1SY6A

Crystal structure of cd3gammaepsilon heterodimer in complex with okt3 fab fragment
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
204
structure length
168
Chain Sequence
MQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OKT3 Fab light chain
publication title Crystal structure of the human T cell receptor CD3(epsilon)(gamma) heterodimer complexed to the therapeutic mAb OKT3.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/antibiotic
total genus 34
structure length 168
sequence length 204
ec nomenclature
pdb deposition date 2004-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1sy6A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1sy6A01
1NJ9B 2VDKH 3P4NA 4HT1H 1KPRB 4KJPD 4X6DB 5C6WH 4NKOB 1DJSA 5T1LB 2C1OA 2W60A 4MNQA 2CDFA 1INEH 1X3DA 2R0WL 4PREB 4TNWF 2IANE 2XI9A 4RRPA 5HVHB 3GSXB 4O2EB 1MFCH 4AMKL 4XTRD 2DIJA 1MY5A 4IDJH 1T2XA 2BCKB 2R0ZL 2Z8RA 3SDXA 4MDIB 5DVNA 4HV8A 1CZ8L 4GMSL 5HI3D 3ZMRA 2R15A 5CINL 3GSQB 4HLZG 4X4MA 4XAKE 1J5OL 1DQQB 2P5EE 1NCAL 1CGUA 4S1QH 5FGRA 4KQ4H 2BVQB 4R0LB 7FABL 4HIXL 5IB1B 1KGCE 4M7JL 3O45A 3OKNB 1EGJH 5GGVH 2JCCF 2XPGB 4KRPC 3VXQA 5KN5A 4PTUA 4LSVL 3R06A 2XV6B 4K55A 4G8IB 1WBYA 4FQCH 2JB5H 1SM3L 4XC1H 5IW6A 1QFUL 4JO1H 4HKBA 4HW6A 4L8BA 4YHKL 5GXBB 1QNZL 3DURA 1TLKA 3S88L 3CFDA 2A0LD 4BFEA 4A2MA 1OAQH 2IBGA 4HWNA 3ROLB 4OD1H 3WIHH 3ARBD 2XOTA 3KYNA 2VWEE 1Q9WB 1T21B 3QUKB 4N5UA 2OSLB 2R1WB 4PJAB 2NTFB 5FKAB 1U3YA 4QRRD 3KPMA 4FXGB 1C5DA 1B3JA 1TQCC 2EKSB 5IMLB 1ORSA 3H3PH 5E5MB 2HP4A 5GHWH 2YA1A 3O41A 4F8TA 2DRUA 1U8MA 3AUVA 2V7HA 4L3EA 5D1XB 4JFFA 5LKNA 3H2WA 5EU6D 1FZKB 2EDQA 2AQ2A 2EDRA 4LCUB 4PJFF 1JNJA 1QPXA 3WKMH 5IOPB 4C56E 3GMQB 3GBML 4L4TE 1JGUH 3VGEA 5EA0L 1SJVA 5HI4C 4I2XB 5HGBA 1UXSA 1KFAL 3ULVL 1ZV5A 1KPVB 3DX9A 1X5LA 1HHGB 3MXVH 1HHJB 4ZQKA 5ERWB 3TJEH 3UJJL 1CQYA 4MD4A 3P11L 1QD0A 5DJYA 3BP7B 4Y1AE 4ZD3L 3BIBX 3E8UL 4TULL 1E0OB 1Q0YL 3OR6A 3EYUH 3TO4C 3T0DA 2XKUA 5EORH 1RZJH 1NL0L 2FO1A 3O8XD 4KKCD 4Z77B 2YXMA 4XP1L 1J1XH 2OL3A 3ZKSD 2VL5B 4G3YH 1QYGH 2GJZB 5CLTA 2UWEB 1G7HB 4NQUA 5F7EL 1UA6L 5EO9B 3VFNB 3EGSB 4P4KC 5C0ND 3EW3B 1V7MH 2IEPA 3DECA 4IHOA 5TQ2H 4CKVX 4BUHA 2VLJD 5D2LA 4M9OA 5FYKD 1NMCC 4YXHL 2ZJSH 4GLRI 5JQ6H 3CFBA 4JG1L 3JWOL 4PBWD 1MQKL 1DN2A 5C8JB 5HVFB 3RWFB 4L3CB 1KJ3L 1KIRB 4NQVA 2K7PA 3K2MC 3EYOA 3ULUE 4Z7WA 1T5WA 1OVZA 4ZUVA 1KCSH 1PY9A 1QFWI 3MRNA 3KYOA 3TBTB 3NZ8A 1T6VN 3S37X 2JELH 3KR3L 3E3QE 3U7WL 3I75B 4U1LA 3BKJH 4K8RD 3ME0A 1AKJB 3DO3A 4OD3L 3P9MB 4U6XB 4JFEE 4R4FH 2EC8A 3ARGD 4MD0B 3MLWL 5KZCB 4NCDA 4JCMA 4QHUA 1FVCB 4MD5A 2XRAL 1XGUB 1PG7X 3KPRD 4YDVA 1EAPA 5TE7H 1M05B 4LSQH 1G7QA 2DS4A 4E42B 3TN0D 5ETUB 2YBRB 2ZZUT 4PP1D 2EXWC 1VPOH 4WUUA 2H41A 3IFPA 4FQXD 1LO5B 2EZ0C 5DMIL 2HJLA 1WK0A 5E7FA 1TENA 1NKRA 4NOFA 4QXUH 1GC1H 3QDJE 3RWEB 1QR1A 3D0VB 1HINH 3GIVA 4HUXA 4AEIH 1ZHLB 3BKML 2P48B 1DQJB 3M07A 5GGTH 4LDLB 5DHYB 1MNUL 2ZOKB 1MFAH 4OV5B 4PRAA 2RFXB 3O6ML 1RIUL 4OFVA 