1SY6A

Crystal structure of cd3gammaepsilon heterodimer in complex with okt3 fab fragment
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
204
structure length
168
Chain Sequence
MQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human T cell receptor CD3(epsilon)(gamma) heterodimer complexed to the therapeutic mAb OKT3.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/antibiotic
molecule keywords OKT3 Fab light chain
total genus 34
structure length 168
sequence length 204
ec nomenclature
pdb deposition date 2004-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1sy6A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1sy6A01
3QG6B 1AR1C 3VXQA 1ZHLA 2A9MH 2ARJA 3EO0A 4ZSOB 3S3SA 3RL1B 3PGDB 2XWBB 5CSGA 4H88H 5EU3A 4UMGA 3U83A 2XKUA 1CYGA 3D18B 4XCEB 4MS8C 1EEZA 3BW9B 1ND0B 5I66A 3BSZH 2QQLL 2DWDB 2AXJA 3TNMA 1F4YH 1FIEA 1EHNA 3EJZC 5HDLA 1HDMA 4U7MA 4F9LA 4M8QA 2HVJA 4HW6A 4P3DA 1IM3B 4YBLB 3LKOB 2DICA 2NY4B 1D3CA 1H3XA 3HI6H 5I1JL 1FFPA 3A0OA 4UINL 3QIBD 2CLRA 4FFZH 3O6KH 2I9TA 5KSVB 4D0BA 1EZVY 1EUTA 4PRBA 5DJAA 3OWEA 1AR2A 2DTMH 1RUAL 5A3ID 1UADC 1N2RB 4Z6AT 2ZUQC 3QEGH 4ZYKA 4PGJA 2UZXB 1YEJL 3ULUC 5CWSA 5I1HL 3K2MC 3VCLA 1HHIB 3UPCA 4MNQA 5C0JA 1A4JB 43C9A 3DMMC 4JG0H 5ETUA 3VI4E 2XTJE 5D6CA 5F8RC 4MQTB 5K9KB 3RY6C 1X4XA 9CGTA 4OSUH 1GGIH 5IVZB 1AGFB 2VAAA 3VMNA 1HQ4B 4RDQF 5T1LB 2FBJH 4LVNC 4N0YH 3EYVB 2EEAA 4Q7DA 4ZXBB 2WUCL 1S7UA 3G5XA 1KIPA 3BP5B 4Z7QF 2C9AA 2L7UA 3QEGL 4HIHB 4L8DA 5F72S 3E2HB 4IOIA 3U9UB 1BQHA 1RK1A 3D39E 3IKCB 4I3SH 1KGCD 5FK9B 2VQ1A 3JWOL 3QISA 1RZKH 4NQCA 4A6YA 2ERJC 5DYOB 3TNNA 5D8JL 2ZCLH 2GCYB 5B22A 1CGSH 5E8OB 4JKWA 4JQIL 4FOMA 5I17A 4L5FL 4ZNCD 1YNKH 3CFBB 1E4XI 5DFTA 2J8UA 4JFXB 3TIDA 2D3VA 2AQ2A 4M62L 2PYEB 5AWNL 3VWJB 3P9WB 1YY8A 4M7KL 3HE7C 1QFOA 1UZ8A 5L9DH 5CLWA 1QRND 2F54E 1ZOXA 1NCUA 3ZKQD 1MCKA 4LFHD 5EORL 4X5XA 5BZDA 4H8WL 5KSAC 1G0XA 3GGWB 3T0EA 3WFEL 2HWZH 1LP9F 1CR9L 3MRHA 5KS9A 4JFEB 4JGUA 3W82A 3VFPA 2EH8L 5CBEA 5T5FH 2CMRL 1UWEL 1JYWA 1G9ML 2OTWA 4LLMA 4Y5XA 1MQ8A 5CILL 3SKNA 2EZ0C 4BZ1H 1ZHBA 3PQYD 3KPMB 3NH7L 1EO8H 1TETL 4M3KB 5DJDB 3I6KB 2BOBA 3OKKB 2DWEA 3FFDB 2NX5A 3TYFA 3CLEH 3I9GL 5LWYL 3VW3H 3PP3K 2E3VA 5CEZL 5KANG 1QRNE 4KVNL 1CIUA 2GJ6D 2BSSB 5JHDE 4XHJD 5F9JA 5K59F 43CAB 4LVNB 3P4MB 1CR9H 3RWEB 2DRUA 4F15C 4JVPA 4KKLD 4NQDD 1IL1A 5CKGA 4WWKC 2Q76B 3FQNB 3I02A 4HUWA 4I48B 1ZT7A 1MRCL 15C8H 5ECJE 1TNMA 2VLRE 4KUZH 1RURH 3G04A 2X4PA 2I27N 1NJ9A 2DQUH 1A1MB 2C3VB 4NNXB 2FGZA 2CO7B 3CK0H 3U7YH 3MLVL 4XP1H 4TUOB 3WUWG 4NN6C 4PJ7B 2YA1A 4OIIL 4Y2DB 3PQYA 4JFZH 1KCKA 4R2GC 4Q9QL 3KPRE 3I50H 4R26L 3WE6A 3PQYE 3CMOL 3RWFA 3EYOB 3GSUA 1FQ9C 4NWUH 3O11A 4HIIA 5E6ID 5EU5A 4EI5C 3MXVH 3UZEA 3BP6B 2GJZA 3BRDA 4QTHB 3N06B 5IM7A 1GHFH 2GJ6A 2EDEA 3VI3F 4XTRC 1YDPB 3TBSB 4N8PA 1HWHB 4XH2B 1SYVB 2NY0B 4M7JL 1J1OL 2OX5A 4QXUH 2X4OA 2BFVH 4HPYH 3HAEH 4ZO6A 5I0DA 4NT6B 3HG1D 1HHJB 2E6QA 3D9AL 4PJXA 3C8DA 2DF3A 1A6AA 1DUZB 4NM8H 5I30L 1MHPH 3PWUB 3PHOA 5L0QC 3X17A 4G8IA 1FHGA 2AXHA 2XQBL 3ZE0F 4PJ7E 2ICWI 3DRQA 4CN1A 4CL7A 5F71A 1FNGB 5D1ZD 4MNGA 4G3YH 5M94B 3VFVB 4GRLB 4WVRA 1U8OA 3AUVA 4X6CB 4WTWA 5L88L 2ADIA 2G2RA 2ZSVA 4GAGH 5KS9E 4MD4A 2D9CA 2XWTA 2NY0D 1LEIB 3RGVB 3V52L 4ODBD 5T3XH 1GC1C 5IMOA 5KAQG 4P9HL 5KVGH 3BDXA 4GFTB 3PWPD 3WS6A 5D2LE 4F15B 4OIBA 3O6FC 4K94C 1IZJA 1A4KA 5BXFB 1YEGL 3EHBC 1MHHB 3BEVB 4YQXH 3LVEA 2Q87A 5GQBA 2L4OA 5C6WH 1EAPA 1XGTB 4NKDA 2XACC 5AYUH 5JTWA 1ZGLA 3RBGA 3GJFB 4I0PA 3QXDB 3P4MA 3RWEA 1N6VA 5DFVC 4QHLA 3GSQA 4PJDE 4CDHA 3PABA 4IJ3C 4WUKL 4NQCE 1UJTA 2YXFA 5BS0B 1Y6KR 5J12C 3VXRE 3V95A 3BKML 2CIIB 4LVHC 4PJ8A 3GBNL 1P2CB 2Q3AA 3I2CH 4AG4L 5D1ZC 5FDWB 3BUYB 5C86A 1R3LA 2R0LL 4PR5A 2X9WA 1OCWL 4XCYA 3KG5A 3KPOB 4WHTA 3SKOB 2A1WH 2M1KA 1IC1A 5IV2A 1H15B 5E4EB 4I77L 1RI8A 1Q9OA 2YZ1A 4G9DB 2BVPA 4NYLA 4CKVX 1RIVH 3WIHH 1AQKL 4XP9L 2EDYA 3VRIB 4G8FB 1XGUB 4LSUH 1UXWA 2R2EA 1FFQA 2NY5L 3TPUA 3BVNA 1AD9A 5C1MB 4NNYA 2VNCA 4J3UA 2WMPA 3U7YL 1NSNH 3M8OH 4I13B 2ZKHH 1NLBH 3WFCH 5KVDL 2R4SL 3V6ZB 4HH9B 1S7QB 3OJVC 4L1DA 3JV0A 3SBWA 4DGVH 4IIQA 4L8SB 4NJAL 4LARL 4UDTA 5IQ7L 3SGDH 4YDLC 5CP3A 3DHJA 4PJCB 4JDVB 2ICEB 1QLRA 1K3IA 2GKIA 1RZ7L 2BK8A 4X7SH 1KC5H 2K7QA 3ARYA 4F3FB 4U1GC 5GHWH 1DQJA 2Y4SA 4D9RE 3OKDA 3SKNB 2YK1H 1MHCB 4M1DL 1BFVL 1X4ZA 1UA6L 2HTKC 1NBVL 3BXNB 3SE8L 3OAUL 2GW5A 1I3RB 2DL2A 1A4KB 5BXFA 3GFUA 2VZ3A 3OKLB 1D5XA 1OAQH 2H3NB 5B4MD 3LSOB 2IANB 4WNQA 4P57A 1TNNA 4UOJA 1MJ7H 4FZ8L 1ZWIA 4ESKA 1KCLA 1ZA3A 1U3HB 3HPJA 3FO9A 2ZPKH 5E0QA 4FQXB 4HH9A 5D1QD 5ERWA 4MAUH 1A21A 4Q2ZB 3FQRA 2A2QT 2I9LB 2BOCA 3MLTA 4KH2A 5DK2B 5L2JA 1NCDH 3IRPX 4AT6B 4UDTB 4BQ6A 1ES0B 4X6DA 1EJOH 1JGDA 2NYYD 3WCYA 1G7MB 3TJHD 3K4ZA 1DFBL 2YPLE 1VCAA 4GG8B 3GJFK 4F7PB 3A67H 4X9FA 1Q9KB 3BAEH 4LRIC 4AH2A 4I3SL 3BP7A 5T1KB 1GGCL 1VADA 5IROA 3ULVL 3L9RA 4HKXA 2CLVB 3BIAX 4LSQL 2VSDA 2H32A 5HDQH 4HMDA 4X6BB 3SDAC 4NYLB 4LSPL 5DJ0A 5LQBL 5HHMD 2AJUL 3GK8H 3QDME 2R2BA 1N7MH 3Q6FA 3HB3D 2MKWA 2XWJA 5MEND 4FQXA 1MLCB 4LPVA 3B8SA 5ALBH 4ODWA 3T0BA 5I1EL 3ULUF 4Z7WB 2BDNL 3QUZD 