQB 5DI8B 4PRNA 4QRSA 5INDA 5ENWB 5JW4M 3FZUC 1FFNB 1K2DB 3OPZH 3N1MC 2NW2B 4X7EC 3IGAA 4JRWA 5GS1A 4JDTH 2FB4H 4J7RA 4E5XB 1AFVL 3ELAT 5F93C 3DMMB 5DD0H 3PHSA 3ULUC 4OM0H 4XMLH 2A83B 4QRUB 1MVFA 2VXQH 2D0FA 1PX3A 4K94C 3ULUD 2R0WH 3VXOB 5KTEL 4JZNA 1G7IB 3SDCB 5DRXB 3RY5A 3KPQA 4F58H 1I1AB 1R5IB 3D85D 1Q0XL 2OL3L 2W9DH 3VU2A 4GRMA 3DUUB 1FE8L 5ICZB 5KS9F 4P46A 2HH0H 5E00A 1CICD 4NT6A 4Y88A 2Y07H 4KUCD 3M8OH 1Q38A 3MYJA 2BDNL 5CSZB 1DUZB 4LHUA 3MV9D 2ARJA 3C9NA 1T1WB 2YXFA 4IIQA 4JM2F 4LCCA 4MAYC 4S10A 5C6WH 3QWOA 2BSRB 5E2JA 3I3BA 1S3KL 4NUGH 4EQ2A 1ADQL 4MQ7B 3QEGH 1MVUB 1TXKA 1GGUA 4JZOA 4HIEA 3W2DL 4WI3A 1NMAH 4JZOB 5DJCB 1NQBA 1OSZB 4OFVA 5SWZD 3AB0C 4HHAB 4ZAKA 4QHMA 5J11C 3RDTB 2R15A 1A0QH 4NWTH 1NFDB 5IEKB 2R2EB 1DE4B 1G0YR 1RJYA 2VAAB 2Y6SD 4TVSa 1KN4L 4E0RB 1M71A 4M8QA 1JYXA 3CFDB 2EZ0D 1HE7A 3H9ZA 4R6UA 1ZHNB 3HZYA 3V0AC 1NMBL 2R29L 2VLKB 2PF6A 2Z8WC 4ZYKB 1A3QA 4KZDL 4QOKE 5A2JH 1ED3A 1G9ML 1YPZB 3DUUA 2Q8AH 4GRMB 1IM3A 4P5KB 3P11H 5C0AA 3MGTA 3S35X 5I17A 2LV4A 4FN0A 3DXAD 4ODVL 1LD9B 1UWGH 4BQ8A 4MNGA 2A74B 2ZSVB 5D7JC 2H9GB 2XZQH 4LSRL 3DIFB 1TETH 4OM1L 3B8YA 3WLWC 4BQBA 2Q3ZA 5FO8B 3CZJA 5KG9B 4NUGL 4CVWA 5I74B 3DRTA 3BPOC 2R1WA 4IMLA 1OGTA 4GS7B 4NHUA 4HIIA 1ZANL 3D2UA 1OVZA 4IDJH 3AREC 4K8RC 4TUOB 3AS0A 2OP4H 4M1GL 3VDCA 3OX8B 3WJJC 5D1XC 4IRJA 4HUWB 1HK6A 1JGVH 4Y4KA 4UT6H 5HHNB 5BV7B 2P47B 2JK5A 2Z35A 1JHTB 3LQAC 1MWAB 3MBEB 1MCEA 2YR3A 5T1DL 3BZ4A 4MA1B 1D6EA 4KK6C 4PTUB 2XWJB 3RTQD 2EKSA 3WIFA 3ZE2E 3DETD 3QXUA 5D7JD 4LLVA 5DSCA 1T2QL 4F7PA 3S4SA 2J88L 1AHWA 3L95B 5K93A 5I71C 2KUTA 1CFTB 5TE4H 1W72L 2MTPA 3UBXB 1NC4B 4HX1A 3HPLB 3RU8H 3VFWA 5JW3L 2FX8L 1KLUA 3H0TA 3L3GB 3V79C 3UTSE 1V5JA 3MRJA 3P4MB 2X9WA 3ARFB 4WFFE 4R3SB 5GJSL 4JFQA 2C9AA 3ZE1E 4P59H 1ZTXL 5HI5D 1NDGA 4U1KA 3PP3H 3S34L 2XWBA 5IQ9B 1Q0XH 2OL3H 1S5HA 2W9DL 1DVFA 2E5EA 3QO1A 3UTZA 5SWZE 2H2SD 2ZCLL 3V5DA 3BIKB 4HS3B 3KLDA 2HJFA 5C09E 5IP4A 4FQIH 1HHKB 3HMXH 9CGTA 3WUWG 5C0FB 3TCLA 3P73B 3C60D 1N64L 4X5WB 1I3UA 3NZ8B 5JZ7C 4U1SB 4P5MB 1N8ZA 4G6JL 1UZ8B 3B5GA 2KQNA 4B5EA 3TH3T 1FZKB 1BIHA 5BOPA 3HI5L 5C0CA 1ADQH 2DB8A 5CEYB 3RRQA 1S7VA 5IBUG 2A0LC 3QDAA 4FFVC 4U6XA 2IBGA 1TJHL 4HF5L 3DBXB 3IETB 1BLNA 4XZUB 1U95A 4DCQA 1I3GL 2ITCA 2EDFA 1JUFA 1KB5A 4NQEE 3OR6A 1F5WA 4MJ5A 5AD0B 3MOBH 1XGPB 4LVEA 4G5ZL 3HC0B 3G6AA 2IALA 3OKMA 3MODH 5D9SB 1NGXA 2OXGA 2O5XL 3BT2L 1GGBH 4X4XB 4N0FB 1JGVL 2XRAL 2WLZA 3WNOA 1EAPA 3CX5J 4Q9QL 4LLWB 1NCDL 3TIDB 1I9IH 4APQC 2IADA 3L7EB 3W82A 3FHAA 3HG1E 4NQEA 1GZQB 2UV3A 4PRIE 4OM1H 1K8DA 2K7QA 2V17H 2BZDA 3LZFH 5IROC 2D03H 4RFEA 4TSBH 1YNKL 4MNQA 2UY6A 3E3QE 5DVOA 5JIKA 1U3HD 3U4BH 1FG2B 2RIKA 1X5ZA 1KIPA 5IFHH 5FYLD 4UTBH 4YHNA 5JLZA 3O4LE 5T3ZE 1P84K 4OI9A 1HXYB 1YYLL 4U1NB 5DO2D 4F57L 2IMNA 5FYJH 4NQVB 5CJXC 4ISVB 1KN4H 1DBJL 5D7LA 3UZQA 5ISZA 2IPUG 1BQSA 4J3XA 1RUML 4WHTA 3L6FB 3RWJA 1TJIL 1D5MB 3MRIA 4HDIB 1U8HA 1WFTA 1IAKA 2VTFA 4M8VA 4NYLB 1LDPL 4MDJA 2ZUWA 4WGWB 3KPSE 5GHWL 2ZUTA 4Q58C 3REWB 3D3VD 3MLPA 3RX8A 1NCTA 1HOCB 5IBTH 1LE5A 2WP3T 2F53E 2FSEB 3O9WC 2IADB 3L7EA 1D6VH 4LEXH 4WO4A 1MCKA 1XGUA 3QIBC 4UNTA 2R4SL 2NTSP 2XFXA 3VFOB 4Y2DD 2K3TA 3RWEA 2I9TA 4RAHA 3THML 4Z0XA 4ZPTB 2ADJB 3MJGX 2Y25A 4N0FA 1ZLUK 3QNYB 2WAHA 1NGXB 2YUZA 3ZSTA 3K4DA 4Y8AA 5KVMC 2H6PA 1MRDH 1QKZL 1CYGA 3HC0A 5CMAB 4EXPX 1JGEB 1GGCH 1WCBA 1YEJL 2C26A 1KB5B 1WTLA 1TZIA 4J4PD 4TUJA 4RNRA 3CXDL 3MRNB 3RWIA 4FQLL 4NRXB 1WUNT 2DLFH 2QKIB 4CNIB 4A6YB 4PB9L 3TVMD 3MPCA 3VXTA 2APXA 4QLRA 2B0SL 2BC4A 3NCYP 3ZDZF 1DEDA 3GGWA 3MNVA 3HS0B 3BISA 4POYA 4EN3C 3BN9D 4D0BB 3FQRB 1T2QH 4JFFA 5KSAA 2C3XA 1K8IB 3KVQA 5F21B 5F3BB 4GKOA 4XCEB 2GT9B 4HS3A 3BIKA 3LEYL 3RGVB 4MZ3A 4WI6A 3KLAA 4L4JA 1J1PL 2XWBB 5IQ9A 3AU1B 5D4QA 3L3IA 3OB8A 4OGZA 1I3RA 1T5WA 1N4XH 1H15B 5KSBB 5C0BE 2G60L 4KTEL 1FFPA 3WDIA 4OCXL 3W5MA 2A73A 2X4SB 1DEEA 3L3HB 4K94L 4P49A 1ZHKA 4WTWA 3MV01 3PWLA 5BS0D 5D70H 