4UIKH 1RZKL 1TVDA 3UYRH 2LABA 5FUOL 4Y8DC 3JTTA 2J88H 2YD6A 3ALWA 3AS2A 3UCRA 4JO2L 1EFXB 2R56L 4X5XB 5JW4Q 5BS0B 4WGVB 3PIQB 1CG9B 2GSGA 3KGRA 5CMAA 2CJUH 1S8DA 4DZ8A 5CGYD 5IBLD 1UACH 1MJUL 3G9VA 32C2B 3W39A 1ORQB 1LE9A 1GOFA 3UTTE 1FZMA 3OB8A 2JLLA 5CHNB 3DRQA 2R2CA 1KEGL 2F54B 1D6VH 2X09A 2PNDA 1HKLH 2DLFH 3TP4A 3VFPA 2C26A 1T66C 1KCUL 1A22B 3BH8B 1A14L 3FHQA 1ZWIB 3OKEA 2Z31D 1HEZA 4LPVA 4PJ8D 4OCMC 3HR6A 5IJKA 1AIFB 1DP0A 1OQOA 4RA0C 4NC2B 3ZKNC 3U4BL 4ORGA 3TIEB 2Y7QA 1OT2A 2JCCE 1F3RB 3V8CA 3OPZL 1UZ8A 15C8L 2APBA 6CGTA 2V2TB 3BZ4A 4MA3B 1VACA 4PLNC 1B9ZA 2CR6A 4POYA 1CICC 1W72B 5IFAL 3AC0A 3QCTH 2Y07H 4HGKC 4WI2A 3CSGA 1NCBH 1LK3L 2DJ4A 3DTXB 4I5BB 3N85H 5J1AB 5IF0B 3VWJA 5FM8A 2Z35B 1YEFH 5GRJL 5IJVA 2BSRB 1VCAA 2NTSP 1N64L 3NTCL 35C8L 4QCIA 5EU6E 2XG5A 3SDCB 3TEUA 5DEGB 5F7HA 3PV7A 3ZDXF 2FEEL 2CK0L 1NMBL 4PJFE 1MCLA 2A6IB 5ICZB 5FA3A 5E6ZA 4H1LB 2CXKA 4HG4K 1WJ3A 4CN1A 1ES0A 3NFNA 5K9OA 4NZRL 4X5LA 2AV7B 4JRYA 2X4SA 3EDKA 2EE6A 1FNHA 1ACYL 5C0FA 4P5TC 5AWNH 3FCTA 1KPUB 1CDBA 3WEXB 5E9DA 4KDWA 5CFHA 4MQXC 5L6YL 5IMKB 3MLSH 4XC3L 5C3LD 4L8DB 1CT8A 4KY1L 1E4KC 1JHTA 1PYWA 1S7VA 4LGRB 1NAKL 4JHWL 4TTDC 1NKOA 3C08L 4NQEB 1MAML 3QQ4B 1BBJB 4Q7DA 5CIPB 4GKSB 1TTFA 3BKYL 5CEYA 5F89A 2X4NA 1BJMA 1QLRA 3O9WA 1P7KB 5I74B 5JUEL 1U8JA 3UJIH 1DEEA 2F53E 4N0UA 4WWKA 1KELH 1BREA 3GO1H 4HF5L 1LILA 4ZO7A 4PRPD 5B4MD 4MXVF 4Z8FH 1IGCL 4LL9A 3N0PB 2JIXA 5JPMA 5AZ2L 5EO1A 1AFVL 3PL6A 3V6BR 4HH9B 4LKCA 2ERJB 2VLRE 1OF2B 4KGJA 4Z0BL 5C09E 4C56A 5FO8A 3CX5J 4QLRA 3SQOL 4PR5A 4UQ3A 5KS9B 3DROA 4TVPE 1X5AA 3M8OL 1NC2A 1I3UA 3EYVB 1X6LA 3MA7B 2Y5TA 4EUPA 1UM6L 2A77L 2VLKB 3VFTA 2X89A 2X1XR 4JM2C 1QSFE 2YSSA 1XGTB 4Z7UB 1OAUL 1ITCA 2W0PA 4OM0H 1YQVH 2HT2D 3FAXA 4H1LG 5E6IC 1ZLWK 4S0SD 3ULVC 3R1GH 1M7DA 2QBWA 1FFQA 2V2XB 4JY4B 3QDAA 2Q6WA 2BNQA 3H9SD 3RBGA 1N0XH 1KJMA 1EZVX 3HNVL 1IL1A 1ZK9A 3KXFB 4B7IA 4BZ1L 4WI8A 5C2BL 4QGTA 1F5WA 1MCQA 5LGKA 3VXRB 3LCYA 2DQJH 4KTEH 1IMHC 1BLNA 2Z9TA 3TA3C 3GKZA 5DF0A 2R1YB 4NJAL 1U95B 5BZWA 4ODXA 4F9LC 3IDNA 5CEXB 5SWZB 4X8XA 5JOEA 4YR6A 4OZHF 1CFVL 3MV9A 4ZOAA 4LRNH 3PQYB 2PO6A 3QWQB 3LQMA 5DRZB 1ZGLP 2ICWA 5FEBA 4O02H 5JTWA 1J8HB 1GZPA 4YC2C 4P2OC 3L3IA 1TCRA 4LNRB 4TUKH 3WNLA 1DQDH 2AJUL 4J7RA 4R26H 5DK2B 1OARH 1PG7W 3HE6D 1VEMA 1P2CA 1AHWC 4N9GB 1U0QA 2HWZL 2RJMA 5IESH 3SDDA 4JFEA 5TPWH 1RK0A 1K8IB 4AH2A 2NYYC 4HS8L 1SVCP 2QADB 2OI9C 1ERNA 2EH7H 4WDIA 1FSKC 4PJCF 6FABH 3AAZA 1NBYB 3RAJH 1DN0B 1S9WA 5AYQA 4BSVB 3BPCB 5GGSY 5GIRB 3P4NB 5D6DA 1FORH 3BI9X 1LP9F 3EHBC 1NBQA 1P5VA 4J8RA 2C1OB 2W60B 4MNQB 3ARVA 1AD9A 3QDJA 5T1KD 2VTFA 4F33A 1H0DA 5D96B 4J2XA 4M4PA 3L7FA 4LAQL 4OCWL 1T1ZA 3H0TA 3P3YA 2PXYC 4F7MA 1ZS8A 2ENYA 3FO0H 4Y4HD 3SKJL 2D7OA 4CMHB 1U42A 4BSJA 1NCCH 5DJ6A 4IBLT 4XNYL 1BWWA 5L2KD 2NXZC 1F8TH 3SDXB 4HV8B 4POZD 3DOSA 5EPMA 1L4IA 5LAXA 5BW7A 2VXQL 2J6EH 3DBXB 4LFHG 4OLYH 3BKCH 4G7VH 4PGZA 3DETD 3LKPA 4WWID 5MEND 5DI8A 3M1BA 4G6FB 1T89A 4M5ZH 