3TWCH 2Q20A 5B38A 5SWZA 1LK2B 3MLUL 5I18H 5ISZE 5IVNA 2ESVA 4U3CA 2B2XH 3HG1B 2PCPB 1IKNA 2CD0A 4PY7B 1INEH 4APQC 1DL7L 4MNQD 1TQCB 4H5SA 1I9RH 4FHBD 4WU5A 4OI8A 5DQDL 4C56E 3MUZ1 4O2CA 4WU7A 3VD5A 4BH8A 2ICWJ 1Q9KA 3D2UA 4Z7OE 1LO5A 1RU9L 4AL8L 1H3PH 1CE6A 1ETZA 1UH4A 5K9QI 3FB7B 3FN9A 2QHRL 3QA3B 1OARL 3NAAH 4POYA 3QR2A 3HMXA 1H8NA 2FX8H 1GIGL 3PV6B 1U8NA 3S88H 1IT9L 1A7BA 1U8OB 4JFHD 3EYQD 5SX5H 2QSCH 3HCVB 4QRTA 4ZO9A 1XF4B 1UCTA 1F58H 1ZLSH 5IFJA 1BP3B 4WI5A 1JNJA 1JPTL 4BSVB 3QEHA 1I3RA 5BW7C 3G6JE 1MCNA 1KJMB 1ZLWK 1K4DA 3L3KB 2R2HA 1X3DA 3LKRA 3W0WA 3SKJL 3B83A 1QKZH 3JV6B 4XMPH 3WN5C 1MIEH 3U36B 3HLAB 5IB1A 1A0QL 3TF7C 3TBVA 2F74B 2OR9H 3GSRB 4LSPH 2L0DA 3KAAA 1WTLA 3WNNA 5HI3D 4ZS6C 3BZDA 2EXYC 4KKBD 3BYTA 3V52H 2FATL 3OR6B 2IFFH 4LVOB 2E7MA 3RHWK 3U0TB 5JLZB 5M7QA 4EI6B 1F02I 4HIJB 1KYOJ 3MLZH 1CGVA 1JPFA 4GAJL 4JM4L 2V2WA 5BZWB 4H1LG 4Y5YA 3QJFA 5LGKA 2BVOB 1IQDA 4L8CA 3IJHB 2JK5A 3TWCL 1FL6B 3LPWA 4WHTB 5DR5L 1RV6X 2RIKA 2VLJD 4IIQC 4YXKH 1IAOB 1MNUH 2CKNA 3R1GL 5INCA 5DRZB 4PRHE 3RP1A 3RUGE 3VXNB 1G7HA 4MS8D 1I8IA 1G7QB 4ZPVA 3H9SD 4PIRF 2VXSL 3S3PA 4F7EB 1XAUA 4PRPA 3U7WH 4PJ5A 4BZ1L 5IF0A 2W9DL 4I9WD 4E42A 4CVUA 5IMKB 4MYWB 2A6KA 3PIQA 4XPGL 4LPTA 4LCCA 2Y06L 1KJVA 1VFBA 5D6DC 2F74A 3HI5H 1I7TB 5FYKH 4QYOB 2P24B 1C5BH 3BKYH 5E2VH 2HKFL 4KHXL 1MVFA 2KH2B 4WFEE 4XNUH 1UEYA 3RDTC 3RKDC 4GOSA 1S8DA 3CVIL 4OLWH 4KK8C 1QP1A 4D9RD 1LE9A 1CF8L 4K3DH 4PRPE 3S36L 4F80A 1EEYA 4R6UA 2AJZA 3BPOB 1AIFB 2YEZB 2ATPA 1CE1H 4KY1H 4EOWH 4KC3B 5GHWL 5TE4H 3SDCA 1IAIH 4DVRL 3VXRD 3MLVH 5CILH 5CINL 1AO7B 4Z9KB 2NNAA 2VIRB 3NH7H 2DQDH 1HI6B 5BVJB 4XGZB 3TYFB 1YY9C 3GIVA 4G6ML 1I3UA 5B39B 2FCBA 5IVXE 2Q1EA 4U7KA 5EPMA 2HT2C 2X4TA 3M45A 2VLKD 2BZDA 3DMMA 4AEFA 3UTPE 2ITCB 1DN2A 2HWZL 3G5YB 5HGBA 2QADC 2IMMA 3RAJH 1T22B 3QUZC 4N5EC 1OT2A 2VDRH 3PHQA 2Y7QA 4KMLB 4U7SA 3W0WE 1VFBB 1IM9A 5ENWA 5F9WB 3UPAA 5DVOA 4WUUA 5E6IB 3C60A 4MLIA 2AVGA 1TETH 1WUNT 4J6RH 2V9QA 1DVFD 4NO5B 4LRNH 2MTPA 1CN4A 4YX2L 3CJJA 3HE6C 4XZUB 3NCMA 5JO5B 1KN2L 4KJPD 1Z9LA 2NW2B 4A6YL 1B0GA 1U92B 2DIAA 1BPVA 1DBJH 5KVFL 1NEZG 2AXGB 5IQ7H 3Q3GB 5DVNA 1T1WB 4ZFOA 2YEZA 3QQ9C 4H8WH 1I1CA 4HGWB 3QH3A 1PG7L 4X8XA 4OGAC 2DM4A 2JCCA 4JGMA 3GMPA 3VWKC 5L8LB 2F53D 4GRWF 4BFEA 4Q6YA 4PJCF 4U1JA 2WP3T 4XVJH 2EKSB 1X5HA 1ZSDA 4OZIB 3ULSA 4IRJC 3OR7B 2W92A 4I48A 5E2TL 3DURB 1MLCA 4HS3B 4DKAA 4K8RC 3SO3B 2CJUL 4M6AA 4YGVB 1MCOL 5E8DH 2FR4B 4GBXD 2BNQA 3ARGA 3Q6FB 4ETQA 1I1AC 6FABL 1I8IB 5IQ9A 2C7UB 3B5HA 5E1AB 3VGBA 2ZUWA 4FQ1L 5F3BA 5BS0E 4OD1L 1RU9H 5F6IC 4H1LB 1PQZA 4BQ9A 1JBJA 3SJVA 1T89C 4HIXL 1JN6B 4U1LA 1J8HD 1S7WA 3FTGA 1CU4H 2XZZA 5EWIH 4TUJB 1YPZE 4RBPK 1QVOA 3RUGB 3CFKA 4YIQA 2WBWB 5E94B 1WBXB 3AM8C 3STLA 4BZYA 5KSVA 5GJTH 4POUB 1X5FA 3ZKSD 1KJ2B 4GQ9L 3MOBH 5TH2B 4XP6L 4EQ2A 4WEUD 2EKJA 5FHBL 4OZHE 4S1DC 5ITFB 4KK9C 4RGOH 3LN9A 4UT7L 5EUOF 4LAQH 4YDVB 4AYFA 4OTXH 2QQLH 1HILA 3KR3L 4NKMB 1ZS8B 4GW1B 5F7KC 1WTGT 3VXOA 4JFFA 1NDMB 1T5XA 3JTSA 3O2VL 2PO6A 1H8SA 1NGQL 1WF5A 1LDSA 2GHWB 2NY3D 4HFWB 3O4OB 4RMSA 3HB3C 2EIEA 1IGCL 3QEHB 5C6PB 2DQFB 4MB3A 1DEDA 1HXYB 3EJYC 4LIQL 4QXUL 4MJIB 1MRFL 1FNGA 4R4NC 5D5ME 1IGIH 1VA9A 4NM4L 1NAMA 2IFGA 4XVUD 3QQ4B 3MSPA 3GUTA 1JFQL 1AR1D 5C0CA 1P53A 1Y6NR 5FB8A 2O5YH 5GGRB 1SJHB 3RA7H 4NN7C 3KPPA 2D7QA 1Q9OB 1KFAH 2XQBH 5HVHB 1IFHL 1KTLA 1TCRB 3UTOA 1FV1B 4IRJB 5E00A 1EFXB 1XGUA 3P0VL 1TENA 2F5BH 3ZYJA 2YPLB 1RUPH 3PXHA 4OM1H 4YHIA 5CEYB 5T5NG 5BV7H 3C08H 4RQQA 3NAAL 4WI7A 3GK8L 1NAKL 4HCRA 1MFCH 3ZSTA 4N90E 4OB5L 5CJXC 5DRZA 3V6BR 4Z7NF 3TBWA 1O5DT 5IEHB 3A6OA 3MJ8B 5CZXD 2PYEA 5FM5O 4JPVH 2W9EH 4QGYA 4QOKA 1T0NB 3MA7A 1JV5A 2NPLX 1KCUH 2GTZB 4M8VA 1C08A 4C55A 4P2QA 3UJTL 2GSIB 3DSFL 3PWVB 4M7ZB 2J5LC 4F7CA 3H8NA 2CKBA 4UQ3B 3HRZB 3QUMH 5DYOA 2A77H 4GKSA 4OT1L 5FB8B 5E8PB 3QUYC 4MD5A 2JB5H 2CDFA 1AI1L 4HUMB 3PDGA 5MENE 3SGEH 3OAZK 4YNYB 4JVWA 1OGAA 5CJXA 1WQVT 2X4NB 1H15A 1OAXH 4HK3J 4IDLA 2K1MA 3RTQD 3S35X 3SGKA 5MENB 3NZHL 4UUJA 2DJ4A 5T33H 3C5ZA 4DQOH 2VYRE 3SDXF 5CGMA 2PXYC 4HS8H 3BH8B 2BNUB 1Y6MR 2JIXA 3U6RB 4TUJA 1JNNL 2DYPA 2X1QA 1K4DB 4DEPC 5DK3A 2I5YH 5E95B 1YEIL 4KKCD 5IIEA 3AS2A 1U6AH 5DHXB 1OOAA 4NN5C 4OLEA 4BFIB 2NX5B 2CUIA 3FFCD 3VD9A 2EC9U 1WITA 1DUYB 4PGCA 1D9KB 5MERB 4HMCA 4YDVA 3TJEL 4L3AA 1B2WL 2J7LA 4CGTA 1KT2A 2VXSH 3RU8H 4NSKA 1D6VH 3L3JB 1BBDH 3P30L 3UO1H 3IYLW 3HFML 4NNPL 3TN0B 5KZCD 3MRPB 2YK1L 5I1AA 5FFLA 4OFIA 1A7RL 1OAUH 4WY7L 5I16B 2AAVA 1YZZA 4KK9D 3X13B 2YA0A 4LSRH 1OPGH 4HUXB 2FZ3A 1A6ZA 4L1HA 3DYOA 4PY8I 1Y0LA 1ORQB 2AP2A 4Q6IA 4R96B 1E4KC 4R0LA 1OTUD 3LKPB 3O3UN 3LRGA 5D7LA 2D0HA 3U30B 4HHAA 3DJ9A 1LK3L 1RZGA 5E7FA 2IANE 3MA9L 4Y4KD 1MCPL 2FGWH 5DUMH 3WFBL 2ZCHH 1R3IH 3DROA 1OAKH 4BFIA 3TT1L 1D5MB 1M7XA 4OM1L 1A8JH 1X44A 1F6FB 1YDPA 1RHFA 4WWKB 5I9QB 3QB7C 3TA3B 5I19H 5JIPA 4MMZC 1N0XL 1CT8A 4YHIB 3P4OB 2VDLH 4LLYA 3FRPG 4GBXC 3WLWD 5BRZE 5AZEL 3IFPB 4HAGA 2DAVA 4YBQD 2FJHA 2CDGB 5IB3B 32C2A 4K55A 5DS8B 3VFOA 1J8HE 4WV1B 3MRBB 3ULVF 4P4RB 5GRJL 5EZIH 2A1WL 3L3JA 3S36X 2F54D 3D48R 5CSZA 2P8MB 1AE6H 3WFEH 4QRUA 1AHWB 