4H88H 3GSNB 3UBXA 4QRRA 1M7DB 2IF7A 2MCG1 4R90L 3OHXB 2NXYD 1AHWB 2R23B 4MA3B 1NLDH 3S36X 5GHWH 1P9MC 1U6AH 4JN2B 2DBJA 2P5EB 5KSUA 3FO2A 4WRLA 2Q7NA 3KLHD 1PY9A 5HXMA 4W68A 3GMRB 2YUXA 4H1LB 1WZLA 1WEJH 3BZ4B 4P2OB 3TFKD 3V6OE 1GSMA 3BO8B 4YX2H 3TLRA 3V7AE 1MY7A 1JPFA 1KJ2B 4XVJL 3G5XB 1A6UL 4XT1C 1PG7X 1A1NA 5HVHC 2CR3A 4I48B 2XXCB 1DN2A 2VLRA 4D8PA 5EWIL 3QCVH 5IF0B 5J12C 1YEDB 2YD8A 5HGBA 5HYIA 3D69A 1XF4B 5IB1B 2R2CA 3IVKB 1AGFB 2VDNL 3RDTC 4ZXBC 1MPAL 4JY6B 4P3WA 5ILTL 3U0TB 3IFPA 2DLFL 1UXSB 1WIUA 3SDAB 4M7JL 3IDJB 4XC3L 2IEPA 3CPLB 2BOBB 3WN5B 2IQAB 2ZG3A 1CK0H 1BEYL 3OZ9H 4MLSA 3QIWD 4PV8B 3ARYA 4P5KA 3X14B 1PYWA 3TIEB 3OKLB 1DBML 3P4OA 2IFFH 1IZKA 1BF2A 1T22B 4IDLA 4N1HB 5EO0A 2WBJB 3C6LC 1KOAA 2YHGA 4ODUA 3QHFH 4XPTL 5C07A 3N06B 1ZLSL 4Y8DC 5I15H 5ISZE 3OKOA 1CE1H 3W11C 1B0RB 1IQDA 3WFCH 5E9DA 5IK3B 3AS1A 5ESVB 1Y0LA 5F89B 3ZT6A 1OSZA 2AEWA 4Q2ZA 1CGTA 1X5AA 3BPLC 2P7TA 3FMGL 2NYYC 5EOQH 3VFRB 1BZ9B 4Z0BL 2Q8BH 5CLWA 5C0NC 1NCAL 2EC9T 5F71A 5AWNH 4WFGE 1HH6A 1O5DT 3C9NB 2VQTA 1T5XB 3VXRE 2CMRL 3KPTA 2XKUA 4KXZH 5E2VH 3R1GL 3SDYL 2HTLD 1FORL 1OP5H 3HG1A 4IM8A 3VCLA 2EZ0C 2E7LC 1CGXA 1A4JB 4KK5C 1W2KT 2VAJA 3MACH 4AT6B 1CBVL 3QJFA 2XNAB 1KGCD 3ROOB 1IGFL 2Z31B 3V0WL 3CXHJ 4AEHL 5DLML 2EIEA 5DRXA 3O6FC 4CW1A 1QPXA 1VFUA 3ALWA 3F12A 4Y5XB 5B4MD 1I7ZA 4FQ1H 1TJGL 3NCYS 4OCSH 4YXKL 5CCKL 5DVLA 4MB3A 3TEUA 3DMMA 3GIZL 4OZHB 1QFHA 4YHPA 3E8UH 4V1DA 5J3HD 5L0QB 5ESQB 3CLEH 3TFKC 2Z31A 2X1XR 4EZMA 3SJVA 4JO2L 3OXSB 2A9ML 3PGDA 1I9EA 2EDHA 5ENWA 4G6KH 3WSQH 4MNQE 3BQUA 3NIGF 1NCWH 1JBJA 3DVIA 4O5LH 3PV7A 4OBRA 3M1BA 3V5HA 3QFDB 1OHQA 2ADFH 2DKMA 1BOGB 3OJDA 1BJ8A 5C8JA 3IDNA 4OGAD 3QNZA 1K3ZA 2VL5A 5GS1C 3MLWH 3UTTA 1Q9OB 3L1OH 4GBXD 2AK4D 1ZT4A 4R26L 3U46A 4IS6B 1WBXB 2AJUH 5F1IB 3EYFB 4JRXD 1U8QA 5DK2B 4O2CB 4OKDA 4WY7L 5I9QC 1CS6A 1P7KB 4YXHL 2BNQD 5FGSA 1UWGL 3TPUB 1F00I 3BGMB 3W9EB 4NM8H 1NUDA 2JCCF 1SBSL 1MJ8L 3M07A 1BZQK 2AXHA 4JVUA 4XHJD 2G60H 4GW4B 4X7CC 5DRZA 2JB6B 2A6KB 3WS6C 1N59B 4MXQC 1EH9A 4PGDB 1P6FA 2EC8A 1KIRA 3L3JB 5D70L 3ZDXF 5DQJB 1G7HA 3LKRA 4RISH 3RVXD 4F7MB 3X3FH 2UUDH 3MV8A 4K7FA 1ZK9A 1LHZA 3RA7H 1L4IA 1NCWL 2BOBA 3CPLA 1QLEL 2EE6A 4K8RD 3LQMA 3EFFB 4PG2A 5TE7H 2DLHA 3U0TA 4AEFA 4F7EB 3FCTA 3B6SB 2QTEA 3VXUB 1NGPH 4HIXH 5EA0L 3RNQA 5MERB 2BRRH 4FNLL 1KEML 4NFDA 1AGFA 1GPOH 2OJEA 1KFAL 4NQCE 4TTGA 5MEND 1MIEH 3HE7D 3QNXA 4XPTH 1G7JA 3PWPA 2MNUA 4ONGL 5IESL 2HTLC 2BSSA 1A1NB 3T65B 4JHBA 1QFUL 5EBGA 5GJTH 5E5MA 4WU7A 5GGTL 3RTQB 4JCMA 4LSVH 4P4RB 3TO4C 4NSKA 4UMGA 3B2VH 5BXFB 1HSBA 1M7IB 5IKCB 1QR1A 1IC7L 3AY4C 1CLZL 2LQRA 5E1HB 4QXTB 4TVPL 1JTTA 4UIMB 5I71B 5CBAB 1ZLVH 4ZD3H 1JN6B 3BIBX 1OGAD 3V8CA 3C8KB 2XWTA 2VZ1A 2OJZL 3TVMC 3ME0A 2QV2A 3W11D 3DROA 5IBUB 3GI8H 1U58A 2MHAB 3UYOD 2DWEB 2HN7A 4BH8A 3BE1L 1AR2A 1SY6L 3FB6B 2VLJB 5LWYL 2WIIA 5JXAL 1RJLB 4GXUN 2CIKB 3G08B 1DL7L 4X6CB 5FECA 5BRZE 1BFOB 1VEPA 3LDBB 3Q3GA 4L8BB 4EUPB 5CIPH 3JBG7 1NFIA 1WAAF 3SCMC 2A6IA 2F53D 3LIZL 1YEFH 2X9YA 3V2AR 4CAGA 5FXCH 2DQDL 5C0EB 2DQHH 5KJRL 4OZ4A 3NCMA 3WLBB 2VIRB 3QHZL 5JUEL 4WO4D 1YY8B 3K4ZA 2I07A 3D39A 3LOWA 2Z92A 3VGHA 4JFFB 2ICWI 4M9OA 5CJQH 1OAQL 5T1MB 5I8CA 3HS0A 4XWGL 1XR8B 1HQRB 2QBWA 4G7VL 1RUAL 4MNGE 5CIPA 3VMOA 4KKLD 3KPPA 2EEBA 4PJAB 1T1YB 4F7CB 4L8CA 1M05A 5CEZL 4JJHA 1JRHL 2XA8L 3MLVH 3F7QA 1UM5L 5FYKE 3UJTH 1JE6A 3L9RB 5GS0D 1JNLL 4M7LT 4CVZB 3MRNA 1AD9A 3NGBC 2VKXA 3MRGB 5DUPH 2J8UE 3IDMB 3UEZA 5CZKA 4FFZL 3BX7C 2F8OA 4QTIH 2BY2A 3TJEH 4LU5L 5CAYB 3NCJL 2F53B 3DJ9A 4Z7WB 4NQCD 1VFBB 4P5TA 3RY4A 3ZHLA 2AXFB 4OCYL 4HUVA 1NBYB 2XFXB 2IBZX 3UTSB 5JZ7D 3UMTA 4MDIA 5F7DA 1BF8A 1R5VB 2OI9B 4U1JB 1J87A 5F1OB 5J1SC 5CJXA 4IHOA 1XH3B 1CTOA 1XFPA 4Q9CA 4Q6IB 5HYSG 1ZMYA 1IC4H 1ZA6A 4XH2B 4Q0XL 4CUCA 5HPOA 3MXVH 1S3KH 3O3DA 1B4JL 2Y9RT 4DN4H 2VZUA 1B2WH 3GK8L 3SQBA 5GISL 4KDWA 4ERSL 4U6HB 5EZIL 3B8SA 2RQ8A 4WY7H 3RNKB 3CMOL 1A7OL 4M5ZL 1UEYA 