1JJUA 1UXWA 3MBXL 3QWOA 4YHOH 1SYSA 3UTTA 5T3XD 5TF1H 4XWOD 1D5IL 4AQ1B 5KN5B 1YEDA 4XMKL 4PTUB 3QBTB 4GW4A 4RGNC 3R06B 4NO2A 3EYQC 1WBYB 2R8SH 5IW6B 5BXFB 5I30H 2BSSA 1U8NA 5IFHH 4HKBB 1FCCA 1YEGL 3MRLA 3GSRA 1CU4L 1KIPA 4DEPC 3HAEH 1QSZA 3CFDB 1L6ZA 4KUZH 1DUZA 2V2WA 1FHGA 3CVIL 1EJOL 5JNYB 4LLMA 3KG5A 4XPTL 2GJ6E 4WV1C 3MZTA 5TJWK 1ZA6A 3MLPA 4TYUA 3KYNB 4ODSH 2VDRH 2KPNA 4HXAH 3QUXA 1JNLL 2D7TL 4NKIH 1FP5A 3QUZC 4FFVD 3GHBL 3KPMB 1C5DB 2ADIB 5DD0L 4XPGH 3ARDD 2VYRE 3MXWL 4M7LL 2CKBA 1ORSB 3GMLA 3OZ9L 4RMVA 1FIGL 4YDLC 4MJ2A 3O41B 1CL7L 1U8MB 3ARBA 4FHBD 2CLVA 4L3EB 1MRCL 2NY5L 4JFFB 4G6JL 4RRPG 3VXTA 1IAII 2GCYB 1P4BL 4V1DD 4AIOA 3IAPA 2O5XL 1OM3H 4NZUL 1KN4L 2GUOA 3HRZA 1ETZA 3BYTA 4JEGB 2ZUTA 3IDMA 1D6EB 4P59H 4KRNA 5KVDH 1RZ7H 5I18L 5FO7A 1YYML 3RZCC 5HGBB 1UXSB 2I5YH 1Y6MR 9CGTA 5EU6A 4I3SL 3I50H 4U1SA 2YC1A 4Z5RA 2F5AL 3DX9B 3OKKA 1OCWH 4ZQKB 1TTUA 2F8XC 1QBMH 1LO0H 1MCDA 4MD4B 3DVIA 5DJYB 4AG4L 2EDKA 2DM4A 1ZGLA 3V6FA 2DQTH 1RHFA 3UTPD 3NVQA 3V52L 3V6OC 3I02A 1INDH 1NUFA 2HT3D 5JOPE 1U91A 3NA9H 2P8PB 1FG2A 5K9KA 2OL3B 3UTSD 3P0GB 4D0CB 4KQ3H 1LDPH 4LIQL 3EYFA 4ERSL 1XGYH 4J1UA 3OHXA 5F9JA 1VESA 4ALAL 1UC6A 1CXKA 5KVMC 2DN7A 4IHOB 4KK6D 5D2LB 4BK4A 2FWOA 4LEXL 3O8XA 4Y89A 3TFKC 1TJGL 1H3VA 2YPVL 2VZUA 1CGSL 5FOJA 1WLHA 1JNNH 1AE6H 4M48H 3LIZL 2NMSA 4HFWA 5DFVC 2R2EA 2PTVA 4NQVB 3HB3D 4OZGF 5E56A 3EYOB 4LSUL 3UTOA 3NCJH 4Z7WB 1T5WB 5ALCH 3KYOB 1F4YH 1MFEL 3MV7D 3NZ8B 2OK0L 5IK3A 5C70A 4PBXA 1W2KT 4F7TA 4WFEE 5HHXL 1TNMA 2KKQA 3DIFA 4LSTL 3BWAA 3EFFA 3CVHH 5DD6A 4PJHA 4XBPA 3IF1A 5CZVH 4QHUB 4MD5B 1GYAA 1Y0LA 3WFDH 1E6OL 4RWHA 2F15A 4HEPG 4YWGH 1QSFA 2E7LA 1CE6A 3G6DL 1JZ4A 4YDVB 3TZVC 1AR1D 1FO0H 1EAPB 1BFVL 2Y6SD 5FDYA 4LHQB 1G7QB 3IGAA 5DD5L 5I16B 4NWUH 1FFOA 4QTHB 1SVZA 2VLLA 4LLYA 3IFPB 1MJ7H 4IOIA 3ARGA 2HJLB 5HHOE 2J12B 3DI3B 3HC4L 1EMTH 4F57L 1QR1B 5FHAH 3GIVB 4PJCE 1KOAA 1U3HD 4GRLD 2ZG1A 3HZYA 4C55A 3MRMA 3TN0A 1IC7L 4NQCD 4DKFH 5IQ7L 3CXDH 5C08B 1HYSD 4FQXA 4PRAB 1SEQH 3C09B 1A9EA 3C5SA 5D1ZA 5CJBA 1JRHH 3JTTB 3X3GH 2YN3A 1CE1L 4O4YL 3P2TA 2NY6D 3O3BA 3C60A 2GSGB 3MPCA 3SGEI 3VWKA 1YPZE 5JORA 4ELKA 5CMAB 2IBZY 3LZFL 1S8DB 4OJFH 4DZ8B 2A1WL 3W39B 1U6AL 3NMEA 1LE9B 2DIBA 1FZMB 5FGCE 3LKSA 3JV0A 3MGOA 3KHOA 3DRQB 4HBCH 4JM2F 5JIHA 2FX8L 4XMPL 3FRUA 4GSDH 5FUZH 1VFBA 3IKKA 1W0WA 1I3VA 3VFPB 5T3ZE 3QI9C 3OKEB 2B4CC 1HEZB 4JPVL 4HG4J 4LP4A 3ULVF 4PRBA 5DJAA 2A9NH 5DC0A 3NGBB 3T04D 1AXSA 4ORGB 4PGCA 2Y7QB 3V0VB 1KTLA 3C5ZD 2QV2A 5CUSH 4IOFD 4YEEA 1C08A 5IB3A 1PZ5A 2HFTA 1UZ8B 1NCDL 2W91A 1SY6L 4YX2H 4UTAL 5ITFB 5CJOL 1ZEAH 3KS0H 4KKBC 4PJ8A 4D0BA 4OTXH 1IM9D 4MXWL 2COQA 4R2GC 3WN5A 5HDQH 4XPFH 1BOYA 3WIIL 3TVMC 2JB6A 4HZLA 1U8IA 4QY8A 4RMUA 4JFPA 1E28A 1OB1B 1V7NH 1KJ2L 2AAVA 1MIML 3HI6H 4TSCH 2MKWA 4HPYL 3GJFH 3ARFB 4PV9A 1MH5A 5K9QG 4B7LA 5C6TL 3VRIA 1OPGL 4XT1C 3VWJB 3QFJD 1ND0A 1EHLL 4PYHA 3RUGF 3UDWC 5C0EA 3BH9A 5I75B 1AO7D 5IJVB 1LVEA 1YEHL 2NZ9C 3U0PB 2XY1A 2PKDA 