2VQTA 4AIXA 5LVEA 1S9KC 1MF2L 1BWWA 3JV5A 3T65A 4OZGF 4ZUUA 3PWLA 3MYJB 3IFNL 2F58H 2G9HA 5CGTA 3T3PF 1PLGH 3TZVB 2OR9L 5KSUA 1RUML 2HN7A 5IB5B 4PR5B 1J86A 3BQUC 3PV6A 2DQCH 3BPCB 2XWTB 5EUOA 1A9EA 2EDXA 5DXWA 5EO9A 1CD1A 1X5XA 2YD2A 1QR4A 5EC2B 2OTWB 1E4XL 4U6YB 4X6FB 2ZZUT 5I30H 4OZHF 3BP4A 3HTLX 4RWYH 3BEVA 5DJAB 1RZKL 5I75B 2IPUG 3S7GA 2VAJA 1ZEAL 3HMXH 4R97B 3VMPA 2Y5TA 4QO1A 4LCYB 1LO3H 1U8MB 5IK3A 1HYRC 5ESQB 3TBTA 3MV9D 1JZ2A 3S96B 5DHVA 1LK2A 4NQED 3BGMB 4XNMB 4NQCD 5GS1A 2FO4A 4JO3H 1E0OB 2D31A 4XPTL 3VXUB 1A6PA 4Z0BL 4E41D 2R56H 4K3JH 5I1EH 4XXDB 1XCTB 5E2WH 3F7YB 1UKSA 4D2NA 3FB8B 3K46A 2HT3C 2N7BA 1MWAB 4GKNA 3IRZA 4FQQB 5C8JA 4NFBA 5I1GH 4R2GD 3SKMB 1AFVH 4ZS6D 2D4DA 3O11B 1VSCA 2CR3A 3WL9A 2HMIC 1JF5A 3GMLA 3QCVH 1TCRA 2DL9A 4JHZA 5E2UH 1A02N 3FO0H 3BO8B 1NANI 1MF2H 3L5XL 2W9LA 1ZLUH 4ODVL 3D39D 2X1WL 1P4BH 1FVDB 5D93B 4G8FA 3QCUL 1LO4L 1ZANH 2VQ1B 4LSVL 3T0EE 1Q9LB 4HKJA 3VWKD 5F9OL 4KTEL 3WXVH 4QYOA 2VZVA 5K9OB 5CLTA 4XNQB 4IHOA 3LQZB 3EFFB 4JPKL 4PJ9C 4YHKL 1TJIH 2X9YA 1PKQB 3JVGC 4BSWA 5ADOL 3CX5K 3FB6A 3GSNB 1J1XL 1GXEA 2WQ8A 5IJKC 4FQPA 1U3HA 3DIFA 3DX6A 5AD0B 2GQHA 3MV7B 2ZJSL 3E0GA 3C2AH 1S9WB 2J8UE 4KZEL 1MRDH 1L0YA 3FZUC 1KXVC 4MNHA 3ZE1F 3ULUD 3V4PL 4PJIE 1AHWA 5T5NF 3U4BL 2KQNA 3MRIA 4NCDA 4M43H 3CK0L 2VKXA 4PYHA 1X9QA 4GG6A 2ZCKL 1HH9A 3R0MA 5GRZA 4JFOB 3T0DA 3B9DA 2IPKB 4G6FD 5IB3A 1J1OH 1WWBX 4DGYL 1U8JA 4L4JA 1TQBC 3RRQA 4E5XB 3GMNA 1FVDA 2P4AB 3GSOA 4RIRB 1FDLL 3MNVA 2C26A 3ARSA 2VITA 4PJ5D 3OV6A 3RTQB 2EXYD 2AJSH 5SV3A 5IFAH 4JO2H 4WI3A 3MXVL 5CEZH 4FFWD 4HXAL 3UJIL 2BXYA 4B50A 5F7EL 2BSRB 2FO1A 3X12A 2FH8A 4OFYA 4M1CC 5TPWH 4YDLB 3EFDL 4OT1H 5TFSL 2QQNL 3V7AG 1PYWA 2WW8A 1BBDL 1CGSL 4YEEA 4FP8L 1MHEB 2P48B 4JEGB 4XVJL 4OCYL 2HVJB 4GUPB 1IC7H 4RNRB 5E9DD 3D2UB 2B20A 1YYLL 4Z7VF 4EIZC 1U8IA 2XKNB 5EBLB 3FT3A 4X9BA 3VU2A 3BKYL 3ECBA 4RX4D 3QA3A 3QWQB 2Z31B 4XWOD 3ZT5A 5D93C 5D2LB 5I8OL 4UI2A 2G60H 3MROB 1NQBA 4UILL 1P84K 5SWSE 2ADGA 4UB0L 1EHXA 3NCBB 3T0EB 1G0DA 5L2KB 5E2JA 2ICES 4ZUVB 5K33A 4C59B 4CW1A 2X89D 1Z0MA 3SDXA 2EO1A 1I8LA 2DLEA 5I2IB 3TA3A 1NBYA 3RVTC 1HINH 5HHOA 5LCVH 4ELKB 2GUOB 3G6JB 4Z0XA 3ARDD 5EUKA 3IDXL 4JRYD 4F8QA 35C8L 5D1XD 2Q3ZA 4HJGB 4LVHB 3DGCR 1Q94B 4NNYB 3ILQD 4FQLL 5F88A 2YMXH 4OUOA 1K6QL 1A7QL 4NHUA 4PB9L 1T20A 2OK0L 3OXSA 4RMVA 2CUMA 4PLKC 4BUHA 4W70A 4S0SD 1Q8MA 3EOAB 1UH3A 4TNVF 5GGSB 1JGEB 5CEXA 1WAAA 3DX9A 2BSED 4NDMA 4OSUL 4AY0A 4P2OB 2XRAH 5DA0B 3GM0A 5LBSH 2WWMD 3ZL4L 2FB4L 1UYWH 1CD8A 2OMNA 5T3XD 4JLRA 1RZKC 5IF0B 1KT2B 5DUPH 1KTRL 3UTTE 1ZGLP 4KK6C 5J6GB 1TDQA 4MQXD 4S1QL 3KPTA 4JRYA 3FCTA 2JJSC 1MY7A 3PNWB 5CD5D 2NXZB 1CTNA 3O9WC 2FX7H 1W0WB 1RIUH 3GNMH 2G5BB 3ILPB 3SGKC 2DQJL 1LO3L 3OHXB 1QSEB 5HYQA 1MJUH 3P2TA 3MBEC 1JHLH 3G6DL 3WNPA 1FYTD 1MCDA 2XIDA 5TGBB 3BEWA 1RUPL 5DHVB 1ZLVH 3MXWH 3QIUC 1U8JB 1WWCA 5HHVH 4ZYKB 2KQMA 3NIFE 2Y5TB 2VXVL 5AZEH 1M7DB 2NY6D 2VH5L 5C0ND 1FIGH 4HXBL 5JXED 3U9PH 1UYWL 1AC0A 1X6NA 5DJZA 1NCWL 1JUFB 2PW1A 2VABA 4RGOL 4M8QB 1TVHB 4P3DB 5HD8D 1CBVH 3RKPA 1JPST 4HMEA 1SVZA 4QHNA 5F96L 4QTHA 1FBIL 1PYWB 5DHYA 1QSZA 3H3PL 2HJKA 3PXJA 5I15L 4DKEL 5IJKA 1R3JA 1EA9C 3R06A 4OUUB 1A2YB 1LP9E 1G6RB 3JWOC 2WIIB 3MRKB 4QHMA 1CFSB 2AERT 5DRXB 2UYLB 3UJJH 4D3CL 5FEBA 1GRWA 4MWFA 2FH6A 4NUJA 4PTUA 1AXSB 1MJJB 2PYFA 2CLVA 2BVQA 1MQKL 5D2NB 1SQ2N 1VDGA 5J12B 3AFLA 4E41E 3QI9B 4XNQA 2GFBB 2PF6A 4NZUH 5FKPA 1MAKA 3MODH 3MNZB 1JTOA 1HHGA 4M5ZL 4HKJB 3MV01 3IDIA 5DO2C 5ESAB 4KDTA 4RDQG 1IBGL 2AQ3A 3OJDA 4LHUB 4LNRA 3AGVA 4ONFL 3SBWC 1AY1H 1J5OH 1P5VA 5T1LA 1OSPL 4LNVA 1O7VA 4MNHB 4F33A 1RZJL 3EYVA 4IMKA 2DTSA 5DDHA 2WINB 1F8TL 1NMCC 1H5BC 1A9BA 3MRMA 4LSQH 2H26A 1ZHKB 1KB9K 3OPZL 4CN6A 3WDIA 4X6CF 2H8PB 5DJCA 3U0PB 2HT4C 1HEZA 3CXDH 4L4TA 3SE3A 3AAZB 4P5MA 2AV7B 1GGTA 2DJUA 2XPGB 4AM0B 3O9WA 4RQQB 1DLHA 2CIIA 2JCCF 1SYSB 2EH7H 1PZ5A 4S1SH 3D0LB 3HZYA 1YEHL 4NKDB 3UYRH 2EC9T 1BM3H 2V5SA 3KYKL 1T1XA 1NPUA 4FNLL 1U8LA 5IBTL 3NCFB 5F7EH 4X4XA 4KDVA 5CBAB 1MFDH 3O3BA 4L9LB 5TPWL 4Y4KA 2R1WB 3GSOB 4RIRA 1MCBA 1WCBA 1CF8H 3O8XB 3MRPA 1UWEH 5ICZA 1KNOB 2PN5A 2EYRB 3NACL 4P23C 2NLJA 3T2OA 3LEXA 5C0NC 3UZVB 2VLLB 4LBEB 4MD0B 4Y19B 1Z9MA 4C83B 1KPUA 4OF3A 1J05A 3CAFA 2X4OB 5BS0D 1CXKA 3L1OH 1BVLA 4GKZB 4NO5A 4TQEH 5SWZD 4LSRL 5F1IB 3BPLB 3PNWA 4PGBA 3VW3L 1G7LB 1CDGA 3OF6A 5ICXB 5E7BA 5TDOB 3QFDB 3K81A 3AU1B 3WIFB 4XPFH 1V7MH 4JZOB 3WSQL 3FN3A 4EXKA 1UVQB 2P5WA 3FOMA 4O5LH 4PJBE 4HCRL 2ZNXA 2AKRB 4Z76B 4KK6D 3SDAB 1INDL 1HNFA 3L3HA 5FOBA 3P30H 1RZIB 4W81A 3DRQB 4P2YA 1IGFL 3F6IA 5DMIL 4F7PA 4TNWK 4OKDA 3RIAF 3U4EA 2WWMC 5T5FL 5E99H 5DEGB 4Z78A 4O2FB 3U2SB 1KB5B 1BWMA 4OLZL 2YSSA 1QD0A 1CFVL 3S37X 4NM4H 4XHJC 4ODSL 2Q6WA 4U1SB 4MWFB 3NFNB 4TQEL 5HJ3B 1MJ8H 3DTXA 2FJGB 1V3JA 4R4ND 4OCRH 4JHWH 3IVKA 5E5UB 5KOVC 2Z8RA 1XZ0B 2J4WH 4OLVL 4KAQH 1IBGH 2AQ1A 4O51B 1OF2A 3T1WA 1CZ8L 4YHOH 1MRDL 2YUWA 4OV6F 4ORGB 5D5MB 3LQAC 3GSVB 3RPIB 4IS6A 1DQQA 1HH6B 2HRPH 3N9GH 4ZODA 5EU5B 3EO1A 4JAMB 3NFSH 4L5FH 3RGVC 4AMKL 4KHTH 4OCWL 3WE6B 1XGYH 4XPTH 5TJWK 5GRXG 4LLWB 4I18B 1XGPA 1KSRA 3STZB 