2FECL 1T1YA 3Q6GL 3O6LH 3OSKA 5E99L 3U0PB 4F7CA 3KNBA 4IRSA 1DDHB 4BKLA 3QFJA 3PWVA 4OLZH 3U79A 3I6GB 3D3VB 1TZGH 4JPIB 2V2TB 2Z92B 5CP7B 4HZLB 5BRZD 3FQWB 3DHMA 2YPLB 4TVPH 2B7DT 1E6OH 3X11B 1ZGLA 3QI9B 4LVOC 3SCMD 3WLBA 4FFWD 2FBJL 5EIIA 4ACPA 2EYSA 3LS5L 3O2VH 1PD6A 4PJIE 1H8NA 1QSEA 3BKML 3KS0H 1NDMA 3QHTC 4LIQE 2H32A 3IDXH 2CLVA 1BWMA 1QRNA 4XRCA 5T1KA 1WBYA 3Q3GB 4L8BA 1T2XA 1PX4A 5DMKB 4J4PC 5I0ZA 2B20A 2BSED 1IC4L 1RZFH 3U2SB 5KSBF 3CCHB 3ZTNH 5BQ7A 2YPLA 2E6PA 4Z18A 1S9XB 1U2CA 5H37H 3BW9B 5GGRB 1U58B 2MHAA 5AZEL 2KKQA 3TNMB 2X4OA 4JPIA 4UNVA 4I1NB 3HE7A 3DURA 4MWFB 2HYMA 3QFJB 4OV5A 2ZG1A 4R4BB 3H3PL 1GZPA 1HDMA 4HXBL 1SVCP 4QTIL 3RVUC 1A3RL 3RPKA 3MCKA 4U6HA 1LDSA 4OSUH 5LAXA 1LWRA 1EVUA 1M7IA 1QR1B 5BXFA 3SGKA 1U3JA 3VA6A 3O3DB 4OTXH 5CEYA 1QLFB 1PQZA 1W8OA 5F1NA 4YZFE 5E70A 1JYVA 3N1FC 4KUZL 3V4UL 2ICCA 1N4XL 1KTDB 5J13C 4MVBD 4CU7A 5C9KA 3F65A 1G7JB 4KTDH 2LTQB 1LEGA 4IMKC 3MRFA 4U1JA 3QWRD 2VXTL 4AEIH 3ARTA 3Q2CA 3HNTL 5IM7A 4CU6A 3V5DB 5E2TL 4OZGB 2AJ3B 1ZHBB 1V7ML 4HD9A 4ZTOH 5DMIH 1WIOA 3QUXA 3KYKL 1R3JA 2IH3A 3CX5K 2Y6SC 5TDOB 4JPKL 5I1LA 5I8EB 5BW7C 4ALAH 1Q0YL 3DVGA 4PJ9A 4WTZG 3Q1SL 5DJZA 3V5KA 5ADPL 3MV8B 4K7FB 5BV7L 5MI0C 3AFLA 4LLYA 3IDMA 1IEHA 5KW9H 3SPVA 3LY6A 3L3JA 4PLOB 5FKPA 5FGBC 1C16B 4BQCA 2XN9E 3OKEA 4LCWD 4M93B 1ITBB 1GIGH 3IJYB 4G8EB 4HXAH 4QYOA 4F7PB 4HG4J 5IMKB 3FTGA 2H41A 4M1CC 5J6HA 1A3LL 3V0VB 3GMMB 4LSRH 5HY9B 1XIWD 5C08E 3CDFA 4CU8A 1XF2A 3Q0HA 4H5SA 2F19L 4QHNA 3EDEA 5F7EH 3MGOB 2GK0B 2WLYA 3MXVL 4Z7WE 3R8QA 3S98A 5DD1L 2ATKB 2YWYA 5F1IA 2F54B 1OLZA 5CD3B 1FBIL 2BFVL 2JCCA 1WIPA 4BM7A 4RX4A 1NFDE 5AG8A 3QNZB 1B6UA 4DVRL 4PJBA 4YHZL 4L5FH 5EBLB 4NKIL 2DRUA 4FFZH 5EUOB 3QFDA 3JUZA 4PRIB 2AGJL 1FIEA 4NHUB 1N6QH 1ND0B 1A14L 1FAIL 4NZUL 3I6KB 3QDHA 5CILH 4X6CA 3UC0H 1FL6A 1QFWI 3H9SD 5HHOA 3QIWB 1FV1A 1MI5A 4BZ2L 2DLTA 3QG7L 4BH8B 4MD5B 4R0LA 1YNLL 5F8RC 4AYFA 2YN5A 3PDOA 4LCWB 4YHPB 1MCNA 3RPIB 2W0FB 4PJXB 2R0LH 2EDDA 3MLSL 1LD9A 2FYYB 1Q94B 4PGEB 3QIBA 1EO5A 4HLJA 4P0DA 4XNMA 4M6ML 5DS8B 1F2XK 2XWTB 4K2UH 2HRLA 1MHCB 2V7NA 5FA4B 1YEKH 1QBMH 4ODXB 1D5ZA 3VFNA 4QXTA 5H2BB 4DQOL 3LS4L 2WWMC 3GEWB 3BDYH 1MLCA 1TVHA 1ZVHA 5GJSH 3R0NA 3HR5A 5DUML 2XOTA 1I1YB 3QQNA 1U8KA 2QLVB 1A0QL 4NWTL 3RDTA 3VXSE 3QZWG 1X4ZA 4KJPD 3RVVD 4GRWF 1I9RH 3BPNC 3AXLA 3MRLB 4R4ND 3EHBD 2P7TB 4LPXA 3O8XA 1MREH 4LPCA 1BVKB 5IK3A 3D5OF 5EH1A 3MOQA 4OCSL 3AGVA 4GRWB 5HYFA 3C6SA 2Z31D 5C07B 1INDH 1IT9H 4NKDA 4W4OA 3M8OL 3MNWA 1DQDH 1TITA 1DLFH 1Z5LA 3BOVA 1S8DA 4RIRB 3LKRB 3SDXF 5ERWB 1MCBA 3UTQB 5GRJL 1PYWB 3F6LA 1YYLH 1G7IA 3SDCA 3ZTNL 1RK0A 5GGSB 3SKOA 5H8DA 2IANE 1F42A 3HRZA 3H9HA 1MFCH 3W39A 4GFTB 3U6RB 1IARB 3SDAA 3C6SB 1S5IH 4GG6A 3GMOA 2ZKHH 3TPUA 2QHLA 1FZMB 3RFZC 3RAJL 1ZGLM 1MRCH 1NAML 1RZ7L 5EC2A 4JB9H 4JHWL 4O2CA 1OTUD 3IFNH 3EJZC 3W9DB 2X4NB 1BZ7A 1RZGB 4I0PA 3RL2A 3ARDD 5DJYA 3D69B 5DTFA 4ZDHA 2FEEL 1NCDH 4LOUC 4UUJB 3RWFB 5CBEA 2FO1A 4OLEA 3LN9A 2DKSA 3TN0C 3RTQC 1KJ3H 3MO1B 4M1DL 3OJDB 1QBBA 5IMOA 2IAMD 4K3GA 3MV8E 5ID1B 3FB7A 4NPYA 4U05A 2NCMA 2IPKA 2HJLA 3QDJE 4OD2B 4P2OA 4NNXB 3R06A 3QB7C 4G6MH 3C08H 4M3KB 3VWJC 1C08B 5FA4A 1AGBB 4F7TB 3RA7L 2CDFA 4E9LA 1FYTB 5ESQA 4OIAA 3ULSB 1FNAA 3F7YB 1JF5A 25C8L 4JN2A 4PPTA 4PG2C 1SJEA 3OF6D 5ACMA 4X6FA 4K8RL 2AEPH 1BBDL 2BVOA 1NBVH 1M7DA 3MMEB 3OL2A 3QIUA 3RHWF 5GGUB 1W0VA 3U0WL 3RWGB 5E56A 3QIWA 4KROD 1A4JA 2ZUQC 4LRIC 3ULVD 1V3LA 5DWUH 4D9RD 1FFPB 4IEFB 3AM8C 1AGCB 1BWWA 5C0DA 1VFMA 3VRJA 1I7TB 1VGKB 3VXMA 3NFPB 1P4LA 4XNXH 1I3RB 2V2WA 5EUOA 1B4RA 4JKPH 1CGWA 2IGFL 4H26A 1MRFH 4YBQD 3RY6A 2XQYK 3NABH 3EO0A 3EZ8A 2Y72A 4JCLA 4MJ4A 3RGVA 4N68A 5EO9A 4FG6C 1WEJL 1DQDL 1XEDA 2F54A 2OZ4L 1CXHA 2X4RB 5FUOH 4YX2L 2PYED 4OZFG 4P48A 5ESVA 1OP5K 1LK3H 4GKNA 1MHPL 1S7RA 2HKFH 4QHNB 5J4MA 5TH2B 5EU6D 4AL8H 4MCYA 5FDYA 5I76A 3BQUD 3O3BB 1P2CA 4K3DL 1CFSB 5DEFA 1OQOA 3LD8C 4ZFGL 4UV4H 1S9WA 2HT4D 3CVHB 