3D3VD 4RFNC 1HIML 4OF8A 5ADPL 1IAIL 4WTWA 4N1EA 1Q0XL 4QCIB 2YD9A 5KVGH 3KLHD 3G6JF 3PGCA 4J3TA 1EO8H 3MNVA 4H8WL 1A7RH 2YD1A 4GG6A 5FA3B 1UJ3C 2XN9E 3E2HC 4DW2L 1HZHL 1ES0B 5K9OB 2AJVH 4JRYB 2MHAA 2X4SB 4K3HA 5HGDA 1MPAL 2B5IC 4PJ7A 4XCYA 4HWBH 4Y2DC 5C0FB 5C0CE 2GJ6A 3FCTB 3PNWA 1M4KA 3GSNH 1JWSA 5I1EL 3WHE1 2P47B 5I1DA 1DFBL 4PTTA 2CSPA 1CT8B 1JHTB 1PYWB 1S7VB 5CWSB 2VAJA 2IPTL 5B8CC 1F58L 2NXYC 4U05A 5CEYB 5F89B 2X4NB 1QLRB 4U0RB 4YHNA 2EDWA 3O9WB 4G8FB 3UAJC 1J05A 2HVJA 1J87A 1U8JB 1K5NA 4NM8H 4QHNA 1DEEB 3WS3B 4G8EA 4N0UB 4FP8L 4WWKB 3Q6GL 4ONHA 2FHFA 5GS1C 2NW3A 1JI1A 2JIXB 5D72L 5JPMB 2W0KA 5EO1B 3PL6B 4LKCB 3FQNA 4QKXB 4QOKD 3LKNA 4C56B 5FO8B 1GGCH 4L4TB 3EJYD 4PR5B 4W6XB 4UQ3B 5INCA 4J3UA 3VGBA 1NC2B 2VXTH 1YMME 1XMWA 4X7TA 4O5LL 2Y5TB 4EUPB 4D9LH 3VFTB 4OZGE 5HD8C 1YEIH 2W0FA 1NANI 1NUDA 1RJLA 4YNYA 1IAIM 1IJ9A 1K6QH 4Y1AB 4LCIL 4A6YA 5BJTB 4PPTA 2ORBL 1NCTA 4M1CC 4YBQD 4WEMB 1KTKE 4I18A 5DO2D 5E1AA 1DANU 3KHQA 4KVCH 5MHSE 2Q6WB 5JHDD 2BNQB 1I8KA 1KJMB 1FAKT 1IL1B 1CGWA 1Z3GL 4R9HA 1FGVH 1FVEA 2ADFL 1AD0A 3REWA 2AK1H 3BW9A 4JPKL 2L4OA 4FABH 4LU5H 3L5XH 3CDCA 5CAYB 1VKXA 5C0GA 3VMNA 5IEKA 1ZVYA 25C8H 3A6CH 5BZWB 4ODXB 3IDNB 5HXMA 4K2UH 4YR6B 1DQML 4ZDHA 1F2QA 3MV9B 1FC2D 1N7ML 2MCPH 4WO4C 2PO6B 4JKWA 4G8GD 2WBKA 5LGHL 2ICWB 5EZIL 3SKUD 1HSAB 3MLYL 3L3IB 4HUUA 5JW4R 1F97A 1QVOA 1TCRB 1VA9A 4XXCA 3CPLA 3PGFH 2YWZA 2OYPA 3SGJA 2GI7A 3KPSD 2PR4L 3GSOA 3L5JA 4XHQA 3I85A 4JFEB 5I2IA 1RK0B 4UDUA 3BAEH 4AH2B 1UM4L 5JZ7D 4S1SH 4UUJB 3QWRD 5IMMA 4WDIB 1DBBH 4ENEC 3AAZB 4EUPG 1G9EA 2XA8H 3MMEA 1JPSH 3QPQD 3P4MA 1S9WB 2FIRT 1NAML 2XTJC 5CKGA 1PDKA 4YFLI 1ZHKA 3HE6A 4NWTH 5CEZH 2IG2L 5F7LB 3D0LA 3VD4A 3WFCH 4JGJA 4JZJC 4GXVH 3O3EA 2NR6C 4LLAA 2BERA 4ELMF 4J8RB 3W5NA 2D3VA 3QDJB 1AD9B 2AI0H 5D7LD 4F33B 4OD2A 3N1FC 3L7FB 1FDLH 3LHPH 1T1ZB 3H0TB 2NY4B 1JV5A 1HNFA 2ZUQB 1ZS8B 1B2WL 4P2CG 3PHSA 4MA1C 2J8UF 1ACZA 4LVNB 3QIUD 2ZG3A 4YBHA 4JG0L 1HWGB 5EPMB 5LAXB 5C07E 5H94B 2YRLA 3V7MA 3R8BB 1WF5A 1YPZA 4AMKH 2WLZA 3LKPB 1A3QA 2H6PB 3M1BB 4NC1C 3BGFB 5AAWA 1UXWB 1QFPA 4Y4HA 3ZDZF 3CZFA 3QWOB 5IVZB 1QFOA 2R0ZH 3UTTB 1V05A 2EEAA 2J7LA 5L2KA 1C7SA 4XHJC 1FL5A 1CZ8H 4GMSH 2B1HL 3MOBL 4GW4B 5CINH 4KUCF 4NO2B 5IB5A 2DTML 1J5OH 1NCAH 3RWJA 3NA4A 3RUGE 2BSSB 1U8NB 5GZND 4LCCB 2E27L 4HDIA 7FABH 3OKOA 3MRLB 4HIXH 3GSRB 1KIPB 4M7JH 5HBBA 3WFEL 1IQDA 4QXGL 2V2WB 5FO9A 3TESA 3SO5A 4JY6A 4LSVH 1X7QA 5IHUL 3G6JE 2JCCB 3BEVA 3D2UD 1SM3H 1QFUH 3QUXB 1PSKL 1Q9OA 4YHKH 4JFDD 4IJ3B 2E6QA 1A47A 1B0RA 4H0IA 4PJIE 5DJZA 1QNZH 4NNPL 5BV7B 1J1PL 3H3KA 3S88H 3MCLL 1EJ6A 5IVXF 4EQ3A 4RMQA 2CKBB 3GMLB 1OAXL 2UV3A 3MGTA 3NPSB 2QL1A 5FKPA 1R3KA 3ARBB 3HNSL 3MV8E 4IRJC 2CLVB 4Y4KD 4PJ5E 1ZAGA 4MQSB 3VXTB 4U4BA 4LVHB 1PQZA 1JWUB 5J6HA 2GUOB 2OJZL 5FCUL 3HRZB 3U1SL 5BQ7A 1ETZB 4DOHE 4P9ML 2X4UA 2ZSWA 1LMKA 3OG4B 4L1HA 1W72L 4HJ0D 43CAA 5FO7B 3OXRB 3BQUC 2X9XA 4LMQI 5EU6B 4QNPF 2NY2D 4IMLA 3WJLC 4U1SB 1H5BA 3RA7L 1VFAA 