3QDMB 3WJJA 3MUY1 2A73B 3T8XA 2R2EB 4JM4H 5GS0H 5HPMB 1YEFH 4WI4A 3RI5K 1BMGA 4XCNA 5ILTL 5C0DA 1JGVL 4L29B 3P4OA 3C09C 1DEEB 3LQMA 1KENH 1OCWH 3MFGB 4N8VA 1QFUL 4LCUB 3ARDB 1KCVL 1DVFA 3GSRA 4KDWA 3DV4B 3ZSSA 1QG3A 3P9MB 3LV3B 1LE5B 5I1DB 5JW3L 5AZ2L 3ABZA 2XTJD 4NKOB 4KZDL 3MREA 3HI1B 2OSLB 5EZLA 4FFWC 5I1JH 5JMRA 4KJWC 3HPLA 2G5BA 2IWGA 1IRAY 2VDLL 3HE6B 2R4RL 4JFYA 4Y4HB 4JO3L 2UVEA 5AYQA 3KXFD 1YEEL 1T5WB 5H37G 4B41A 2E7LC 5IHLB 5HHMB 4LCCC 2AI0L 4UDUB 2OZ4A 2DS4A 5KVEL 5C71A 3WJLC 2I25N 4P3CH 5CGYC 2FHBA 4I2XA 4PJIF 3T8XB 1UXSA 5MEPA 4HV8B 1E28B 3QO0B 4QTIH 4DKEH 5JPMA 5DQDH 1VKXB 4LLWA 1XIWD 2EDJA 3H42H 5GISH 1CFTB 3QXAB 4FFZL 3HZVB 3B9VA 4XCFL 4ODHH 1KCSH 1ZT1B 3ALWA 4CMHC 5LBSL 4WY7H 4YJZL 2BY0A 3NFSL 1L7IL 5TE7L 3CX5J 3MRCA 1KB5L 1G7QA 2M8XA 4ZPVB 3IGAA 4R3SB 3T1FB 4PFEA 1E6OH 5DC0A 5E6IC 4DWHA 3Q5YA 2IALA 4NQVB 4PS4H 2AJZB 5IHUL 1XT5A 5D7LE 1K8IB 3MNZA 1N59A 1JF1A 3JZ7A 1EGJA 1LGVA 1G9MC 2YMXL 3TP4A 3C9NA 3L95B 1KLUA 4PB9H 1QEWB 1PG7H 5IGXL 3QQ3A 4JPIB 4WUUD 3WJLA 3VRLF 2FZ3B 5IMMB 4U1GB 5C0FA 1WEJL 3BP7B 2IH3A 4N9GB 1YNTB 2QTEA 5GRUH 4S2SB 4TPRH 2I9LA 1T0NA 3KPOA 2PO6D 4JFQA 1IM9D 2FB4H 4BUGA 2HFGL 1CT8B 2R2BB 3QNXA 4J3WA 1FG2B 3P3YA 1SM3L 2PUQT 5DVLA 4JDTL 3DVNA 3VFMB 3KHQA 5IVZA 5E24E 1AGCB 5E6IA 2WBJD 3G9VA 3OKKA 3NOIA 1N2RA 2F19L 4JZNB 5ITFA 2BC4B 1FLTX 1RJCA 3QXVA 2DLFL 1EX0A 3MLSL 5FA3B 1FE8H 3B9KB 3RKDD 3BXNA 4MDIA 3TZVD 3IB4A 2HFFB 1EHLH 5MEOA 2WLZA 3STZA 5C2BH 1UB5B 3BIKA 3OR6A 4LLUA 1Q9WB 3VXMA 4HS8L 1U0QA 4F3FA 5AG9A 3QEQE 2QQQA 3IDJA 3K8MA 4G8GA 5MERA 4HQQL 2ID5A 3QQ3B 1HOCB 2W0FA 1LWRA 3UXFA 3BJLA 2ZJSH 3TH2T 3QIBC 2B1AL 3L5WA 1IC5L 1BD2A 4GXUN 5SX4I 4F58H 2FEDD 3QWOB 3S36H 3VWJA 3ARGD 1U91A 4H20H 1KCSL 1NEZB 4P2QD 1SJXA 1XF5B 5I8CB 1I9JL 5D1QB 4ZFZA 3TC9A 3VXQB 1HYSD 5ITBH 5L7XH 2PTUA 3QDJB 4XI5D 2F8OA 3DUUA 2R0WH 4PRIE 4OFYD 3EYSL 3GIZL 3TNNB 1CL7H 1I9IL 3BZFA 4OQTL 1KTDB 1T7XA 3CVHL 5EO1A 2Z0BA 3TBYA 1M1SA 3F7QA 5I1IL 4MA7H 2FHFA 4Y19D 1DUZA 5EA0L 3IJSA 3VFPB 3KXFB 4Z95H 3MCLH 1R24A 3NVQA 4X4MA 4M5ZH 4JDTH 5GS0C 4TSBH 4XC1L 5BRZB 1EBAA 2BRRL 1QR1A 1RIHH 1P9MC 3JV4A 5D7JA 2XA8L 4NZDA 1CVRA 1KLUB 5HYJE 5D5MA 2R23B 5TQ0H 5B8CA 5E08L 4U1HB 3HNSH 4PJIA 1WBZA 1OF2B 2VDPL 1K5NB 1IAOA 4J1UB 2VXVH 1AGBA 1NGZB 1JZ7A 4J23A 3W39B 1XGRB 3WD5H 3FFCE 1QPPA 3ZHKA 2P5EB 4JFFE 2EXWD 3V0VB 4NFDA 5I2IA 2C3HA 2DMBA 3ZT6A 3U0TA 5ICZB 1QUNA 2H32B 1MIMH 1TVHA 5DJ8A 4KQ3L 4XPHL 5INDB 3V4VL 3C8HA 3TFKD 2YS4A 3F7VA 4TSCL 3P0VH 2WBKA 4PJFA 4JREC 5T3ZL 2H2SD 2D7PA 4UINH 1CFNB 1BJ1H 4ZNEA 5DI8A 3DXAA 1WC7B 5FUOL 4NPYB 1FLRH 1P6FA 2PYED 2BNRD 5FM5M 1J0ZA 5EZLB 5F6IB 3TVMC 2R9HD 4O58H 1OTTC 4CUCA 3TJHC 1KB9J 1QSVA 4KJYA 3S37L 3K74B 5FUCE 3MRIB 3TIDB 1AGEA 2K7PA 1K5NA 1A5FL 3M07A 2J4WL 3ARVA 4OLVH 1NBQA 3CVHH 1MCLA 4N0UA 2VIRA 2DQJH 2AS5M 3ULVH 3ARGB 4BQCA 4AQOA 2AK4B 3KPNA 1YA5A 1T1YA 2HLAA 1F6LL 5IESH 2M2DA 3N85L 3HZKA 4HWBA 5HGHB 1S5IL 2FJGA 3CFIC 2CRZA 4HWEL 1XGYL 3L5JA 1PD6A 5ID1B 4NKQB 2GK0B 4ALAH 1NUGA 5ALBL 5GJTL 1N5AB 2ESVD 4XP6H 2YBRB 2ZUVA 4ORGA 1Q0YH 3GI9L 3V6OC 5JIHA 4J7RA 2BNRE 2DD8L 2QQKL 3QDGB 5GRVK 3GMLB 1IGTB 1IARB 4OGYH 4IRSA 2DYPD 4JAMA 3P40A 1OP5H 1FO0H 4M4RA 1VENA 3T1FA 3TT3L 4XVTH 4Y5YB 5HD8C 3THMH 5EBWA 1G6VK 4NUGL 2VWEE 4I0PC 3EDFA 4WUUE 1J1PH 5F3HB 5C0RH 2D03H 2QLVB 4DUWA 2V7NB 1M7IB 4KHTL 4L4VE 3AY4A 4J6RL 3G04B 2MOVA 3BWUC 2VDNH 4PJGF 2OR8A 5MI0B 1A7OH 3KNBB 3MROA 5JZ7C 2MQ0A 3ULUE 1GGBH 1P4IL 1WISA 2BNRB 1RFDL 1ZSDB 2A6KB 4UT6L 4NSKB 3MRRA 5E1HB 4HC1H 3QZWB 3NCEB 3MLXH 1MCPH 2FGWL 3L7EB 3O4LB 3JTTA 5ICXA 2OK0H 1HHKB 3TJEH 3ARBD 4YDIL 2Q76A 1NFIB 1H3VA 3QH3B 2R69L 3KJ4C 2YRLA 5HDBE 1ZA3B 3H9ZA 3CFCL 3L5HA 2KBGA 3VDBA 4KUCF 2NR6D 4JQXC 2XQYK 2IANA 4QF1B 3VJ6B 1F6AB 5KVDH 1OAUL 3WBDA 1IC4H 2B4CH 3L7FA 3ZTJH 2AV1B 4FFYL 4S1DD 2NXYD 3D5OF 4FFVC 1KELH 1BFVH 4TTGA 2FYYA 2NY3C 3CLEL 3I9GH 5JQ6L 5LWYH 4HWBH 1WK0A 3SOBL 5LGJB 4XNZC 3IU4L 5FGCE 4Q9QH 2ED8A 2PR4L 3G6JF 4JRXD 4P2CG 1SM3H 5KSBB 1FAIL 2VDQL 3C6LC 4L4TD 3WSQH 3RAJL 2DDQL 3UTSD 4NZTH 1UKTA 3WFHB 2X4NA 3GMOA 2VZSA 2ITCA 4KUZL 3THML 1AKJA 4FZ8H 1QBLL 1ZVYA 4UTAL 1H9VA 2BXZA 3CFCH 3RVTD 1SMOA 5F1OB 4W4OC 4EIGB 1QFWL 5MP6H 4FXGA 5JIKA 3SHSA 4BM7A 3AREC 5E4IA 1M6OA 3R0NA 3OKEB 4OF6A 4FQHA 3RZWA 3JWDL 5T1MB 4Q9RL 3LS4L 3GI9H 5IB4A 1ADQH 3VGAB 4J3XA 8CGTA 4IRJD 1GGBL 3RX7A 4Q6IC 2QSTA 1TPXB 1PX4A 3FB6B 2JKXA 2NY0C 4HPOL 5KN5A 3CSBA 5IBTH 3KPRD 1DVFB 3VFWB 5JNYA 1RZ8B 4S0TD 1OGAE 4P3WA 3MV11 4KJQC 1VFMA 4XPBL 3U79A 5EIIA 1FH5H 2WM0A 2QHLA 1WEJH 5FYKD 4KI5F 3BUTA 3U1SL 2QHRH 4W4NA 4ZFOL 1JE6A 1OWWA 4BK5A 3RNKB 3RY5A 3MV9A 3T4AB 3QHZL 1D9KD 1TJGL 4XPGH 3DARA 3HAEB 1NMBL 3UTPD 3W39A 4N0CD 4GT7A 1FFNB 2B1HL 4JY6B 3A6BH 3CSGA 2GT9B 1AJ7L 1G84A 5J1SC 4YBLC 1AXSA 1ACYL 4RAUA 5KVEH 1C12B 4B5EA 2OTUA 4XBGB 2H1PH 1MCJA 2GCYA 3OKEA 4OGZA 1SBSH 5FO9B 4G6AC 4BSVA 3G5ZA 2BOCB 2A6DB 1QYGH 4J4PA 1YYMH 1SHMA 1BLNA 3CUPA 4LEXL 2VN4A 5JHLL 2EEDA 3FOLA 5AZ2H 5I1AB 5FF6B 1LEKB 1QO3A 5BO1L 3PE9A 1J1PL 4PRAA 5IW1A 3V5KB 3ETBF 4HZLA 1H5BA 1KIUA 3HZMA 3LKRB 5DMJB 3E6FA 4WJ5B 3ARTA 2MMXA 4U1LB 3V4UL 