2AI0L 5DZOA 1DQML 3HA0A 2HT4C 3VXQB 2ZKHL 1F2QA 3OJ2C 4XGZB 1MWAL 1IGJB 5GGVL 5GQBA 3OQ3B 4C56D 2GJ6A 3B3IB 3MLRH 3D18A 4PV8A 3FO1A 1RUMH 4L1HA 1ZV5A 1FZOA 3P4LA 2DAVA 4ZNEE 3CUPB 1DQTA 3UX9B 5D7JA 3MCG1 4LVOB 4IOSD 1A6VH 1OAXH 4MLIA 3SKJH 5HI4C 2EDYA 1A22B 2O5ZL 1KC5L 5E6ID 3RWEB 1AO7E 1RULL 3OGOE 1XGUB 4HT1L 4WO4B 2A77L 3JTSA 1TJHH 4HF5H 2W38A 3L3DB 4RGMB 1ITCA 3O0RL 2NTFB 2P24B 4Y4FA 5BS0E 2PYEB 3TO4A 1MUJA 3QHFL 1W8NA 3LPGA 1B0WA 4JPWH 1RZJL 1DSFH 3NPSC 1I9RL 4PJFB 3K0WA 3TBTB 2PCPA 5EOTB 5JQ6H 2ITDB 1ORQA 2F5AL 1U8HB 4HDIA 1NCCH 2R9HC 3VWKB 5E08H 5KVEL 1GGBL 2XQYG 4PJGA 5BVPH 4ZO8A 3LSOA 3VFPB 1LO5B 3JSSA 5KOVC 3FO2B 4M6OH 3STZA 3J8F7 4ZSOA 4LBEB 1L7IH 3VFVA 5F6IB 5T3XE 5IVXE 5EU5B 3QCTL 4F33B 2W07A 3C2AL 5DHVH 1YN6A 1FORH 2BOCA 2EXWD 1FG2A 1FDLH 2R4SH 4NOBA 3X17A 4QT5B 1U8NB 3MLYL 1HHJB 2Z8VC 3U2SA 4YBHA 4MNQB 5DEZA 4RFEB 4KI5D 1S7WA 5I15L 5KVGH 5KVDL 1DEEB 3L3HA 2A73B 3E6FA 1O7SA 1RULH 4R97C 4RWYL 3TN0D 1WLHA 2N56A 3MYZA 1UC6A 1H15A 2UY7A 3S3SA 1KYOJ 1KPVA 3DWTA 2XZZA 1CDHA 4FQQB 1CF8H 4FXLA 1JPTL 4TPRL 4PY7A 1MH5B 2XACC 1X9QA 3EJYC 3V6BR 5SWZA 4Y19E 3RQ3A 1D9KB 4HZLA 1JGUH 3TT1H 2P42B 5IFAL 4M7JH 2YUWA 1J86A 3VG0L 4PUBH 1D5XB 5C1MB 3MNVB 4M93C 1Z0MA 4V2CB 5J57B 5E8DL 1CDUA 3QULA 4O51B 2DLEA 3B9AA 5D96C 3D9AH 2NY6B 5DJ8B 5AYUH 4U6XB 4QRPA 1X5JA 4I3RH 3KYMA 3C5SB 3IYLW 4YDLB 5BRZB 1UZ8A 2NY5L 3O6KH 1QFOA 5F3HA 2C4FU 5ANMB 1N7ML 5MHSE 2R1XB 1A47A 1SBSH 1UKSA 4U1MA 4WCYH 5IHZB 1MI5D 1AO7D 1TJIH 2VLMD 1UCBH 5EO1A 4O9HH 4XXCA 5D1ZB 2B4CH 5T5FL 4OCXH 2H8PA 3VG9C 3V4PH 1A2YB 2IC2A 3D39E 5I1JL 5GGVH 4PY7B 4ZXBD 3OAYK 1T21A 2VQ1B 3EHBC 4BH7A 1F3DH 1YMHB 4OLXL 1CL7I 4JG0H 3EZJB 3BVNB 1BGXL 4XCCL 5CJ5A 2VLKD 1F13A 2ADIA 1RFDH 5JORA 1D5IL 2OTWA 4WUKH 1YNKH 3MR9A 1FO0L 2CK2A 5B3NA 4JKWA 4LGPB 1IGFH 2YOCA 4FQJH 1OD7A 1YN6B 3P0VH 1FLRL 4KI1A 4LSSL 1TJGH 4KUZH 4YXKH 3LKSA 4JANB 3STZB 3SO3B 5HHPA 4XBPB 1A7QH 4IOFD 1SMOA 3O3EA 4H20H 1MCOL 1E28B 4UQ2B 2L0DA 2X4PA 5B38A 2PW2B 4JG1H 5L2KE 5DJ6B 1N0XL 5FUZL 3GKWL 3BUYB 4JY4B 3P30H 1IGTA 1H5BB 4DTGH 3OB0K 1AO7B 3CVIL 3FFDB 3HCVA 4KK8C 3PWUB 4Y4KB 1P9MA 3O45A 4OZ4B 3B2UC 2NY2D 2WWKO 5IWLA 3JV6A 2VXQL 4Y16B 3FT4A 4R9HA 4FA8A 1JWSA 5B3JE 5EUOE 4JRYE 4RMSA 4OT1L 4BSWB 5EU3B 1MSPA 1TQBB 3I02B 3PP4L 1Q72H 1JNNL 2GAZA 1C5DA 2Z8SA 5HJ3A 5KG9A 3I84A 4OLWL 4CMMA 1DQJA 3OKMB 1Z9LA 1TIUA 5D7JB 5IIEB 1EJ6A 3ULVE 1G9NL 1KB5L 2Q7YB 5IJVB 1IC5L 1I1RA 3FO1B 1E4XH 1F4WH 4MA8L 3MGTB 1MNUH 1JUFB 4J3OC 5DD1H 5CBAA 5C9JA 2BVEA 1UVQA 3ARFD 1QSFE 3GJEA 1HYSD 1WVZA 1BFSA 4JRXE 4K3HA 2QADC 2VDNH 1T7YA 2CK0L 4NZJA 2LU7A 2A9NL 1CFNA 1OTSD 4MJIA 4N0YH 3WJJA 5I76B 4PGBA 1RJYB 4YQXL 2R2EA 2H2PC 2VAAA 4P9HC 2GY7B 4PV9A 5FKAB 4NKOB 1Q9LB 4ONHB 4OLYL 4JFDB 5DD0L 4PB0L 3PWPB 2UZXB 4HHAA 4HKJB 5EBWB 1WJ3A 2GTWB 1MIML 4I8DA 3HE6B 5FYJE 5HGHB 4YHYB 1WZ1L 2IAMA 1IFHL 4XB7A 4U1HB 4QHLB 2MQ0A 5IROA 4PREA 3EO0B 4FABH 4LEOB 4PRPE 4M9PA 1EXUA 3B6SA 4MJ6B 3PABA 3L1OL 2XKNA 5DRWB 1VGKA 3PV6B 1R3IL 4ELMA 5LKNA 2DI8A 5E00B 2B4CL 2EDWA 4Q9BA 1IC7H 4RGND 2DOCA 1CD9B 4G8GA 3RWGA 5ALCH 3FJTA 3FQTB 1I1AA 1R5IA 1UM6L 1A6AB 3QYCA 4G6KL 2VXUL 4ZO9A 5DFWH 3S97C 3FMGH 5DRZB 5ADOH 1DVFD 4LLVB 5DSCB 5ICYA 3QUKA 1PKQE 3BWUC 4E5XA 2DM2A 1G7QB 1P7KA 2MQCA 3FT2B 3VGAC 1FFQA 3PWPD 3MBEA 2P8LA 2ZSWA 3UJJH 2DQCH 4ZUTB 4U0RB 1UCTA 3LRHA 1EJOL 1SEBB 4BFEA 2PO6C 5I1HH 1BD2D 3B9KA 3B9KB 3WJLA 3F7VB 2YC1A 4AEEA 4ORGB 5HGDA 1JZ6A 4E41D 2PR4H 2IH1A 5C86A 1IJ9A 4OF5A 3QHZH 5DDHA 3VMNA 3KPLB 4KJYA 1AQDB 5D71L 1FN4B 4JVWA 3RU8L 3ZKXB 1L0QA 2QQKL 1IM9A 2PYFB 3N50A 1T80A 3WEXB 4MHHG 4W6XB 4LLMB 4Z0BH 3GFUA 3ARVA 3EYQD 3QDJB 2VWEE 3V6OA 3SJVB 1P7QB 2R1YA 2W60B 3U6RA 4RGNE 4OZHA 4KVNL 1J5OL 3SGJA 4KJQD 4LL9A 5C08B 3HUJF 4AK1A 3A6CL 2EE3A 1CK0L 1MCRA 1P4BL 3OKDB 4GXVH 3H9SE 4HWBH 5ERWA 1CBVH 1KPUA 5GSRA 5IVNA 4I0PD 5C2BH 2W0LA 1KCUH 1HINH 2I9LA 5IR1B 1WAAE 2EDJA 4OLZL 3ZKMD 4CN6A 3PV6A 3PGFH 3BD4A 1MFAH 