2A38A 1E4XL 2YC1B 4MXQD 3SDAA 1DSFL 4YHYB 3OKKB 4Z5RB 1I1AD 2DQDL 2GY5A 4EVNA 4FFWC 5E2JA 3GBMH 2I60L 1ZGLB 3V6FB 3G04A 5EA0H 4JHAL 3PWUA 4E0RA 3I02B 2EIDA 4GAYA 1KFAH 4RGNE 1U91B 2FEDC 1ZOXA 3ULVH 2EICA 1YNLL 5K9KB 5FUCC 4W68A 1WGOA 5C0AD 3UJJH 3EYFB 5KOMC 5KSAC 5D1QD 3P11H 4H8WC 4J1UB 4XPBL 3OHXB 5F97E 5F9JB 3IXAA 2WBWB 4ZD3H 4ZS7L 3AY4C 3E8UH 5D71L 5DUPL 4TULH 1D5MB 3DXAE 1Q0YH 2H1PL 1NL0H 4O2FA 2WV3A 4XP1H 2FWOB 3MJ6A 3R4DA 3UTSA 2VDOL 3TJHC 1MEXL 1DBAL 4NPYA 5F7EH 1T0PB 1UA6H 5IHLB 3T0XA 3PABA 4HFWB 3OG6B 1NGZB 2R2EB 1CIDA 2DQIL 1NGYA 1CICA 3CC5A 1CDIA 2I9LA 2P46B 4JFOA 4NCC1 2LAAA 4YXHH 3UZQA 2APTA 2YEZA 4JG1H 3T2QA 2W65B 3JWOH 5IK3B 1YC8A 4KXZH 2VLRB 1MQKH 4J4PD 4JFXA 3RWHA 4F7TB 1GOHA 1G9MC 1KJ3H 1EGJA 3DIFB 5KSBF 1MAJA 2VLME 3BWAB 3EFFB 3TIDA 4PJHB 4H5SA 4BH7B 4XBPB 1KIUA 4PD4J 3IF1B 1YMMA 2F8VA 3O4LD 1Y0LB 1UGNA 1VADA 5ID1A 2OBGA 4MAYC 1QSFB 2LVCA 3KR3H 3GMOA 1CE6B 3W9EA 3CFIC 2DJSA 3U7WH 3RY4A 5CLWA 3IGAB 4OD3H 3P9WB 5BRZD 2G5BA 3W11D 1FFOB 2YPLD 1EVTC 1P69B 4LSPL 5D1XC 2VLLB 3B8SA 4LLYB 1T1YA 1YYLL 4IOIB 2XRAH 3V5DA 3JUYA 3V6OE 3G5YA 1OAZL 2F58L 4KK5C 5I76A 3MACL 1FE8L 5J9PB 2H45A 4LRIA 3HZYB 1SHMA 5BOZG 3MRMB 3TN0B 3IDGA 2QSVA 4JE4B 3F65A 2BY2A 5DMIH 1B4RA 4FQXB 4QWWD 4OZ4A 4MSWA 4AYFA 3LRGA 1A9EB 3DMMD 2YUWA 3C5SB 3HE7C 4M1GL 4KJYA 5D1ZB 5DJ2A 4AEFA 4G9FD 3BKMH 3O11A 4ELME 3O3BB 3C60B 3VWKB 4KKAD 4ELKB 5DZOA 1GIGL 1U3HA 3QDHA 1CFSA 3SE9L 4ODTL 3RHWK 2DF3A 1MNUH 3RL2A 4NQCA 4EI5D 2YUZA 2A73B 2I07A 3O6MH 1RIUH 1EHXA 1RZKH 2BSED 1MSPA 3LKSB 3MGOB 5FUOH 5SWSD 4LEOA 4N0CC 4JO2H 1KB9K 1WBZA 4L4VD 3FRUB 1VFBB 3O6KL 1MELA 1KF9B 2EDYA 1CDCA 4OF6A 4ZPTA 1MJUH 5EBLA 3X14A 2FBJL 3TO2B 4D3CL 3X12A 3N1PC 3NFSL 2BHUA 3CMOL 4PRBB 3AREC 4RSVA 3ZDZE 1BECA 1KEGH 5DJAB 4XNZB 4KK8D 4ODUA 4JHZA 4PGCB 1BJ1H 1CTOA 1DVFD 1W8OA 1KTLB 3GI9L 1KCUH 1A14H 2FHBA 1KC5L 5J7CC 1C08B 1BJ1J 5IB3B 1PZ5B 3RL1A 1CGXA 5SWQA 5FHBL 4RGMB 5EZJA 3AXLB 4PJ8B 4V2BA 5FYJL 3WN5B 3U4BH 2JB6B 2EH8L 1U8IB 2VQTA 4HZLB 4QY8B 1D5ZA 2DKMA 4JFPB 5HYJE 1E28B 2O5YL 3MLXL 5J11B 4JKPL 5I17A 3GM0A 3OPZH 5ISZD 2GSIA 15C8H 3WHE0 2E9JA 4OQ1A 1VEOA 1MH5B 5GS0C 3RP1A 5K9QI 1QBLL 3JSSA 3VRIB 3B9KD 1ND0B 3K8MA 3SKNA 5C0EB 2ED7A 3BH9B 5IFAH 5L88L 2BVPA 3TH4T 2N1KA 4KHXL 2NNAA 3W9DA 1URLA 4RQQA 2IALA 5L2JA 2NX5D 3PGCB 3H3BC 4MA7L 3MNVB 5J56B 3IDJA 5GRJH 3CDYA 4P2OA 4Z7NF 1N64H 1V8HA 3K1KC 3FTGA 3NTCH 1RFDL 35C8H 2BVOA 4S0TD 1BZQK 2MHAB 1HDMA 5HGDB 2X40A 4HFUL 1QACA 3QNYB 1C5CL 1FYTD 2ITDA 3Q1SL 4PJ7B 4K9EL 1NMBH 4L3AA 4XCYB 2GJ6B 3PNWB 4GMTL 1BD2E 1S5HA 4P49A 1C16B 1JWSB 4F7PA 5I1DB 4NZRH 4G42A 2YD5A 4PJIA 4PTTB 4APQA 4ZYKA 2WAHA 1A64A 5F6HI 2CK2A 4QTIL 4PJXF 2DDQL 3VE0A 1ACYH 1ROWA 4PJEF 5GGTA 3SOBL 1K85A 3D5OF 5KOVC 3VI3F 5L6YH 3BHBA 4XC3H 1J05B 3U6RA 3QIBD 2HVJB 2FH8A 1K5NB 4PJ5A 1GZQA 5D6CA 4G8EB 4KY1H 5JIIA 2Q76A 3QYCA 3GHEL 1NAKH 4JHWH 4ONHB 3C08H 2NW3B 3HHRB 1MAMH 1TVBA 3DARA 5FGSA 4ZUWA 4FQJL 3FQNB 3BKYH 2ADGA 3LKNB 1WWBX 2EXYD 