2XOTA 3VD7A 5JPNA 1DSFH 4B53A 5A2FA 1KENL 1BOYA 2Z31C 1WBYB 2E8YA 5CUSL 2UZIH 1KCVH 4PP2B 5F3BB 4G9FE 4JE4B 4MDJA 5EZIL 2ZG2A 2ZUUA 1QBAA 1U42A 2V7HA 3CLFH 4HUVA 1J0JA 1DL7H 2H6PB 4P2RE 3UPRB 4JN2A 5D96B 2W91A 2Z92A 3ARZA 5LAXB 3O9WB 4DN4H 5TGBA 3HUJB 3HC3H 4OQTA 4MA3B 5H94B 2HJFB 4RAUB 1OSZB 1CDIA 1IMHC 1ADQA 3CX2A 3D69A 3QSKB 3N0PB 2FL5A 4GW4A 1DUYA 4PGCB 5DMGD 1PKQA 1W0VA 2WQRA 1IAIM 3I3EA 4NZRL 1U58B 5I17B 1GL4B 2ARWA 2ED9A 4QKXB 3OX8B 2OTUB 5GZNC 4Z7VB 3DV6A 2F53B 3VFUA 4CJ1A 5C92A 1G7IB 2VLLA 1K8DA 4J3VA 2VDMH 4E0RA 2IBGA 5HHME 5SV4A 3DETD 1WCBB 1G6RH 2E9BA 5DZOA 3WO4B 1HKLH 4YWGL 2F8XC 4WIQA 2FBOJ 2FHCA 1F13A 2MHAA 1KJVB 4RGND 1A1NA 2DLGA 4MZ2A 1NAML 4OJFH 4NJ9L 1K4CB 2WBJA 4OF8A 4XRCA 3PJSA 4QRRA 5C6TL 1ZAGA 4V1DE 3AU1A 4MGXA 3S3JA 3WIFA 2EDNA 5TQ0L 3OAYH 3CCHB 1IILE 1DBBL 1QBBA 3FQRB 3PWPA 4DVBB 4NOBA 5IR1A 5IKCB 4GW4B 2DQCL 2EH7L 4PJGE 3PHSA 2PW2B 1R3HA 3OKOA 3TO2A 5JW5A 3DI3B 5H94A 5ACMA 4HQQH 2EECA 3BVNB 4G8GD 4LSSL 4HGMA 4G9FA 4XMKH 2G60L 3ISWA 3FB5A 3PP4L 5H37H 3RY6A 3LKPA 3ME0A 5CWSB 4JY4A 4G43B 1U8MA 4P5KA 5IK3B 3LEYL 2V9TA 4FQLH 1GGCH 4UOW1 1B0RB 1JMXA 3SDDA 5CEZD 4LSTH 5JR1L 3UEZA 2XKSA 5I74B 3OX8A 4HK3N 3TLRA 1UM4H 2CLZB 1K8IA 5IHZA 4ENEC 1BVKA 3K80A 1Q0XH 2OZ4L 3RJDA 1BX2B 4C57C 4D9QE 1IAIL 3GSXA 2CKBL 5EDXA 3S35H 4ELME 2WWKO 4BKLA 1TITA 4FG6D 1CFQA 1C8PA 3AM8A 1RUKL 2X89A 1WWWX 3TCLB 3FKUS 4ZUSA 5GGVH 2VXUH 3V5DB 2F8VA 5BCAA 1J18A 3MRLA 1FL5B 5C08A 4OD2A 4LDLB 5HHOD 4QWWD 2LQRA 4YBHA 3UBXI 1UB6A 3BZEA 4JHBA 4CJ0A 3JWOH 3BD5A 3ZMRA 4XNYH 5JR1H 5LAXA 5EZOL 1RSFA 3U6RA 2E7HA 5D7IF 4Y2DC 3QPXL 4JFDE 4UQ2B 2P24A 3O8XC 5IVOA 2IPKA 3O2DA 4TVPL 3TA3C 1H3UA 3PWJA 5CIPH 3MR9B 4BH8B 3U0WH 5C0EB 1EFXD 3CFDB 2HG5B 5I8EB 4MAYB 5ISZB 5L9DL 4MA8H 2ERJB 3SE4A 1A6AB 3NCJL 2UYLA 2FEEI 1XF2A 1MEXH 1S9WA 1QFHA 2OQJA 3RBSA 3SOBH 4XCCL 1WFTA 5E03A 4X4ZA 4M1GH 5C6TH 3SDAD 5D7SH 2EDOA 4DN4L 3OKMB 3C5ZD 3FB8A 2EH8H 5HHNB 4M61A 4M6NH 3LKSB 4F33B 2Y5EA 4XCFH 4YR6B 3BQUA 2AJXH 1VEOA 1MUJB 3T4YA 4HJ0D 5ESAA 1JPSH 2DM2A 1BD2D 4YHPA 4WI8A 4Y4FB 5FYKE 3WFCL 3M17B 4XP4L 3NGBC 3IT8D 5J56B 3OZ9H 4GO6B 5AWNH 3I6LE 4BSJA 4HV8A 1Y18B 4HWZA 2AEQL 3MRDB 2EDBA 4KK5C 5D2NC 5DR5H 5DRNA 3VXUE 1MCHA 4M6ML 4BZ2L 1PG7W 4JG0L 4RFEA 4U6VH 4KKCC 5IESL 5JO5A 2XG4A 3UJJL 4L3CA 4W6XB 4AEHL 4Y5VA 1A1OB 1DCLA 4TNVK 1MAML 3ZKXC 2OSLA 1HIMH 4QHNB 3B6SB 1T5XB 3GBNH 5DURB 1CLOH 4MNGE 1UJ3B 3PL6C 3QHZH 3WHXA 4PJ7A 2HN7B 4LU5H 2X9XA 1NC4B 3OGCB 1A6ZB 3CFEA 4LLAA 2DD8H 2QQKH 3ARQA 1F4HA 3TIEB 5F89A 2X40A 2B0SH 1FFOB 5IHUH 5F97E 4M7LL 4NBYB 4BZ2H 3GMNB 4KMTL 5AYUL 3V6FA 2ESVB 4PJHA 2DOCA 3QIUD 3TO4B 1MNUL 5HYJD 5L6YH 3GMQA 3GJFH 1LHZA 3CVHA 3QFDA 2HT4D 2GAZA 4DUVA 5DJXB 5F7YC 3RVUC 1YEDB 3BP4B 2ATPB 1GCFA 4D0DB 5JQHC 4C58B 3O9WD 3G6JA 3R8BB 4MHHI 3FMGL 1SBBA 4MXVF 4L3ED 3G5VA 2A0LD 4PTTB 5HVFB 2MCPL 4PJBF 1VPOH 4H88L 3FN0H 1S7TB 2QR0A 1U2CA 4AEIL 1OHQA 1WICA 2OCFD 3EZ8A 4PGEB 4IM8A 2R9HC 2MHAB 2BVYA 4LEXH 3DTXB 2X10A 4G3YL 2V2WB 3S5LG 4PJFF 4RZCB 3RDTA 4U6VL 3P73A 4I0KA 4BH7A 3W11D 2Y23A 3ZDXF 3K8LA 1BQSA 4JPIA 4FABH 5CFHA 1XEDA 4O9HL 2ADFH 2NY2D 1XH3A 3D6GA 2ESVE 4RSVA 3OXRB 5I71B 4C4KT 1F2XK 4MA1C 5I1IH 5DQJA 4PY8J 2V5TA 3T0VA 5A2JH 1NGWA 5JHDA 1T1WA 4ZFOB 1U6AL 2P43B 3AS1A 5GGVY 1WZ1L 5EO0B 4ZAKC 5D2NE 1NLDL 5BZWA 2KDGA 3HS0B 2X09A 3MJ9A 5F7FA 4ZUWA 3IFOB 4LGRB 1VGEL 2F19H 5D5MF 5D7SL 2DWEB 3SDDC 4AEHH 1AO7D 4YHYC 3E8UL 2X6MA 1CLYL 4PJDB 4Z7OF 3EFFA 3PABB 3WIIL 4HUNB 4TULL 3IDUA 5FGBA 3QXDA 4HUVB 5MEOB 5BOZG 3I85A 4XWOC 1ADQL 3DUSA 3MBED 4CVXB 2AGJH 3EOTL 4X6DB 5BV7B 4IMLA 4WI6A 5F8QC 3V5HA 4GG6B 1NJ9B 2R2CA 2DLHA 1IQWL 3VMOA 4HK0A 2AEWA 4XGZA 1ERNA 2A6JB 3GIVB 3WFZA 3UAJD 2VC2H 4OZIF 2DWDA 4LCWE 2EYTB 1BD2B 12E8H 3QPQC 4XBEL 5TDOA 1I8LC 1QSFB 1ZHBB 3NA4A 1S7VA 3V2AR 3U0PA 1F11A 4LKXB 1IC7L 4N0YL 5GRWA 2BHYA 5JW4M 5T1KD 4P46B 2BOBB 2W60A 4U49A 4ERSH 2DIBA 5JQ6H 1EJOL 5IUSA 5IBUB 3F7VB 4CADB 4EI5A 3EDEA 2J88L 3IAGC 3LD8C 3LPFA 3O6FA 2PNDA 5DI8B 3QIBA 4ZD3L 3RIAK 2IQAA 3EGSA 1LO0L 1R24B 1A6WH 2Z93B 1RZFL 2YD5A 4WO4A 1FSKC 3QDAA 4EZMA 3IS0X 1FCGA 5J13B 1QRKA 1U8LB 1W0YT 3TESA 2LABA 4R8WL 2WWKT 5GGSY 1ITBB 2A9NL 3D1MC 5F9DC 3DUUB 4ZFFB 3KWWB 4U2YA 3NZHH 4U1HA 4GMTH 1NAMB 1DBMH 1SMAA 4PTTA 1I1FA 4AENA 1Q94A 3AAZA 4P5MB 3OKMA 1AGFA 2FBJL 2V5RA 4ODWB 1S7XB 2ZUXA 2UUDK 3SE8H 1R0AL 3MLPA 4DN3L 3PG2A 4CMHB 2FJFB 4JKKA 3KLSA 2IQ9L 4ODTH 3X3GH 3UMTA 3ULSB 25C8L 1FYHB 1NDMA 3FJTA 3BE1L 1D5XB 1D5ZA 4FXKB 4NC1C 3P4LA 4MJIE 4Y19E 4CU7A 4ODHL 2DM7A 1FV1A 4IRJA 4MB5A 3GMMB 2W38A 1QSFE 3SDYH 3L3HB 5B39A 1XF1A 3S97C 4Q2ZA 4JKPH 4Y7MA 1YNLL 1RUQL 4UIKL 2DTML 1ZWIB 5LXGH 4QHKI 3UYPA 4NKOA 5EOTB 3SDCB 1QA9A 3MLRH 3RA7L 1ED3A 3NPSC 1CCZA 1X5AA 3FT2B 2IADB 3G9AB 3KPSE 4Z77A 1P7HL 2MFNA 1FVCB 1S7SA 2Z31D 2IGFL 2W0FB 4TRPH 4LIQH 1U8PB 3O3DA 2XN9B 5FV1L 4NN7B 5CBEB 2XXCB 1A6UH 3UTQA 1JTTA 2YD7A 4IOFC 5T3XL 2X4TB 1I4FA 2QL1A 1S9YA 2IBBA 5D1XB 2C1PB 35C8H 1CLOL 5GS0L 1XCQB 2D7TH 1LNUB 4PG2A 3VI4F 3FZUD 3RIFK 1OB1A 4PRAB 1MCFA 1XGPB 3MZTA 5DUPL 3LKSA 1KPVB 2WUBH 2D2OA 1YMMA 3MV7A 4HKZB 3KR3H 1HSAA 4HULB 