1U8PA 1HCVA 4E0RA 3BKYH 3DSNA 1YUHA 4MA8H 4Y2DB 1T5XA 4LQ1A 4MXVE 5C92A 4MJ6A 2YD2A 3NFNA 5DFTA 4H20L 5IMMA 2NXZD 2UWEA 3O8XB 4YH6A 3BAEH 2OXHA 3HMWH 2IAMB 4O2EB 1CL7H 3H7BA 5DGRA 1AXTH 4RAVA 1JF1B 3CVIH 3O6FD 2GQHA 4FFYH 2C3GA 4LKXA 5E9DB 3TYFA 4UNUA 5FKAA 1CDIA 1I8KA 5JXED 2X7LB 2ARJB 2UWEE 1T0PB 5FOBA 5I30L 3ZDYE 4EDWH 1Y18B 3LRGA 3SDCC 3H9YA 3FO9A 4Z78A 3QIWC 3EYSH 3KYNA 4X4ME 5CP3H 2GTZB 1QFWL 2VUOA 2QHRL 2AP2A 1MQKH 5I6XC 1I8LA 3OKLA 5F6IC 2V9TA 3K74B 4X8JA 3G04A 2CLRB 3JTTB 5GGRY 4ZTOL 4JZNB 4X6DB 4PGEA 3MUY1 1F4HA 1LO4L 2XKSA 4TOYL 1EJOH 1T1ZB 2Q7YA 4HS8L 5JPNB 1TENA 4OGAC 2NY4D 3ZE2F 1C5BH 3LN5A 1CFQA 5D2LF 1G7MA 4M03A 1CI5A 2N1KA 1FFOA 2Q20A 1BAFH 3O2VL 4HS6B 2ADGA 1FN4A 4WW1B 2JELL 5FCSH 3IF1A 1U3HA 3QG6B 4ORGA 4POZD 5HGDB 4K3JL 5GZOC 5D2LB 4RWHA 3GSQB 4ZD3L 2W59A 3MOBL 4G5ZH 3SN6N 3GIVB 4XBEL 3WIHA 1JPFB 1KJ2A 5IB2B 4QF1B 5DD3L 1BHGA 1OY3B 1IL1A 1OT2A 1C7SA 2E8ZA 4ZUTA 2XRAH 3LD8B 2X4PB 1H8OA 2P5ED 4R4FL 4NO0D 1EHXA 3ARGB 5IESH 2A1WH 3IFOB 2ZNWA 4NQDE 1OM3L 3WL9A 2ZPKL 5DJ2A 3BJ91 1RMFH 1YZZA 4DEPC 5BW7A 4LNVA 4WEMB 3RVUD 1WZKA 3GSNH 2NY4B 3O4LA 1U0QA 4GMSL 3HMXA 3LEXB 3I2CL 4TNWF 4OTXL 4NC1E 1Q1JL 2Z8RA 3OKNA 4M02A 5EN2B 1R0AH 5FGBA 5H35B 3GUTA 3V5KB 3NFSL 5FCUL 1FO0B 3DVGB 3S36L 5A16A 3LKPA 2PN5A 3STLA 3VG9B 1A9EB 1DJSA 5EOCH 1KEGL 5D1XB 2NY5C 1Q9KB 2YN3A 4YNYB 3L3IB 4DK6A 1BPVA 4R7NA 5TE6H 1QYGL 4LSDA 3WKML 5D1ZA 5E08L 4PRHE 3IAGC 3GJFK 2HP4A 4CJ0A 4DN4L 2BSTB 3Q48A 2LABA 3RUGA 4HFWB 4S1QH 3BWAB 4H8WH 3MRQA 5I66B 4CGTA 5CUSH 2DM7A 4X6EA 3BSZH 4JFXB 4PJ9D 1U36A 4N90E 5DRNA 1QFUH 1OM3H 4MJIB 1CFNB 2P5EE 2DQUL 3T1FB 1S7QB 5IEHA 1CICC 4YIQA 5LAXB 4LP4A 2QKIA 4EN3A 1DR9A 4O51A 3EYVA 3UYPA 2OQJA 4RNRB 3WKNA 4FQXA 1MHEA 1JGEA 1UJ3C 4YR6B 2P43B 2DD8H 4G6AC 4PLJD 4ODHH 1CD0A 5BCAA 5E6IC 4QXWA 1QSEE 4K3JH 5E2UL 2NX5B 2Q3AA 3RIAF 1A5FL 1WFUA 4KGJA 4XTRC 4UT6L 5SWZB 4C54A 4C4KT 5MEPB 1B6DA 1SEQH 5F9OL 2B2XL 1NANH 1IKNA 1BBJA 4ETQA 1BQHA 3DTXB 4OQ1A 5C09B 3G6DH 5HYQB 3SGDI 1EEUA 5CHNB 3EDDA 1NLDL 1EBAA 3UYRH 5A2IH 1INEL 1KG0A 1VPOH 1CGUA 2NR6D 2IWGA 3FOLA 1NDMB 2GUOB 2X2YA 2ILLA 2WWKT 3IT8D 3UZEA 3AUVA 1ZLWH 3UC0L 1A7PL 4OFYA 3FRUA 4GAYA 4I3RL 3X12A 4X5XB 5SWSE 3IS1X 1HHHB 4OQTA 2V2TA 3QPQC 4DKFH 4NQDD 4O00A 4YE4L 4ODVH 3SY0B 4F33A 1E28A 2CDEB 4C56E 3DVFA 5IW6A 3QISA 4UDUB 4OQTH 4UDUA 43CAB 5EFIB 1BD2E 2VZVA 1S7XA 1KGCE 3MA9L 2ESVB 4ZNCD 2YD6A 1T7ZA 2W0PA 3ULUH 1V3MA 3LRSA 3U83A 4GKZA 2FJHB 4JQVC 2MOVA 2LU3A 4WW2C 3EIFA 3K2UL 5HYJE 1RZFL 2BNUB 1PZ5A 2IG2H 3CFKA 1ZWIB 3NIDE 4HK0B 5D5MF 5FGCE 1GZQA 4YHYC 4L3EA 4GBXB 4NO5A 1CDJA 1KG0B 3DGCR 3W2DH 3JTSB 5I16B 3PQYD 3UTSA 5T33H 3MBED 1Z6JT 4KH2A 5C09A 5DXWA 3C5JB 1UJTA 4Z7OE 4M4PA 4P57B 4PJBE 3S36H 3AY4A 2YXMA 1U92B 2JCCE 1RK1A 5ANMA 3QEQE 3VXSD 1S7TB 2R0ZL 1NEZA 4M5YL 4M7LH 1RQ5A 2DMBA 4FS0A 1U95B 4QRRE 1GC1L 5KS9B 2ESVD 3IDGB 1OOAA 1G6RH 1B2WL 3GK8H 3NIGE 1MPAH 5E7BA 4NNYA 3GMLA 1MFDL 4P2YA 4JLRB 4X5LA 4YEFA 3VFTB 5BZDA 4JFXA 3VFUB 5I73B 2H2PD 3A6BL 1TQCB 5GRVK 2H2SC 2C3VB 1OTUC 4OCRH 5CKGA 2C7UB 5BV7C 5E2WL 3CSYA 4JFOA 3T09A 4GAJL 4NQXB 4IDJL 1WWAX 3UTPE 4Y16C 4GRWE 3C60B 1MWAH 3BZFB 5DC9B 1FH5H 1ORSA 2F8XC 2YS4A 3P4NB 5EUOF 4YO0A 1IAOB 3HNSH 2BK8A 3QXAB 4S1DD 1AGCA 4P23D 4EBQL 4DVBA 4YAQA 1XF3B 4PIRF 5A3ID 3ARFA 2FHCA 5H94B 2CO7B 4TSCL 1OAUH 2E9BA 1I85C 1HHJA 3WFEL 3OPZL 2Z0BA 3O2WL 1OAYH 5GGUA 1SQ2N 5SX4H 4E42B 4JO1L 1T04A 1KCSL 5B39A 4AL8L 2AABL 1WC7B 3L95A 1VPOL 2VR4A 4PJ8C 1JFQH 3GSOB 3TZVA 1T89C 2MQ3A 5D2NA 3QAZC 3FOMB 3VXUE 4PJ7A 4BZ1H 4EI5A 5E2VL 1U8JA 32C2B 3ZO0A 2O5XH 2YEZA 1D6EB 3BHBA 1MFEL 4NNXA 3SE8H 5EUKB 2JJTA 3KWWB 2OL3B 3N9GL 1QLRB 2HG5B 1ORQB 3SGKC 1JHTA 1GHFH 1EFXD 2Z35B 3HFMH 4DW2L 4U7SA 4WU7B 5E5MB 4IRJB 4WWKC 3S35L 1WISA 2VDKL 4ORZC 3SCMA 2FD6H 5IV2B 2X1PA 1G84A 1CXLA 2PYEA 3TO4B 5DEGA 2F19H 2HLFD 4Z7NF 3E8UL 3ZKXC 1U3HB 1UZ6F 2R0LL 1KN2H 3FB5A 3MLSH 4AEIL 1EZVX 2RB8A 2JIXD 1A5FH 