1FL3A 5F7DA 1A4KA 5D7KE 5JUEH 3ZKXB 5INCB 5ICYA 4HF5H 1IGCH 1A6ZA 1S7TA 4X7TB 4YPGA 5D4QA 2HFFA 2VISA 5AZ2H 1AFVH 1I1YB 3DSNA 2W0FB 1RJLB 1BQUA 1ZLUH 4QOKA 4RNRB 4YNYB 4Z0BH 5CGMA 1FBIL 3SQOH 3Q3GB 4EN3D 2EYSA 4A6YB 2FJFA 3QDME 1S3KL 1IQWL 3M8OH 3QXDB 4DWHA 4I18B 3B2UC 4RWYL 1Q72L 4GFTB 1MCSA 1UM6H 5KSBE 4WY7L 3SDYL 1FZJA 2AV1A 1I8KB 4U33A 5ACZB 1OAUH 4K07A 1QRND 3VXPB 3SKMA 3G5XA 3S5LA 1YJDL 4C54A 1FVEB 1AD0B 3DXAA 1FN4A 3REWB 5CBEA 2BY1A 4WI7A 3RFZC 2YK1L 1VKXB 1RULL 5C0GB 3SDCC 5IEKB 3I3DA 2VKWA 4C83A 5JHDA 3HNVH 2OL3L 5FYLL 5C92A 3QUZA 5HPMB 3T08A 4ZDHB 5C2BH 2VITA 5ADOL 4PB9L 1TQCB 2A6KA 3CK0L 5FDWA 4TSBL 2CRIA 4NJAH 4HUUB 4JVUA 1QVOB 3WV0A 5ECJE 1CLCA 3RVXC 1JYXA 3CPLB 1CFVH 5B39A 1M7IA 3AS0A 4GKOA 4HT1L 3GSOB 5J1SC 4KGLA 2P24A 3MRQA 1A1MA 3DGGA 3MA9L 5I2IB 4UDUB 4M3KB 3FKUS 4XNXL 2JJUA 3GNML 4H20L 5IMMB 3QDGD 1I1RA 3K46A 2AJUH 1A1NA 3RZCA 3K2UL 5DTFA 3P4MB 3F5WA 5IBTL 3P0YL 5EBWA 3QH3A 1ZHKB 2HWZH 3OKMA 3KPSA 5DC9B 1LDSA 5I74C 3D0LB 3T77A 1Z0NA 1A6UL 3GK8L 4P3DA 4U3CA 3O3EB 4HS8H 2DYPA 4K71B 3D25A 4LDEB 3VJ6A 1JZ8A 4KHTL 4HXBL 5C9JA 2FR4A 4OD2B 3TO4B 1Q9KA 2XZAL 2ERJC 4NN5B 3U0WL 2NY7L 3L3HA 4PJCB 4AL8L 3NPZB 4U1NA 3EUUA 4V2CB 4MJIE 3MSPA 2MTPA 4X7DC 4O2CA 4Y19D 4P2QD 4HCRA 5TDPA 4LAQH 1A3RL 4OCWH 2Y36L 4G6ML 3V4VL 1BZ7A 1YPZB 1G6RL 3U79A 3SKJH 4OSUL 3PWJA 4Y4HB 3CZFB 1ZT4A 4XNYH 3DYOA 4MS8C 4PJAF 5FGCB 1PFCA 3LKOA 3WIHL 3QIUA 3FQWA 5F7UA 5L2KB 1FL5B 4GO6B 2VXQH 3B9DA 3OX8B 3CFCL 1A7PL 1J86A 3IS0X 5IB5B 3IDXL 4WFGE 3RWJB 5HGAA 5HI5D 3MRCA 5I71B 4HDIB 3MBXH 3OKOB 4BH8A 3OB0K 3U48A 1D5IH 1IQDB 1RZ8A 5FO9B 4GRMA 4XMKH 1JN6A 4JY6B 4OUOA 1X7QB 1V3LA 3LEXB 3BEVB 4O51A 5FXCH 1Q9OB 1JF1B 1YEGH 1B0RB 1CU4H 2XTJE 3A67L 4OFYD 1DEDA 3CVIH 1EJOH 2W9EL 4MNHA 1QHOA 3S96A 5FKPB 2X1OA 3I3BA 2FSEB 5HYJA 4L29A 1R3KB 2FDBP 5AEAA 4N9OB 4UB0L 3RDTD 1JNLH 2D7TH 3MCKA 5DVLA 2Y9RT 3SKOA 4MB5A 4JFDA 2HAZA 3GHBH 4N8CL 1PQZB 4WHCA 4PLKC 5DD0H 1UB6A 5J6HB 3MXWH 4M7LH 3OZ9H 1Y18A 1WISA 5BQ7B 2QADC 5EOTA 5BO1L 1FIGH 4GBXA 1CQKA 2X4UB 1CL7H 4O58L 4PJXE 3CFEB 4PJEE 1MRCH 3C6LC 3U0TB 2NY5H 1F4XL 1IARB 2UWEF 4G6JH 3UTQA 3FB6B 4R97B 43CAB 3VI3E 3PWPD 1U92A 3ZKND 1P4BH 4Y16D 3IJYA 2O5XH 3JWNC 4NZUH 1KN4H 1BP3B 1TPXC 1VFAB 2X7LB 4XCNA 3SDAB 5CEZD 1X5YA 1BHGA 3LEYL 5D70L 5MI0B 2OTWA 2K1MA 3VU2A 2GT9A 4NC1E 4EVNB 4OGAC 3S35L 2VH5L 2C7UA 3G04B 5I18H 4E0RB 4UMGA 3GKWL 3PWUB 5IIEA 1YYMH 4ZO9A 4QHLB 1X5JA 1TVHA 4CNIA 2E7CA 2XWJA 4GAYB 3VI4F 4I3SH 2V7NA 3MUHL 4CMHC 1KACB 4CADA 4F7CA 2F5AH 2CO7B 1I1AA 1TDQA 5F6HJ 2FX7L 4AEHL 1OSZA 2GK2A 2V9RA 4AG4H 3IXAB 2Z8SA 1MOEA 2BNRD 3IAQA 3T8XB 4X6FA 4P9HL 1OLLA 3V52H 3W82A 4BZ2L 3N1MC 1I9EA 5E2UL 4P23C 1Z9OA 1YDPB 4L8SC 5ICXA 1MIEL 4LIQH 3UTSB 4ERSH 1OP9A 4H0GA 3T2NL 4NPYB 4ALAH 2V9TA 5D1QA 2X4PA 2HLAA 2FJGA 2JJTA 1KB5A 1LQSR 4ZS6C 1CICB 3CC5B 4KK9D 4TNVF 3FO1A 2I9LB 4JFOB 4LEXH 5IFJA 4GW1A 1TJGH 2YEZB 2AABL 3MRDB 4P4RB 5CD5D 2YPVH 5ID0A 1CGSH 1P1ZA 1UH3A 1E4WL 4JFXB 2EIZA 