3HUJE 1MFBL 2J8UB 3BE1H 2EIZA 3MBXH 3OTTA 4JFQB 3T0XA 3B3IA 4Y5XC 3I75B 3ZYOA 3HE7D 2FDBP 1MLBA 5I1LA 4ZS7H 5DD5L 3WDJA 2R23A 5C0BB 2NW2A 2NX5D 5GGUA 4JFED 5C07E 4M7ZC 4U1KA 1LQSR 5B21A 1YECL 1GIGH 4JKPL 2C3VA 4NNXA 5FECA 3LS4H 4RZCA 3RDTB 3V6OA 4RFOH 2AK4D 2FLBT 5JUEH 7FABH 5KJRL 4NZJA 2OL3B 5GGRY 4BJLA 4YGAB 3BH9A 4LPXA 3LEVH 1TFHA 1NL0H 1OAQL 4KJWD 3DWTA 3VFUB 3O8XD 5IBLC 4UDUA 5DURD 1A6WL 5FV2A 3E2HC 4PGZA 3V8CA 5ABDE 3MV7D 1M6OB 5CMAB 4OI9A 5KN5B 1IGFH 1D6VL 4ZOBA 2GIYA 3TVMB 3T2NL 1G9NL 5FYLE 3FQUB 2Q86B 5IJVB 2YPKB 5HDBF 4MSWA 4YC2C 1KJ3H 1JYNA 3JWDH 4UUJB 3H0TB 5FKAA 3KJ6H 2DM3A 2PW1B 5C0BE 1GJIA 4KQ4L 2CPCA 5DVMA 2ZOLB 5EORH 5F9WC 5HI5C 1X7QB 4UU9B 3N1MC 2I24N 3D0LA 3HRZA 2R1XB 4KRLB 4ZMAT 1AY1L 1J5OL 2P8LB 2XT1B 4I5BA 4M43L 3KS0J 3NACH 5KTEL 4H20L 3VJ6A 2XPGA 5TDNA 1A7RH 1V3KA 2OL3L 3SCMD 1JWMA 4OV5A 4XHQA 4PV9A 3RWGB 1V3LA 3H9HA 3MNWA 4RCAA 1IAKA 3ZO0A 3LRHA 4EDWH 4JPKH 4BQ8A 1HZHH 2F5AL 1KPUB 5DT1L 1EEZB 3GSXB 4RISL 2QEJA 3EBAA 1PDKA 4L29A 2EYRA 5BMFH 1TCMA 3HC0B 3TBTB 2X5PA 3K1DA 3PGDA 4QTIL 1RJZA 5IG7A 1CLZL 2SEBB 3SQOL 2Z93A 3O41B 1F8TH 2VC2L 5I15H 3BESR 5KS9B 3Q1SL 3BDBA 2KZWA 3KPQA 3WLWC 5F44A 1J0KA 1CGTA 4DVRH 3SO3C 4IRZH 2ATKA 3OXSB 3DETC 5KVMC 2NTSP 3E6HB 4JM2C 5D1QC 3T2NH 4EUPA 4HGKC 4HBCH 2X4QA 3MLYH 3SCMA 4PJBA 3BP6A 1N5YH 2NY6B 3VGAC 3EDKA 1SJEB 1FNHA 1HSAB 1MCWW 1NL0L 5FDWA 2B0SL 4F7TA 5DFWH 1J9CT 5IQ9B 3SY0B 3C8KB 4I77H 1HHIA 1J0YA 5I1LB 4NJ9H 1VGEH 4WHCA 4ZO8A 4OD3H 5MHSE 3H42L 4ODUB 4XVTL 1MFNA 3B2UD 4NKIL 1JMZA 5TDPB 5T3ZD 3MRNB 3QXAA 4TVSa 5ENWB 3MMEA 4LBEA 4KFZC 3UTSA 2APWA 1E4KA 2ZKHL 4RMTA 3LIZH 3RVXD 1CDYA 1Q0YL 2ENYA 3BEWB 1S7UB 5T3XE 2RCSH 3QUXD 1E6OL 3G6AA 3QG7H 1FFOA 4C54A 2C1OB 3C6SB 3HE7B 3KDMA 2IQ9H 4ODTL 3FO1A 5MI0C 2CSPA 4WFGD 4U6YA 1U91B 1JRHI 5L8JB 2P5WB 3FOMB 1JNLL 2HJKB 3H7BA 2HJFA 2VLRB 1OTSC 4LLQB 1J10A 3LRSB 4C56B 3VGEA 1FZOA 4P59L 5HYSA 3KLHD 3KLDA 4JFDA 4POZC 3NTCH 5HSFA 3LKQA 1RUAH 1CQYA 3QPQD 4WENB 2A9ML 3RWHA 1WBZB 4YFEA 5IHZB 4N9GA 1WBYA 2KPNA 4OV5B 5ACZA 3RTQA 5CJOH 5DSCB 1AP2A 1RMFH 5DFVD 3AY4C 1E4XH 2CRMA 1NCTA 3V0WL 5C08E 5I1GL 1NFDE 4E5XA 3ESVF 4Y5YC 5F7UA 1LEGA 4JM2F 3BT2L 1I7TA 5D96C 5B38G 3BD4A 1HXMA 4R90L 3MGTA 5HI4D 3J8F7 4QNPF 2EXWC 1SYVA 2BVUA 3WKMH 1P6AB 4O2EA 4M7JH 5FO7A 3L3DA 3P4NA 4URTB 1NCCH 1HIML 3MACH 1I1AD 4Q9BA 1CICD 4OFKA 5SWSB 1N59B 4N0FB 2P5EA 3W81A 1T1ZB 1QSED 2P45B 3MA7B 5JHDB 2CRIA 1TJHL 3DVFA 4J12A 3WD5L 3OJMB 1FL6A 3OF6D 3MYJA 3SEPA 1YQ2A 3NFPB 4OCMC 1CGYA 2YD4A 4MD5B 1FFRA 3VG0H 4MJ6A 2VE6B 5D7IA 4ZUVA 3KPQB 2EICA 2MNUA 1MH5B 2JLLA 1N0LA 3B9KC 4ZXBA 1PX3A 2HRPL 5ID1A 5DD6B 4YFLF 4WW1A 1WJ3A 2OZ4H 3KYNB 4PLKD 1KV3A 3C6LD 3T3PE 5FAAA 2X70B 4ELMB 2XFXB 2XV6B 4LKXA 5IW1B 3QUYD 4QRRE 3GIZH 3EYSH 5IMKA 4RMRA 2ADJB 3ULUL 3IF1B 4UBDC 3AXLA 4LEOA 3WIHA 1YYLH 4P5TD 2YRPA 2DI8A 4JDVA 1DBAH 4HWUA 2WIIA 4OLYL 4QHMB 2A6JA 4ZD3H 4XMKL 4UT9H 5JA8B 4XNYL 5J3HC 1RZFH 1BVLB 3FO1B 1JUFA 1U95B 2DQHL 4WW2C 4G6KH 4PJAB 2YRZA 3DGGA 3K0WA 2CDEA 2P8LA 3KXFE 1W72L 4ZTOH 2V7HB 4UTBL 1PKQE 2B8OT 4L8BB 3ROLA 5ESQA 1FFPB 4JRXE 1I8MB 5CZVH 5ANME 4NT6A 4PRIB 1PFCA 1CDJA 1RVFL 5TE6L 4XTRD 3MRGB 4GAJH 2FIRT 1ULVA 4WWKD 5EBMB 5AG8A 2C5DC 1U3HD 4KV5E 2DQIH 3V0VA 3FQXA 4U2ZA 2NY7L 3VXSA 5A40E 2C3XA 3I6LD 3VRJB 1YY8B 1JN6A 1DLFH 2OS7A 3RWCA 3VXTB 1RAMA 5JA9A 2W07A 1AQDA 4G5ZH 1DQDH 2BSRA 1UWGH 1QKZL 4XMPL 3KGRA 3PWLB 1F4XL 4ODXA 5DD5H 4FP8H 4Y0GA 4S10A 1AD9B 4TULH 2BJMH 2XTJB 4YLQT 1UACH 3BPNC 4IJ3B 3U9PL 1P7QD 2BNUA 5DRWB 4YHKH 4WV1A 2RGSA 4R7NB 5GJSH 2X4QB 3SCMB 3W0WD 4WCYH 4M5YL 3V0WH 2DB8A 2EYSA 2XNAB 3LEYH 4YDKL 4YWGH 1DQMH 2MQ3A 2YUZA 4GSDH 1T0MA 3S5LA 3QUKA 2Z4QA 1MCCA 3BQUB 1GZPA 1DR9A 1BFOB 3ZE1E 5SWZB 5IOPB 1CFSA 3R4DA 5DRXA 5IGXH 3MV9E 1HK6A 3L3DB 4KXZI 3ROOA 3BOVA 4WFED 1RJLA 1LDPL 3KPLA 3GRWH 5ERWB 4JB9H 3RI5F 3RWFB 1X5YA 1DBBH 5ANMB 1IGML 3QIWC 3AB0C 4HJJL 5EULV 4K3JL 4N5ED 4PJ8B 4LRIA 2NLJB 5C09E 1BQUA 3KWWA 2H32H 4RX4A 4YK4B 2UWEE 2N7AA 4EEEA 1HN1A 1Z3GH 3H9SA 4R0LB 3OKLA 2GK2A 5C09B 4BH7B 2IG2L 3CLFL 1ZT4B 3VXPA 5J89A 4NQXB 4TSCH 3LB6C 1F3DJ 5H35A 5KW9L 2COQA 4K3HA 5GISL 5LKNA 2J6EH 2ZWLT 4D0BB 3CDYA 2CXKA 4PPTA 5IVXB 3QXTA 5KAQF 4YHYB 1FO0B 3U1SH 3LRSA 4K3GA 4WUKH 1L7TL 2IPTL 2VUOA 2D7NA 3P9LB 5ID0A 1AO7E 3P77B 1VHPA 3FFDA 4ORZC 3ZL4H 2LAGB 4G9FD 3ROOB 5FYLH 1FGNH 3BYYA 1BZ7A 1A7NH 5FA4B 3MLRL 1MEXL 4JKMA 5BRZD 2QSCL 3BDYL 4FTVD 4DZ8A 1MOEA 4LQFH 2GY7B 5EOQL 3BKJH 3B9AA 3QHFL 5C7XH 1QYGL 4F57L 3KPLB 3O8XA 5SX4H 1S7QA 3EO0B 4ZSOA 5C0AA 1F3DH 4U4BA 1FAKT 4ZUUB 1PLGL 15C8L 1T83C 1TVBB 4JM2D 4XC3H 4PJ9B 1RJYB 2HVKA 2IAMB 3V5HB 2AJUH 3RNQA 1B4JH 1ZK9A 1UZ6E 5E8PA 5J1AB 4FQCL 1RD6A 4FN0A 4JFHE 1I85C 3CU1A 4X7FC 2YUXA 4RGNE 1A9EB 3RIFF 1ORSA 3RUGF 5DQ9A 2JJWA 4NRZA 1KF9B 4F9PC 4QEGA 4MXQC 3TZVC 1R3KB 1AIFA 4ELKA 5I18L 4LAQL 4GG6F 1I3GH 1OSZA 3C60D 3OBAA 3TBSA 5FYJH 2VERN 1Z6JT 2EDDA 4FQ2H 4YE4L 1NBYB 5CEYA 5DJ2B 5LGHL 5KTEH 1UWGL 5DEFA 1N5AA 2HRLA 4XAWL 1P84J 1LDPH 1R3JB 5TF1L 3U0WL 2F58L 4PJDF 5C0AD 1I8KB 3RL2B 1TJGH 5C70A 3U4EB 2DQUL 2IJ0C 4WJ5A 2YD9A 4R7NA 5JW4N 4LLUB 4DGYH 4KVCH 