1KB9K 1NH6A 3KPSA 1L7TH 3MLUL 4ENED 2COQA 5CJ8A 1KPRB 4LLUA 4G6JH 2G75A 4X9BA 4EIZC 3LN5B 3P0YL 3P9MB 4JAMB 4L9LC 3GBMH 5L2JA 2BXZA 2H9GA 4KKAD 4XPAH 4KKCC 4ODSH 5JDJA 4LIQH 4Z7UE 2OLDA 4PJ9C 4F7MA 2J8UF 4ODTL 5C0AB 2Y06H 4OUOA 5GS0H 4GAGL 1IGJA 4PBWD 4F58L 1YPZA 1TCRB 1KENL 1S78D 5D1QD 3OXRB 1S7UB 2WINA 5JHDA 4ONOA 1WT5C 2ZZUT 3HZYB 1MEXL 3GBLA 5E4EC 3FFCD 4KMTH 4YPGB 4QRQA 4RA3A 5I18L 1HCFX 3LV3A 2W1NA 1EFXB 4GMTH 5D7KE 4HKXB 1D3CA 4PR5B 4MCYB 3V8OA 1VEOA 2IAMC 1YECL 5JNYB 4OKVB 5I1DA 1QR4A 2QQKH 2X10A 1JF1A 3WXWL 2NY3D 3O11B 5TF1H 4KJWC 5FYLL 1ZT4B 5I75B 2CDGB 5DD5L 4HPYH 3C08L 1CQKA 1CLOH 5GRJH 3SDAC 2BSRA 4K71C 5C6PB 1U8KB 4V1DE 2B1AH 3QEHA 3ZHDA 1YEJH 3M1BB 4NCC2 3V5HB 4P3DB 1BFVL 4UBDD 1MLCB 2ZP0T 2DQGL 3WFZA 1VB9A 3DYOA 5JPMB 4KC3B 5EORL 4JRXA 4LCUB 3QZWA 2HJKB 4JY5H 3OKDA 3MRCB 4WUUB 4X7SH 1REIA 2AXJA 2F58H 1JNJA 4PJXA 3SDDB 4APQB 3F7YA 4CW1B 4W81A 4PJIF 1FDLL 2W60A 2VDKH 1W72H 1UB6A 5MHSD 1YJDC 4LMQE 4U3XA 1C08A 2DWDB 1K2DA 1KTLA 3DRQB 3N0PB 4GQ9L 4OFDA 4G7YH 1FG9C 3VD3A 4JO1H 4HH8A 3OR7B 5CGYC 1XGQA 1J1PH 3LS4H 4JHAL 1F6AA 1OAQH 4CBPA 1IAIM 1ES0A 4RGMC 3BP6B 4LVNC 5CP3A 4YXLH 5I1EH 1J1XH 3TBWA 4XPGH 4BZ1L 4PJCE 5BOZG 3M17A 4OZIE 2J4WL 5BS0B 3EYSL 2CDGA 1F6LL 1NMAL 2X4UA 4ZFGH 3NZHH 2DQTL 1BZ7B 2NY1C 2D7TL 3L3KB 2HKHH 4Q2ZB 5I9QB 2FZ3A 3S3JA 1LO2L 4H0IA 3EAKA 2NY1D 5IB5A 4LFHD 3MGOA 3LEVH 5TPWH 2OX5A 5FV2A 1UWEL 1IEBB 4XCFL 2DQEH 3KLSA 3EYOB 4JKLA 2W0KA 3H9HB 2DMKA 2YUVA 4KMTL 4UINH 4QYOB 4EBQH 5C0RH 3UXFA 3NCFB 1NJ9A 3MA7A 1INQA 3N85H 4I3GA 3W0WA 1VENA 1U8MA 1YY9D 3PWJA 4DGIL 1MOEA 3DHJA 3QUZC 1NKOA 1JZ5A 4K23L 1F3RB 3MNWB 2B39A 2QQQA 4PJGE 2CUHA 3T2QA 5L2JB 4N5UA 4HW6A 2NXZC 5GZOD 4YDJA 2P8PA 5LGJA 3N1GC 2G75B 1R3JB 5I2IB 4WI7A 3QUMH 2AV1B 1JWMA 4RWYH 3V6FA 4MD0A 2J5LB 4QHLA 4RX4D 5IM7B 1FRGH 1F3JA 1NCUA 3HN3A 4WTZA 1H3XA 4PRDA 4RCAA 5FM5O 5EBWA 1PBYA 2BY0A 3QO0B 1AI1H 1QBLH 3IJSA 3MV8D 4I48A 3HMXL 5C70A 3S35H 1IGYB 4P4KD 3ARDA 2YA0A 2RAMA 1Q8MA 2DBLH 1DBMH 1U3YA 3D48R 2YPKA 3T0EB 2JLLA 2VE6A 4EOWL 2YEZB 4I9WE 3T4AA 3MQIA 2ZOKA 4PJ7B 4DGVL 5E8EB 4NZRL 4K23H 2DN7A 3U1SL 4O5LL 4MA3A 1A7RH 1Q94A 3JVGC 2FYYA 2R23A 4X9GA 2NX5E 3CFIC 2BHUA 2X4OB 3TNMA 5TQ2L 4ZTPH 3K46A 4MD5A 4R0LB 4X98B 3VMPA 3CCHA 5D1ZC 1NGQH 4CMMB 1OPGL 1K4DA 1RZJH 2YWZA 4R26H 5D1ZD 4CADA 3IU3B 5GS2D 3V6OC 1E4KA 4K3EH 4Y19A 2I25N 5EU3A 3PDDA 4DKDC 2CUMA 2PXYA 3TA3A 1EO8H 4PRID 3GBNH 2CD0A 2I27N 1J0IA 1MEXH 5ADOL 1MY5A 1XMWA 2BY3A 4NBYB 3WN5C 1KXQE 2AAVA 4O4YL 5EIIB 1MRFL 5I1CL 4EJ1C 4X4YA 3VH8B 3NIFF 2FEDD 2DI9A 2R0KH 4NQXA 2ID5A 3JZ7A 3EDKA 1H5BA 2GFBB 4KV5F 5LGHL 1LE9B 2ATKA 1WTGT 2OR8A 5HI3D 3KPRA 1GC1C 5GSVB 3U4BL 5ACZB 5KSAB 3DO7A 3P9LA 4J12A 5B38B 1EA9C 4OIBA 1GOFA 2FO4A 3D3VA 1UXWB 1U8IA 4TNVK 4YXLL 5I1EL 1YPZF 1XF2B 4MD4B 5BZDB 2VN4A 5DHVB 3U0PA 4NRZA 3CLEL 3GMQA 2XG4A 3FTGB 1N7MH 1FCCA 1XIWB 4BK4A 4D3CL 4JO2H 4M48H 3D25A 1BOYA 1E27B 4UB0L 4DUVA 5D7LD 3KJ6L 2D31A 1ZA3A 2WBWB 4XAWL 4OGYL 2G2RB 2ZJSL 3U7YL 1U93B 5F7YC 5I73C 1LO3H 1VCAA 3LDBC 3G9AB 2JKXA 3SDXA 2F54E 3IRPX 2QL1A 2FWOB 3WD5L 5FHAH 5F96H 5GRWA 3ZE1F 3GB7A 5MEQA 1UB5B 4PJCA 2VC2L 5JOEA 3O3AB 3CSBA 5IB3A 4BFIB 1DFBL 1UH4A 3CJJA 5E8OA 1KACB 1OT1A 1A7NH 1T21B 3PHQA 5FOJA 3MOAH 4J6RL 4JO4H 4KKBD 5HYSA 3T1WA 1B88A 1I8LC 1U8OB 1F4AA 2R8SH 4Z7WA 1B3JA 5KVDH 2QQNL 1HILA 5C07D 1EERB 4LARH 1LP9E 5A3IC 4G6FD 3IU4L 1XCTB 1UM4L 4NQDB 1MCHA 1U91A 3C8DA 2XY2A 3ARWA 4G8IB 2AQ3A 4FQXC 3L9RA 3T8XB 4TVPD 4WDIA 1E27A 3D25B 3L6FA 4MAYB 4U6YB 3RWJB 4GRWH 3X3FL 1E4XL 1F4WL 4NN7B 1ZLSH 3IFLH 2AXGA 2FJGA 3ARBC 1RVFL 4S1SL 2YBRA 5BVPL 1H3UA 4Q74A 5D6CA 4JR9H 4EN3D 3LHPH 3VXUD 1R3LB 1UXWA 3WCYA 1MJ7L 2UVEA 3RVWC 1A14H 4GG8A 2IPUK 4IOIB 4ELKB 1SM3H 3T0WA 1RZKH 5J11B 1V7NH 1S9XA 2V2XA 1N6UA 4ZO7A 1N2RB 1FE8H 4X99B 5AWNL 4DFHA 2B8OT 1XCQA 2GUOA 1X5YA 5JO5B 2J2ZA 3EFDL 4HKBB 2Z31C 1LMKA 4LARL 1S9VB 1SJHB 2F74A 2F74B 4EUPA 2PXYB 3TA3B 1EAPB 4MJIE 