4QGYA 4HGWA 4OCRL 3RWHB 3LIZH 4P3CL 1KB9J 4KVNL 3TIDB 4LSUH 4H5SB 5CGTA 1XF1A 2VN4A 4QXUL 4YQXH 3OKYA 4Y5XC 1C7TA 1YMMB 1EFQA 1CI5A 5F8QC 4ZUSA 1MFEH 2OK0H 3FB8A 5ID1B 3MODL 2LVEA 3LB6C 5FGBA 4Z7VA 3GMOB 3W9EB 1UM5H 3L6FA 5HHXH 4TTDD 3U4EA 2GIYA 4DKAA 5E8NA 4LSTH 3RX7A 2G5BB 4YHLL 5H2BB 1QTYT 1TTGA 2P44B 4UIKL 2ESVD 1T1YB 1FNAA 3V5DB 1E6OH 3O4LA 5DHVH 3G6DH 3G5YB 4PGJA 1AQKL 1BFVH 5I76B 5DD5H 5FUCE 5DSCB 3F7VA 3IDGB 2CUMA 4N1HB 4ODHL 4P5TB 4PG2A 2IPKA 4NKQB 2AK4E 2Z92A 3HC4H 4OZ4B 5AG9A 4MSWB 3QHZL 4TVSa 4F57H 4FZEL 4TTGA 4KJYB 5DJ2B 2P4AB 4G7YL 3STBA 5DVKA 3O11B 3M45A 1KEML 4NHCL 3D39E 1U3HB 1CFSB 1IC7H 1NC4D 1UCBL 5IQ7H 3C8KA 3RL2B 4NQCB 1A9BA 4NO3A 3F58L 2AXHA 4LEOB 5EU4A 3DMMA 1CE1H 4O4YH 3ULVD 2NY6B 5INDA 4PG9A 3LZFH 1O7VA 2A1WH 4UQ2B 1X6NA 1FCGA 3BPNB 4YUEL 5EBLB 3EFDL 3X14B 3CUPA 3X12B 1U6AH 4EI5A 3ULUL 4FTVE 5J0BA 1T2QL 5SWSA 3OF6D 4F8QA 2FX8H 4XMPH 3RRQA 4ODUB 4XP4L 4JGMA 1IC4L 4PY8I 1NCBL 2P43B 3RY5A 3ETBF 4JPVH 3L5IA 3VXSD 3X11A 5SWQB 5HHMD 3RKDD 2EE9A 5D7JA 5EZJB 2YD3A 4HK0A 3OSKA 2BVTA 1T04B 1D5ZB 3VW3L 1DVFA 2D0HA 3I84A 4CW1B 5I17B 1GGUA 2XXCB 2GSIB 4MJIA 1NCDH 1N8ZA 1SY6H 4UTAH 5E70A 5CJOH 4MXWH 3WIIH 1RMFL 3SKNB 5C07B 1OHQA 4QRPE 2HT4D 2BVPB 2CQVA 3VG0L 2NYYD 1KJ2H 3NIDF 3MJ9H 4NRZA 1MIMH 5DUML 3B9AA 2HTKD 2NNAB 3W9DB 4RQQB 2AXJA 1ZXQA 5ISZA 2IALB 5L2JB 3ZE0F 5CZXC 1PX3A 3D85A 5C6TH 1OP3H 3CDFA 1OPGH 3T4YA 1N5YL 1EHLH 5E2VL 2YR3A 3IDJB 2C9AA 4FQLL 3B9KA 1T03L 1OAKL 1YEHH 3EHBD 1U8HA 4P2OB 4Y5YA 2EC9U 1HIMH 3RUGB 5DJDA 4XGZA 5ADPH 3FTGB 1IAIH 4I13B 4ODVL 1Q0XH 2BVOB 1FO0A 2H9GA 2NX5A 2BZDA 3HG1D 1EX0A 2ITDB 2PXYD 5J13B 1N3NA 4H8WH 5M95B 3MRIA 1KN2L 3CLFL 4DW2H 1S5HB 2OI9B 1HZHH 4JFQB 1FSKB 4Q9RL 4J3OC 4GRWB 4F7PB 2BFVL 3C5JA 5BVPL 2FGZA 4G42B 4PJIB 4APQB 2IAMC 4TN9A 4ZYKB 1MPAH 3VGFA 3K1DA 3GMNA 3ZTNL 1FYTA 2CLRA 3VE0B 4AK1A 3QUML 2ZUYA 3BSZL 4LOUC 3HZVA 1TQBB 2NY0D 4JZJA 2FO4A 4HHAA 3BHBB 4YFLF 2BNRE 5K9JL 4Z7UF 4PJ5B 5I1EH 1GZQB 3IFLL 2NZIA 3K4DA 5D6CB 4FS0A 5F8RC 1SJHA 1DFBH 1CWVA 4FQHA 1E27B 2Q76B 3EJZD 2GTWA 4KRLB 3EYQD 5E2TL 3I9GL 2IPTH 5BV7L 1A1OA 1JFQL 3QEQE 1F58H 4OF7A 3UZEA 3MX0A 5IJKC 2PUQT 1A7QL 1I85A 2XZZA 4POUB 1FL3B 5F7DB 2PCPA 1A4KB 3LS5L 2NXZB 3WXVL 5I1KL 1YY9C 3QIBA 5ICYB 3MRRB 5EH1A 1CFQA 2DLIA 2WM0A 4FP8H 3T0AA 2ZCHL 2B1AL 4NQDE 1CBVL 3Q6GH 1A6ZB 1S7TB 4YPGB 4XVJL 2HFFB 2VISB 3ILPA 4YHPA 5I8KL 1IC1A 1GVIA 4X6BA 3QFDA 4OLXL 2EYSB 2YMXL 4LHUA 2FJFB 4IRZL 4OIAA 4HKZA 3LQAL 1BEYL 1RIVL 4OZIA 2PW2A 3BVNA 4O5LH 3DYPA 5DURD 1NUNB 1FZJB 2AV1B 3V5HA 4XBGA 5TDOB 3V7AG 2BXYA 5HVWA 3U4AA 3VWJC 2JJVA 4LCIH 5I75C 3SKMB 1S78C 2H2PC 3G5XB 3S5LB 2DMBA 2ORBH 4EN3A 3SGDH 4JGUA 4RDQG 5EBMA 3PHQA 3DXAB 1RJYA 1FN4B 2EECA 4X9IA 5CBEB 2DQEL 4WV1B 2QKIA 4E9LA 4I8DA 2HMIC 5BS0E 2W0LA 1PW3A 2HH0L 3DPBA 2DTSA 5JHDB 2J8OA 4BA8A 1XEDA 5C0IA 3QUZB 1EPFA 3GRWA 2VITB 3QNXB 1IZJA 1Z3GH 2LU3A 2CH8A 2ADFH 3EZ8A 4PGBB 5D5MF 2NY3C 4JPKH 3JXAA 5FDWB 4KI5C 4YDLB 4R7DA 4ZFFA 2APFA 1B6DA 