3HG1E 3KS0H 4Q0XL 4ZQKB 5BJTB 3VD3A 2YC1A 1ZLVK 1JGUL 4RGNC 5DT1H 1JTPA 5GJSL 2FSEB 2F53A 3IDXH 1CDUA 4TVPE 4EVNB 2NYYC 3KJ6L 1WWAX 3F7YA 3BAEL 1PY4A 4GRWB 3LS5H 2KUTA 3LKQB 2JB5L 3WL9B 3JV6A 4GQPH 5GSVB 2H45A 2AK4A 3N9GL 2WBJC 4XP9H 4QXTB 1W72H 5EOCJ 4X7EC 43C9B 1U92A 2YXMA 3LOWA 3WIIH 4QLRA 5F9AC 1XGQA 4X6CA 3DX7B 3UX9B 5BVPH 1ZV5A 4FFYH 3WXVL 5C2BL 4X80H 3RNKA 5E2VL 4PD4K 3P9LA 1J11A 3O2WL 4KRNA 4WUUB 3QEQD 1ZT4A 3VXPB 1M7DA 3GMOB 5IWLC 1FNAA 1INQA 4YXHH 3PWPE 4OAWA 1EBPA 4QY8A 1UM5H 1V7NL 5T1LD 3V4PH 2CLZA 5C0BD 4IDJH 4WGVB 5CBAA 4YE4H 1CE1L 4KY1L 4EOWL 5HI3C 5EC1B 3MRQA 5IROC 3VH8A 1MCSA 4D0CA 5FYKU 5FYLD 2ADFL 4ODUA 1T2QH 2VDOL 5CKAA 4GLRH 2LU3A 1JGLH 2YHGA 1NGYB 4PJAF 4M61B 5FIEA 3TO2B 3D87B 4NQEB 1YEJH 3BHBA 3QUXA 4YHML 3C5SB 2UZIL 4V1DB 2LU4A 1YC7A 4QXGL 4LVOC 4Y16A 4ZUTA 3KYNA 4KQ4H 4WO4C 4D8PA 3WHE0 1DQLH 4MVBD 3QI9A 3KPPB 4EUPH 5C09D 1OB1B 3HC4L 4I18C 2IAND 1TZGH 4PBWD 5EFIB 3RZCD 3RNQB 2IH1B 2BVPB 2VO5A 1FLRL 4PJXB 1OAYH 4U05A 4JQIH 4XNXH 3IXAB 2QJDA 4Y4HA 4Z7VE 2CDGA 4GG8A 1YJDL 3N1FC 1I75A 5K93A 1RMFL 4YQXL 5CHNB 3E3QE 4K07A 3CGTA 2XKNA 1W72A 3FQWB 1KCUL 1K2DA 2HKHH 2JE8A 3BZEB 2R0LH 3VCLB 4X6BA 4XAKD 5I1HH 1HXYA 4HK0B 5DJXA 4D0DA 3KPSD 1CFTA 1U3JA 4GSDL 1PY9A 3V0AC 4PRIA 4N0CC 4N8VB 3L5XH 3WFHA 1R5VB 3P0GB 4YH6A 4JFFB 5DTFA 1YN7B 1U8KB 4ZQKA 1PG7X 3QFJD 2R1WA 2BRQA 5BJTA 4OF5A 5H35B 5MENA 1FC2D 4O58L 2WAHA 5EOCL 1I4FB 4NZUL 2EIDA 1F58L 1ZLSL 1KN4L 5KBNC 3NCYS 1QOKA 4U0RB 2XXMB 3BSZL 3WO4C 1OGAD 5FGRA 4E41B 4JN1L 2W0PA 1CK0L 1LO2L 1D5IH 1N3NA 3VGFA 1LEKA 4G8GE 3UP1A 3MGAA 3D3VE 4ZAKA 3IDMB 4OD1H 1JPGA 1A1OA 1N6UA 2E27L 4QHUA 1OY3B 4HIXH 4KDTC 4Y89A 5DQJB 1OAZL 2H2PC 1KLFA 5JDSB 1JYVA 4PRID 3TO4C 1WFOA 3AS0A 4NDMB 1S8DB 5DD6A 1I7RA 4JRXB 5FCSH 1U3HC 2C4XA 1EMTL 5J1AA 2ED7A 3BN9C 1S3KL 5H2BB 3KLAA 3WN5B 1T0MB 3S5LB 1EERB 4HWZB 5KSBE 2PXYD 2W0KA 4KROD 1J0IA 3KNBA 3LZFH 4UNVA 5E00B 4OTXL 4XVUC 3X3GL 1HHGB 1CFNA 4P2OA 2NXYB 1CVSC 2J88H 2NZ9C 1OGAB 1XH3B 1JPTH 4RA0C 3S98A 3EJYD 4HT1H 5F1NA 3TEUA 2J8OA 3WUWA 2AEQH 4JDZB 4YHOL 4XCYB 4XPFL 3TO4D 5B39G 2HTKD 1R3IL 2A6DA 4NGHH 1ZE3C 4Z7VA 3IETA 4LMQI 4WGWB 1JF1B 1IAKB 1D5MA 3QEQB 1OM3H 5IG7B 2IBZY 3B43A 4EI5D 1F45A 2MWCA 1JNNH 1T6WA 3T2PA 2R39A 4RWHA 2X4SA 2R1YA 1DBJL 3MBEB 5KVFH 5C3TA 3MJ7B 5I1DA 1VERA 4HKBB 1CDCA 3NPSB 5EBMA 5F7WC 1JHKH 4M6MH 1CXIA 4P23B 5F70A 4LDOB 5F6HI 2VUYA 3ET9F 1RIHL 4K3DL 4X5LA 2HP4A 2O5ZH 2A77L 4K2UH 5ELIA 3I02B 4HUWB 4G6KL 4PRPD 3O6FD 5DO2D 1YPZA 2CO6B 5C9JA 1BJMA 1BREA 3Q1SH 2WZPD 4MVBC 4S1RH 3GO1L 2ICWA 4OGAD 3UBXA 1KPRA 3VFRA 3DI2B 4WO4D 3SO5A 3D3VD 1A3LH 4Z77B 3ZE2F 4NQUA 4NO0B 5FA3A 1TTFA 2HTLD 1VESA 1D9KA 1FZMB 5TDPA 4X9IA 5IFJB 1L9NA 3S6CA 4H25A 2GI7A 5TE6H 4I2XE 3QXUA 1SJVA 1U9KA 3MLXL 1CICC 3EDJA 4DEPB 4EBQH 3CPLA 2CGRL 3VFGH 1OQOA 3FQTA 3ZLQC 1IC5H 2EIBA 1FG2A 4L4VA 3HI1A 4WFFE 3JV4B 5D7JB 2R0ZL 3X3FL 4F58L 3ZDYF 4D94A 3MRDA 4I5BB 1N3NB 1AGDA 1BX2A 4N8CH 2XNAA 4JG1H 4X5WA 4DUXA 3QXWA 4OZFB 3VFTA 4K9EL 3VD4A 4X6CE 2NW3B 5SWQA 4PJFB 32C2B 4X6EB 4EN3A 1T6VN 4YNYA 3SJVB 4RA3A 1CWVA 3QZWA 1M4KA 2Q6WB 4OLUL 5DRWA 1U93A 3DUSB 2XI9A 2AK4E 2WANA 2VLMD 5CSZB 4U1KB 3EYFB 2O61A 1YEIH 2DKMA 4NCC2 3ZTJG 4O4YL 4AEIH 2CLRB 2AV7A 1T3FB 1S7WB 3PP4H 5EBGA 4PBXA 5HY9A 5DUBB 3NIDE 3OKOB 1CTOA 1BOGA 4O51A 3O2DL 4DAGL 1FBIH 2P47B 2AI0H 1S7XA 1JPGB 1N6QH 4PGDB 1OT1A 4Y1AD 4L8CB 1MPAH 4IS6B 4ZPTB 2QR0B 4FQ2L 3D85B 1SEBA 1JK8B 2ENSA 5IMLB 3WIHL 4UNTA 1M71B 2X1XR 3ZKXB 2NZIA 1A1MA 4MXWL 3SDCC 1BQHB 4JFFD 4KTEH 1KG0A 1LEGB 1TJHH 4Y16C 3PQYB 1MIML 3BZFB 1Y0LB 2NY6C 4KHXH 1WGOA 2ZUYA 2OI9B 1TZHA 4CADA 5GRYA 7FABL 5KJRH 5CCKH 5FCUL 4X6EA 4TVPD 1CG9B 1EAJA 3HZKB 1MIEL 2J5LB 4JHAH 3QFJE 4HEPG 4R90H 4UAOC 3WHXB 1C5CH 3D69B 3C60C 1CD1B 3O3EB 3WXWL 3ULVC 2IGFH 1UZ6F 2WNGA 3HPLB 4PJFE 3HNSL 3O6KL 5JHLH 4PJ8D 1KPVA 5BO1H 1WIOA 5A2IH 1PSKH 5C0AE 1XR8A 3VI3E 4R96A 1FRGH 2DQTL 2WV3A 3TM6A 1MQKH 1ZVSA 1FZMA 2Y6SD 2OTPA 4JFEA 2VL5B 4JO1L 1BFTA 3LQAL 2XG5A 2VITB 4KKBC 4DAGH 5A2KH 4Y5XB 3U7AA 1TZGL 2AJVL 1YPZB 3BN3B 3BZ4B 3NA9L 2OJZL 2WK2A 3G5YA 1IGCH 3SJVD 4L4TB 5I75C 5HYQB 1MWAH 1FH5L 4YFDB 1A0QH 3ARFA 4M48H 5JXAH 2AXFB 1ZGLM 4OLUH 4Y88A 3CFEB 3EO1B 5I6XB 3QNYB 4JM2B 4P0DA 5DMGC 3ORJA 5I73B 1C16A 3ULVD 3G5ZB 2CK0H 2DQTH 2WINA 4HJJH 4JPWH 5EUOB 4K7PY 3I84A 2ZOKA 4WFHE 2I07B 1XMWA 2BDNH 4DN3H 5D72L 1KIRA 1EEUA 3H9SE 1F2QA 1HXMB 4L3EE 3HAEA 5I8OH 3LQZA 1X5IA 4FRWA 5D2LF 1U3ZA 5E9DA 5JIIA 5HYIA 2IEPA 3SDDB 4R8WH 4TNWF 5GRVL 4YHLH 3ARBB 1DEEA 2Y6SC 3INUL 4NKIH 4NQCB 4A6YB 1H3PL 4U6TA 1U93B 5HDQL 3MRGA 4DKFL 2DBLH 4ZDHA 4YBQC 2HJLA 4PRPB 4Z5RB 3IAPA 3VWJD 4I1NB 4E9LA 2V2XA 4MJ5B 2FIKB 3SE9H 4OCSH 2Y07H 5H8DA 4NC0B 2OBGA 1FJ1B 1BBJA 4OCXH 3MOAL 3U4AA 5BV7C 5HVWA 4GBXB 1MCOH 5E8DL 3QEQA 1I1FB 4AENB 5IB4B 4K7FB 1EZVX 2IADA 2B1AH 4HHAB 5FO8B 4J8RB 1UGNA 3D85A 1V7ML 4NBXB 3MCLL 4M93B 5ICYB 3ZKMC 2ZG3A 4TSBL 3BGFB 4PV9B 2Z8VC 1JVKA 5A3IC 4Y4HC 3EYOA 2PO6C 3BGAA 1B9ZA 1RHHA 1EHLL 1UB5A 3BIKB 5B3JE 3LH2L 5HTSA 1KPRB 3VFRB 2J12B 3WDHA 2ITDB 4PV8A 1QFWH 4N0RA 2A83B 2BERA 3QUYB 3GI8L 3MJ9L 4G8GB 1FZKB 5HHXH 