1IGML 4G6FB 3E6HA 5C07E 1XCQB 3KS0J 1S7WB 1OAZH 2GJZB 1K4DB 4MX7A 3QI9A 1VSCA 1ZGLB 5GGQH 1O0VA 1G9EA 4YHOL 2HN7B 2L4OA 4LSUH 1T3FA 3QPXL 4XNQA 2EECA 1A1OA 1JZ3A 3KJ6H 7FABH 4WFFD 2WUCL 4YR6A 4DVRH 2BVYA 4MAYD 2VDPL 2BRQA 3MUHL 4G8FB 3MRKA 15C8H 3LPFA 1HHIB 1ZT1B 3BEWA 1LO5A 3LSOB 3VFPA 3TJEL 3RVWD 2R69L 5HDQH 3IETA 3ZE0F 4EN3B 4NN5C 1MIMH 1YNTA 4G8IA 3MLZH 1IVLA 3ULVC 5CZVH 3RTQA 1YEIH 4PJFA 4D9RE 3ARDB 5DURD 1KUMA 1N8ZB 1IC1A 2BCKA 2BSSB 5HHMD 3AM8A 1OCWH 3FQXA 3IDYB 1BD2B 4DKAA 4M7ZC 2XZQL 2BSTA 4E41B 4TSCH 1JV5A 4RZCA 2NY3C 1RU9L 3HC3L 1R3HA 2CGRL 3LB6D 3RNQB 3DOSA 2AV1A 5SWSB 4DQOH 3C09C 4YNYA 1AKJA 4R7DA 4YDJB 2R9HD 3SJVD 4KKAC 5JOFA 2PETA 4Z5RB 5FYKH 2HA1A 5F44A 3SDYH 2VLRD 1AXSA 3A6OA 1OGAE 5I1KH 4HUMB 5C08D 4R96B 3B3IA 1Q72L 3PP4H 1A4KA 2QJDA 1AD9B 4ZFOA 3O4LB 1YJDL 5C0AE 3SKMB 5CINH 3VXQA 4KDVA 5DMGC 2CKBH 4HC1L 1UACL 1MCFA 2FBOJ 5DJ2B 4K7PX 5BMFL 1A9BB 5DEFB 1FVEA 3K2MC 3LS5H 3RVVC 4H8WL 3KGRA 3BKMH 2EKSB 5CIPB 3VGDA 4RRPA 5IVOA 1EEZA 3ISWA 3QIBD 4D9QD 2EDRA 4NQSB 3BD3A 3TO4D 3UDWC 3CFJA 3D39B 5FV1L 1YY8A 5IB2A 1Z3GH 2ZCHH 3MRMA 4F37K 5EO9B 1C7TA 5F7KC 2DDQH 1HEZB 3TJHD 4GQPH 1RVFH 4S1SH 5DHXB 1WBZB 3MLXL 5D2LA 1BOGA 5LXGL 4P3CL 1ES0B 4LIQL 5F7WC 3D2UB 1I85A 4LCCC 3FONB 5HSFA 4ESKA 1RZKL 3BQUB 1J5OH 4JFYA 4XP9H 4NO0A 4P5TD 3GM8A 4F3FA 3X13B 2OTUA 5ILTH 4HV8B 1WAAA 5FM5M 2AJXH 4PRPB 3VRIB 3Q6GH 3QIUB 3MMEA 1KEMH 2WUBL 5L6YH 1X5HA 2ZSVA 5D1QB 4KV5E 4NUJB 3NMEA 1SYVA 3LAFA 1FPTL 2ZG2A 4WUUA 3AS2A 4YBQC 5EZLA 3ROOA 4QRPD 2H3NB 2KH2B 4XAKE 2C4FT 5F88B 5M7QA 1A7PH 3RKDC 3R06B 4JFZH 7FABL 4NSKB 3BPLB 3TYGH 3GZKA 3SGJC 3IFLL 1WK0A 2OI9C 5HYEA 2XV6B 4RMWA 3TYFB 2DI7A 4DFIA 5KN5B 1A02N 1BP3B 1A6TB 4XCNA 3QNXB 1T20B 1LK2B 5C6TL 5FUCE 5ID0B 3UTTD 2DQCL 3BT2H 3DX8B 3ILPB 4MQ7A 4AMKH 4Z7VA 4MD0B 4W4NA 5EC2B 4OKVA 5JNYA 1CVSC 3QWOB 1RUAH 3FCTB 1T1WA 4IIQB 4PJ8D 5IHLB 4Y2DA 1GOGA 1RAMA 1K6QL 2CRMA 1N3NB 2Z9TA 1SYSA 1CFBA 1XF5A 4HLZH 3DGGB 3A0OA 3MJ9A 3H3PH 4KPHL 4WU5B 1H3TA 5C0GB 4HS8H 2VXSH 1DQLH 3WIHL 5EU4A 3OXRA 4NKMB 4P46B 1MJJA 3T3ME 1CCZA 1C5BL 1ZT7B 4BZYA 1KPUB 4UI2A 2AS5M 5JIHA 4NNPL 3V0WH 4AEHH 4GJTB 5E1AB 1EO7A 4PGDA 1KXTB 4L4VE 2VLLB 3P2TA 1FYTE 4GW4A 4LAQH 1JI1A 2C1OA 4U4BA 3OAUH 5ECJE 1ODAA 2GHWB 4JZJA 1P1ZA 4JAMA 1TDQA 2WV3A 3PJSB 3BGMA 4BELD 4M62H 3QDJA 1KJMB 4L3CA 3EJYD 4LVNB 2OCFD 4EQ3A 5INDB 2VDQH 3DV4B 3PNWB 1FIGH 1NGPL 1FAIH 3LN4B 2BRRL 4FNLH 3MBEC 5ID0A 3QXDA 1Y6NR 1WBXA 3U46B 4ODWA 5IFJA 1CDBA 2FIKB 2AJYL 3QRFM 1MFAL 2PO6A 2NY1B 5C8JB 2PTUA 3WMSA 4YFLI 2N4IA 4C83B 1BIIB 3WJLC 3K80A 5ESAA 4EI5C 3T0EC 3U9UA 4JFEA 4M61B 1N5AB 1HH9B 3IXAA 1PEZA 2C3WA 5I8KH 3QFJE 4CKVX 4NO3A 4M5ZH 1Z3GL 1D5ZB 4ODXA 1KCRH 1WSST 4JREB 4UAOC 3H2WA 2DICA 2IANB 1JPGB 3ZT7A 4XNMB 4J4PA 3O2DA 4M7LL 1EHLH 1YN7B 4TYUA 1NBZB 4PP2A 3RPIA 4BK5A 4KUCF 1G7LA 3EO9L 4JQIL 5B39B 4MYWB 1T66C 2AERT 2ICWA 3MV7E 3UZVB 1KNOB 4Y1AE 1MI5B 2FBJH 4EIGB 4KQ4L 4KY1H 3FHQA 4XTRD 5C6TH 1YMMB 5CWSB 4XBEH 1NAKL 2J8HA 3J7HA 5DHYB 4YGVB 2I5YL 2V6HA 1M4KA 4YAQB 3EOYG 4JPVH 4PRAB 1X5FA 4P3DA 2MSPA 2FR4A 2BNRD 3QJHB 4PRIA 5IGXH 4LLAA 1EXUB 4HIXL 5EA0H 5DMIL 1EHNA 3QEUB 1YDPB 4NN6C 3EW3B 1BZ9A 2FEDC 5F3BA 5FK9A 4FFVD 4PJ7F 3VXSA 2AJSH 1VACA 3S8WA 2VN7A 3P40A 2GK0A 1NGWB 2E9IA 4XX1G 5EC1A 5K9OB 1VEMA 3V0VA 1A3RH 1CXIA 2ZUSA 3KPNB 4GW5B 4JLRA 3EOBB 1FGVH 1FVEB 3QA3A 4XVUD 1P4IL 1GH7A 1HI6A 4H25A 4A6YA 5HTSA 1PFCA 4G8EA 1KN2L 4OFPA 5HYJB 2D3VA 1T22A 3K1DA 3KPOA 4LSPH 3NIDF 1I1FB 1NGZB 5FKPB 1A4KB 2QADD 3X14A 3W5NA 3UBXI 3T77B 1QYGH 1EPFA 3ULUL 1WCBB 4ZFFB 1JWUA 4JPVL 3WN5A 1BGXH 4XCCH 2R2BB 3RWCA 5IIEA 1VADA 2Q86A 2ERJC 3QDGE 2HMIC 4R7DB 5F97E 4LLUB 2ADJA 4YK4B 1WF5A 1ZS8B 1IQWH 5SWSA 5T1LB 3GHEH 3R8BB 3TV3H 1AE6H 3KPSB 2YSSB 3IXTB 4NRYB 1WWBX 1R0AL 3KPRD 4KGLA 4F9LC 1JV5B 4RZCB 5HGBB 5IVXF 4U3CA 1ZGLP 2MJWA 3JV6B 3DPBA 4WEBH 2FSEA 5I18H 5HHQB 3NPSB 3CFCL 4PJAE 4XP5L 2F8VA 4EUPH 3C6LB 4DZ8B 3ARSA 3D85A 