3DMMB 3HKFA 3QIWB 2FX9H 2RHEA 3PWJB 5J1TC 1OL0A 4UT6H 2EDLA 5F1SA 5SWZE 1DQQB 1HH6A 2VXUL 3BI9X 1F11B 1I1YB 3AREB 3MO1A 5FDYA 4HPOH 3R1GH 4J3SA 4XBGA 3RGVA 2VL4A 5L2KD 4WHYH 2P42B 1F4XH 5ANMA 2YA2A 2VDRL 5CIPB 3KYMA 2RJMA 1FJ1A 3WS6C 1L6ZA 2AJYH 5EUKB 2IBZX 2VN7A 1C5DA 3RVVD 1G9MH 2GITA 2Y25A 4TPRL 4ETYA 3LDBB 4KGLA 4XBPA 5B4MC 4HDIA 5JPNB 4LCUA 3L1OL 5F9OH 2F9BT 4Q0XH 4U33A 5IW6A 4QGTA 3QRFM 1MCWM 5FK9A 1ZHLB 3F58L 4IOFD 3QNZA 3DX9B 1G7PA 3MRNA 4GAYA 1P9MA 1QFPA 3J7HA 3UC0H 1QLEH 2V7NA 2IH1A 2X1OA 4NWTL 2EDRA 4PD4J 4DZ8B 3TNMB 4OLXH 2ZCLL 1JK8A 3ZTNH 1DZBA 4P9HC 4YZFF 3MBEA 5HVHC 1YN6A 3QFJB 4K94L 3FO2A 3CXDL 2Y07L 2V2TB 3OL2A 4IRSB 2XTJC 2FO4B 3BPNB 3KYMB 4K3EH 5CJOL 5EC1A 2W65B 4RFOL 4Q9CA 2FIKA 4M4PA 2O5XH 3A6CL 2YPVH 2J6EA 5GGTH 3MTRA 5T1MA 1E28A 3QO0A 3QWRA 3RVWC 2NY2C 4QRPB 3WS3A 2DBJA 1QHPA 4P3CL 5J6HA 3PJSB 4QRRB 1B88A 5IEKA 3DLQR 5E2UL 1ZEAH 1GPOL 5T1KA 4HDIB 3G6AB 3SKJH 3TBVB 3QNZB 2ZNWA 3CU7A 5J7CC 2Q8AL 3BN9D 4Q97A 4LMQE 1FNEB 2D7OA 1PAMA 4KPHL 4RMUA 5GGQH 2DN7A 3IDNB 1E4JA 5IB2A 3QI9D 1HCVA 1L7IH 4L4VB 4W4OA 2ZG1A 4OZ4B 4MD4B 1FGNL 1BAFH 3MOBL 2VLJE 5C9KA 3CDCA 2IFFL 3G5VB 5DHVH 2RFXB 4GW5B 4AJ0A 3PGCB 4JJ5A 2HAZA 2W9EL 1WCQA 4NKMA 2MJWA 1A2YA 3SGJA 4JFDB 1TQBB 1ACYH 1NFDA 3RPKA 3GHEL 4KTDL 5ALCH 4G80A 5KSAB 4KRMB 3K2UL 4UV7H 5EOTA 1BIIA 4HFWA 2AEPL 2AJVH 4QHLB 3UTZB 5CHNA 4F7TB 2N4IA 3AREA 1F97A 3GEWB 5EU3B 1IE5A 2V17L 1T03L 1D9KC 4PYGA 4OZGE 3W2DH 2VABB 3QG6A 4WW2B 2GFBA 3KPRB 2XY1A 3ZTNL 3FOLB 5CEXB 3O6LL 4X8JA 4KV5F 4EVNA 4ALAL 3IFLH 4PJCA 5BZDB 3S4SB 4WRLA 3BKCH 1EGJL 1PSKL 4ERSL 2N1KA 1FIGL 4HXBH 1NH6A 4UNUA 3MV8D 2C7UA 2RCSL 5E1AA 3C6LA 5KANI 5DTFB 4G9FB 4NCC1 2XA3A 1KTKE 2ZSWB 4KAQL 1MLBB 1WSST 2PTVA 2GJZB 1GAFL 2JF1A 4F37K 1CZ8H 5D9SB 3DROB 3CH1A 1R3KA 2X41A 5FXCH 1S7RA 1OGTA 4IRSC 5EZJB 1WIPA 3X11B 1DLFL 1CGUA 4JQXA 3VXRA 4GAGL 4Y4KC 2GJ6B 4K8RD 3RWDB 4UZGA 5AAWA 3T77B 4LHUA 4OCWH 1CD9B 1QBLH 1UEMA 5E99L 1OP3H 4UTAH 3O0RH 3VRIA 5EN2B 1EO7A 2XN9D 4NN6B 4P23D 4P2RD 3MLYL 3DSNA 4A6YH 1UACL 2P5WD 1U2HA 2V2XB 1UWXH 2B39A 3P11H 8FABA 4WW1B 3RZCC 2XZAL 1YMHB 1YJDC 2YD1A 4EI6A 4ZDHB 2D0FA 5C0GB 4G8EA 4ONOA 2CDEB 1REIA 1EFQA 4JCMA 2VRAA 2Z31A 4LP4A 4WDIA 4HJ0C 4POZD 4J2XA 5I1KH 4EKXA 1E27B 1LK3H 1W2KT 3CPLB 3B2UC 1YUHA 3L3IB 1JZ3A 4UQ2A 3CNKA 3STBA 2AABL 1T66C 2Y36H 3CH1B 3LMJL 3LY6A 1AHWC 1F6AA 1L0QA 4V1DD 1VFAA 4HSQA 3VXSB 2ZSVB 4NQSB 1T21A 1NMCB 2EYTA 3IDNA 1PZUB 2H6PA 3SGJC 3GJEA 4O2EB 3GHBL 4ZFGL 3FT4B 1KJ3L 4NOFA 2XZQL 3F7PC 2UWEA 1KXQE 1ZTXL 3CMOH 3QIWA 4DTGL 2VKWA 4G7YL 4JZJC 1O7SA 2PR4H 3JSSA 4PJCE 1RK0B 3AMKA 1BF8A 1JZ8A 5CJ8A 3PUCA 4Y2DD 4NHUB 3DOSA 4G8EB 4Y1AA 3V5KA 5J11C 3NFPA 1CLYH 2HFFA 4NUGH 2ZPKL 2Q86A 5IJVA 4X0KB 4WEBL 5DLMH 4WHYG 2FD6L 2E9JA 3BWAB 4X7TB 1IKNC 4APQA 4PGBB 4Y4FA 4QWWC 4BFGA 3CDGA 4Y5VB 3BMVA 1M71A 1NC4A 3OGCA 4U31A 3PGCA 4JJ5B 4ZUWB 1HI6A 3RX8A 1G1CA 2JJTC 1NBVH 4BKLB 1BFOA 1H3WM 1GC1L 4JLRB 4UOW0 2BNQB 1VFAB 3DX8B 3QDJD 2D9QB 4LFHG 3BT2H 1WC7A 1I3GL 1JHKL 2OL3A 2VZUA 4GH7B 5FM4A 3UJIH 2C3WA 1LD9B 1G7PB 5FYJL 1OLLA 3IVKB 5E8EA 2OP4H 3NGBB 4CBPA 5IVXF 1S5IH 3RWJB 1Q9LA 5INDA 1K8DB 2CIKA 4XCNB 4YZFE 3FT3B 1IGIL 3QQNA 3CIQA 5TF0A 4LHUG 3NTCL 3VXSE 3MR9A 5HHNA 5EG6C 1NBZA 4OZIE 1FNFA 1C5BL 3C5SA 3UCRA 3PF2A 1KIPB 5D1ZB 3OGOE 5CAYB 4EN3D 4R3SA 5ESVA 2OJEA 2H2PD 3ZHLA 1U8QB 1W8NA 1GAFH 3GKZA 2IG2H 3SCMC 2E6PA 4KZEH 5JMOC 4LKCB 4MQXC 2FECL 1D5BB 3V6OE 3M1BA 2GYSA 2EE9A 1KEGL 3HNTL 5BRZA 1T80A 4FTVA 2GAZB 3REWB 1ZVHA 3V7MA 2JK5B 2P7TA 1I8MA 4R9HA 4XNZB 5HI5D 1H5BB 3HZMB 3O0RL 4QRRD 1T1YB 2HLAB 3BP5A 4KUCD 1IT9H 1S7SB 3I2CL 5FGBC 4AG4H 5D1XA 5CP7B 1DSFL 4O02H 4L8SC 4QRSA 1FGVH 1KJMA 1NGXB 5DJYB 1JGVH 1T04A 4OGYL 2VSCA 1XF4A 3HMWH 4N5UA 3LAFA 3SDAA 5J57B 3FO0L 4R0LC 5C7XL 5F96H 3C09B 3MJ7A 1JNLH 1HSBB 4NO2A 4JQVA 2Q7YB 1ROWA 1UB6B 3EYQC 1KBGL 2QKIA 4ISVB 5EU6E 1KIQA 4LSDA 1HDMB 3WFDH 3DXAB 1CG9A 4J3TA 4UV4H 5E4EC 2HJLB 2FX8L 1GC1H 3A6BL 1CDHA 1J88A 4LU5L 3PHOB 1MREL 4L8BA 4G8IB 2A73A 2JB6A 4PUBH 4M6OL 1AXIB 5HHOE 3S8WA 5E9DB 2R0KL 3BO8A 4GJTB 5D4QA 2IH3B 4ZUTB 1RIUL 3VFOB 5KSBF 3SDXE 4AZ8A 4W68A 3VXMD 4L8DB 3SKMA 1ZMYA 4JO4L 3BHBB 4RAHA 5C08D 2DKSA 4E42B 5B3JF 1RULH 5HGDB 3IGAB 5CJQL 5EC2A 5FO9A 4DZBB 2WIMA 4F7EA 3LCYA 2UZYB 4Y8AA 5EZJA 3X11A 3EYUL 4MJIA 3L6FB 2IAMC 3QJHA 3VG9B 2YKLH 1YEDA 3GSNA 1E6JL 5K9KA 4HBCL 3O3AA 5FUCC 4GQ9H 2GJJA 4N1HB 5F1NB 2OLDA 1IAII 3GSQB 4PG9B 5EA0H 3E3QC 5FHAL 1HSBA 4NO2B 3EGSB 2EC8A 2YBRA 4P2QE 5FYJE 4F9LC 5C0CD 4P4KC 3B4NA 1BEYH 1ZGLB 1XFPA 4EBQL 2ZCHL 3NZ8B 3DUHA 3QIUA 5L8KB 5GS1C 1X7QA 1QRNB 2BMKA 4LPWA 3OG6B 1ES0A 5LGJA 1RJYA 2HVKB 2IAMA 2EYSB 4WO4B 5I8KL 2X4PB 1VKXA 3I6GB 4WFHD 4P46A 2FECI 4HGWA 4LCIL 4PLJC 4R4FH 2JB6B 4L3EA 4FQQA 2X4UB 1FVCA 1BIIB 1JP5A 4N1CA 2WP3O 4X98B 1UA6H 1QTYT 4PJAA 4U0RC 5ACZB 5L2JB 4LQ1A 5C08B 4G7YH 1W0WA 4FNLH 1BJ1J 1OW0C 3NMEA 2R0ZH 4QRTB 3T0AA 3UTSE 3X3FH 3BRFA 4LHJB 5J6GA 3WHE1 5FYJD 1UM5L 1NAMH 4OJFL 2Y7QB 3UDWC 4ONGL 1TZHB 1MRCH 1HHHB 4Y1AB 4Y16D 5DLML 4GRLA 2APFA 5GSRA 4ODVH 1Z2KA 1PKOA 3JWDC 3U46B 4R2GB 1EDQA 4XXCA 4K8RL 1U8IB 3IFPA