3VJ6B 1F11B 3QXWA 1EV2E 5EBMA 1IAKB 3H6JA 2NQCA 3MJ9L 1TTFA 1M7XA 4NYLA 2H26B 5AAMA 5B39G 2O61B 3BP5A 4O2FB 4U1LA 4UQ2A 5JW4R 4MXWH 4ZOEA 5D7LB 1RJZA 1QFPA 4KQ4H 1TNMA 5EFIA 5ALBL 3FOMA 3O6LL 5E99H 4ZUUA 1DFBH 3HE6C 1W0YT 4YPJA 4XNXL 1G6RL 3QDMD 4ODBD 1RMFL 2QSTA 3REVA 1A1OB 5TF0A 3PWPE 4PLKC 5I1IL 3MR9B 3F8UB 4DZBA 4PP1D 1OWWA 1JK8B 1G6RA 1JPSL 4L4TA 3VI4F 3ZDZE 4DUXA 2ADIB 5KSBA 1T0MB 4EI5D 4HWNA 4LLWA 5D7IF 4PYGA 4XP6H 3MRHA 4U6TA 3MV7A 3BZFA 4KKLC 4MA7L 4JG1L 2AVGA 4M5YH 4ZAKD 5HVWA 1D9KC 1E6JL 4XMKH 1CG9B 3GSVA 2GT9A 3BD5A 1BQLH 3P11L 5EO1B 4UT9H 1UWXK 3N1PC 5JW4Q 3TC9A 1ZKAA 1XGTA 4G9FD 4LSPL 2R1XA 3LHPL 4ZPVA 4QHUB 4XPBH 4QCIB 5DC0A 3ARQA 1T83C 2PTTA 1AJ7H 4ZSOE 2EH7H 4HCRH 1NC2D 4Y1AA 4Y1AB 3IDIA 4G43A 3FZUD 5EIQA 4K9EC 4NRXA 2VISB 5J0BA 5JW4N 1ZA6B 1U91B 4OAWA 4FFWC 5DRNB 2UYLB 5KAQG 1S7TA 4X5WA 3TCLB 3F58L 1FGVL 1G9MC 2DQEL 4IRJD 5CMAA 4LCYB 1MAML 5DVKA 1U3HC 4MDIB 1WV7T 1KTRL 1AP2B 4MS8C 3S3PA 3FAWA 2AXFA 2NZIA 4R7NB 4HBCH 1C1EL 2VR9A 1IKNC 2F5AH 3PGCB 5B8CB 1N26A 5EU6B 1KPVB 2XZCH 1INDL 1MCPL 3HHRB 4PY8I 1QZ1A 3LKPB 3HB3D 4JPKH 3STLB 1RZ8B 1XZ0A 2A38A 4NO5B 4GBXA 2B0SH 4L3EB 3ECBB 4Y5YC 5DT1H 5H35A 1PKQA 1EEQA 3QUYA 1PZ5B 3DUHA 3I9GH 2EE2A 1G6RB 1JK8A 3T0VA 4Z76A 3LEVL 1A8JH 1MCWW 2E7HA 4YDLC 4LVHB 4BUHA 3VFVB 4XBGA 5CKAA 3FFCB 4EDXA 4U1NA 3S34H 5IW6B 3WFHB 3PQYA 35C8H 4HH9A 3D87B 3GO1H 4YHNB 5JLZB 2O93L 4MAUH 3VWKA 2RBLA 4MMXC 1CF8L 3G6JF 1JPTH 4TPRH 1LE9A 4XP6L 3TBYA 2K7PA 3INUL 5E5UB 2XT1B 3C6LA 5DFVD 4XP4H 3O6MH 1K8DB 1JGUL 3TT1L 3PL6B 4R90H 1AGEA 1ADQA 1MUJB 4TUOA 4KZEH 2E7MA 4FZEL 2CLZA 5FYLH 3ULVH 1NFIB 2VR5A 4PJ5A 1CLOL 1FFOB 5IHUH 1BQHB 1UKTA 1BBJB 1A7BA 3L5WA 1ZS8A 2UWEF 3G08A 2CIKA 3CVHH 1QACA 4XMPL 4X4XA 2W91A 2BNRA 3TO2A 3CSGA 1KFAH 1KENH 1TCMA 1I7RA 2NX5A 2DWEA 5K9JL 1VADB 1IAII 3O4LD 4NZTH 3F7PC 3ZYZA 4K8RH 3BMWA 4K7PL 1FZOB 3ARZA 4GMTL 2XXMB 5TFSH 5TDPB 1FYHB 3SKNA 3DVNA 5MENA 4FQXB 3D0LA 3N85L 3T4AB 3ZYIA 3RKDD 4KI5C 4MAUL 3MROA 2QQLH 3LKOB 5AUMB 1YEHH 5H37G 3V4VL 5E6IA 2YPKB 4OJFL 3WHE0 4P2QE 1CFSA 5CGYD 3UO1L 4Y0GA 2UZIH 1KLGB 1L9NA 4OLVL 4JJ5A 1X7QA 4P5MA 4U1SA 1UWXH 5EZOL 1GGTA 3THMH 5LCVH 4KVNH 2CO6B 5KSVA 5EPMB 4ZFZB 4YC2C 2BJMH 1M6OB 4TULL 2E27L 2OZ4H 2YKLL 2A77H 4D3CH 1FNGB 4HIEB 1F3JB 4S1RH 3U7WH 5DUBA 3HFML 3QEUA 4PJDB 4NQED 4WIQA 4QNPE 1J10A 4PJ5D 4LHUB 3QJHA 4N8PA 2FR4B 5B4MC 1U8PB 2PXYC 3TA3C 2BNQA 4PJEA 4P46C 4DJMA 1G1YA 2NY4C 4RDQF 2AKRA 5CLTA 3VRLE 4Z8FH 3OTTA 4I77H 2Y4SA 2FLRT 2ICWJ 3W0WB 1YNLH 4HX1B 3DLQR 3QUZB 5C08A 1A21A 3VFSA 4ZUWA 2AABH 1W0WA 3S4SB 1W72A 4IRSD 4PTTB 1T66D 1B0GA 1AIFA 2B5IB 3I9GL 1CWVA 2WW8A 1A64A 1BM3H 3FT3A 5GS1B 4KJWD 3MLVL 3VW3L 1I7UA 3WEXA 2HMID 1B9ZA 4KAQL 2G5BA 4P2RA 3S5LB 1H9VA 2HJLB 4OD2A 2GIYA 4YFEA 3NZHL 2W92A 2FHFA 3N9GH 2NW3B 5ANME 4TTDD 3DMMD 3UTTB 2IFFL 5D5MA 2YC1B 3M17B 3TBVB 1P5UA 5DJ0B 3FB8B 3DI2B 2FL5A 2NY0C 3FKUS 4PJFF 4P2RE 4HIHB 4WW1A 2R2HB 5D7SH 4XHJC 5DJYB 1DQQB 3G9VA 1L6ZA 1J8HE 2P8LB 2XZAH 4X7FC 2BHZA 4P2RB 3S5LA 3H7LA 3MRRA 1QQDB 4HPYL 1KJMA 3OXSA 4L3CB 4LSSH 2FJFA 3LQZB 1TVBB 4CN4A 1YC7A 1AIFB 3EOTL 4YUEL 1Q9WA 2XIDA 4IOFC 2XTJC 3W0WD 4UQ3A 5B38G 4V1DB 4DK3A 1GGYA 5ICYB 5HHXL 2HWZH 3OWEA 4R97B 1W72B 4MNGB 1W0WB 2CRZA 4FHBD 4ZUWB 3ULVL 5C0JB 1KIQB 4CJ1A 1I7ZB 2UZIL 1ZLVK 5DT1L 4OLVH 3MRCA 4M3JA 4X8JB 1NBVL 3CSPA 4LPWA 2XNAA 3C87A 4LMQI 1I8IA 3ZTJH 3KYNB 1CZ8H 4IRZL 1MI5E 2XN9B 1KJVA 3SE4A 2A6DB 1CDGA 2NY2C 3WUWA 5J9PA 1N3NA 1RUQH 3MUGB 5J7CC 1HSAB 3RUGE 1YQVL 4LKXB 1YEEH 3IJHA 1A7NL 4U6VH 1RURL 4RAVB 4HUKB 3MRLA 3O11A 2P1YA 1KYOK 2GTWA 1PDKA 1ZE3C 5F8QC 5L8LB 4GSDH 1DANU 4P2RD 2NY7H 4ETYA 4ZS6C 4HUXB 1Q9LA 1TPXC 4LCCB 4LHQB 4WUKL 1J8HD 3TWCL 1YUHB 2JJSC 4O58L 4FZEH 3CFBA 4XVUC 4D9LH 4LSTL 4PJXF 1QD0A 1JRHI 4TSAH 4HWUA 2J8OA 1XR9B 1KJVB 4PJ8A 2YPVH 2BP3A 4ZG1A 1UVQB 3GJEB 1CE6B 5C9JB 3UDWA 4JVPA 2WQRA 5GSRB 1UEMA 2V7NB 4GAFB 4XAKD 2NY5H 2CGRH 4C55A 4A2MA 3PF2A 4JZJC