4Y7MA 2D4FA 3V95A 3T3PE 3MYJA 1DQMH 4EQ2A 5B39B 1J0IA 1M7IB 4OGZA 2NW2A 1N7MH 4BQ6A 2ZP0T 1MI5D 1FQ9C 2VWEC 3D9AL 4ZSOE 5LGHH 2P24B 3DGGB 5EZIH 4MCYA 4HMCA 3JV4A 3MLYH 1ZA3A 2HFGL 4LSSL 1GGYA 4XI5D 3B5GA 4MGXA 4UNVA 1A1NB 3RZCB 5DTFB 3U9PL 3NIFF 1Q94A 1FAIL 3F5WB 3VFVA 3SDXF 2PR4H 3OKMB 5B38A 2WBJC 3KPSB 3TFKD 2QJDA 3T77B 2C4FU 4DGYL 5C71A 4HWBA 4HSQA 4TVPL 1UM4H 4P3DB 4WWKC 3ILQD 1WFNA 3ARPA 2DYPB 3D25B 1OAYL 4NQXA 4R8WL 5F1KC 3SN6N 3VJ6B 5C9JB 1TIUA 2FR4B 3QIWD 1NAMH 3PL6C 3VD5A 3C8HA 1Q9KB 3CFJA 4JRXE 5HYSA 5E03A 3L3HB 2IG2H 2XXMB 4U1NB 2P42B 2FATL 5FOBB 4HUVA 5KSAA 4ONOA 4UBDC 5HJ3A 4O2CB 3SQBA 5F71A 3V8OA 5GS0H 3H8NA 1YY8A 3VXUD 1AI1L 5TDPB 1ZGLM 3GIZL 4LGPB 3S36X 1BZ7B 1B2WH 3U36B 5JO5A 3PWJB 1SJEA 1A6VL 1ZT4B 1PGRB 2FYYA 5F9OL 4JG0H 3LKOB 3QIUB 3FQWB 1WCQA 4P2QA 2VN7A 4RX4D 4OM1L 1WC7A 1ZLSL 3WL9B 4JQXA 5B39G 4WI4A 5TFSL 1DANT 5EFIA 4N8VA 5HGAB 5K33A 3MRCB 1VDGA 2X2YA 3NIDE 1U36A 2Z4QA 3H9HA 3BN9C 3BIKB 4FTVA 4ZOEA 4OFDA 2VZ3A 5DMYA 1HILA 1AJ7L 1JHLL 1RZ8B 4EBQL 2B1HH 3MOBH 4GRMB 1JN6B 3ZE0E 1J0JA 4K94L 4ACPA 3VFUB 2DTMH 5LQBL 4O51B 1XGPA 2E9WA 5SX4I 1GGBL 1KYOK 4MAYA 2E27H 3K7UA 2PO6C 2Z8WC 5C0BD 2HJFB 3WO3B 1GGTA 4L8CB 1OGAE 2OP4L 1VFUA 4JDZA 3WFEH 2HKFL 5JW5A 4MNHB 4J3VA 1P4IL 2Q8AL 5IHUH 3S96B 5HYJB 3GZKA 4L29B 1I1FA 3FB5A 4I77L 1PSKH 3MCKB 4ZFOL 3SKOB 3RVWC 4JFDB 4NNPH 1FJ1A 1ZT7A 1J1PH 3SDDC 3MCLH 5FYKU 4WHTB 1XF3B 4F37K 1Y18B 3AM8A 3ECBA 1OAXH 1P6AB 4QRSB 3BXNA 3BFOA 1O7SA 3SE8L 4OV6F 4QRPA 4OZFH 4WENB 2AQ3A 3MJ8A 4GBXB 4WCYL 4P57A 2OTUA 3BP4A 3HNSH 4P99A 3UTQB 5HHVL 3RDTA 5J6GB 5D6DC 3TBSA 2VDQL 1EBAA 4BUGA 2KL6A 5C2UB 1CVRA 3A0OA 4Z7UE 4XCNB 2OJZH 5FCUH 3U1SH 1F02I 2OTWB 2MCG1 2GT9B 4XVSL 5D2LF 4P9MH 3BD5A 2C7UB 1W72H 1H3PL 4KKBD 5KW9L 4ZO6A 5IIEB 2NY4C 1TVHB 4CNIB 4JPWL 2XWJB 3TVMD 2ZUQC 3PWPA 4YHML 2V7NB 3DV4B 3RA7H 1E4XH 4CADB 4F7CB 1DSFH 4KJPC 5EB9A 4Z7WF 2LAGB 2DQDH 4LVNC 4N90E 5IG7A 1QOKA 4PP2A 5L8LB 3OKDA 4XCCL 4KTDL 2X4TA 5F1IB 2I60H 3VDCA 3OAUL 3ZT6A 5JHLL 3T2OA 4JHAH 4FRWA 4X6FB 1I7RA 5L0QC 3ARSA 2QR0A 1WFTA 4JKLA 1JGVL 3ZDYF 5SWZE 2NZ9D 1T89C 3BGFC 4AENA 1YNLH 4XTRC 2XKSA 3S3JA 3HR5A 1V3MA 4XPBH 5DK0B 1F13A 5D1QB 4ZS7H 2X5PA 4OCSL 1ULVA 2X4PB 3GBLA 1EEZB 2HLAB 2L0DA 5D71H 5DUPH 2BNRA 1J8HE 2FJGB 1KB5B 2H1PH 2IGFL 4IEFB 3FO1B 4Q0XL 4BQBA 5IFJB 3FO2A 3TT1L 2V17H 4GW1B 4NNYA 3IKCA 3QEQA 1UWEL 4N5ED 5ID0B 2E5EA 2VDOH 1S7XA 1MEXH 3ZL4L 1P1ZB 3MOQA 1DBAH 4LVEA 2EIZB 2CPCA 2NLJA 2DQIH 1L7IL 4EI6A 2WZPD 2EDEA 4PJBE 4Q2ZA 3I3EA 5DS8A 2ZG2A 5D5ME 3WD5L 3FB8B 4OFKA 4Z7VB 5E24E 5CIPH 2A0LC 4L1DA 2H3NA 3L6FB 3NPSC 2ENSA 3U4EB 3MCG1 1A2YA 5E8NB 3RI5F 3QDMB 3VFSA 4R3SA 2EDLA 3ARBC 3ZO0A 3WO4C 4MNQE 1OL0A 3CSYA 3G6AA 5I66A 5TDNA 1PEWA 4LVHC 3O4LB 2VIRA 3FONA 3MLZL 1OSPL 1CTNA 2HJKA 5GRVL 3F7VB 4A6YL 3NIFE 1S9YB 4LSPH 3OAYH 3LQAC 4LLDA 3SDXE 1YYLH 3X3FL 3MREB 5D2NA 5GRXG 4CRPA 1BQSA 4WEUD 4X4ME 1HCVA 2EDJA 4GQ9H 4YHYC 5EOCL 1OAZH 2F58H 4LMQE 3MACH 1FE8H 4F9PA 4PLOB 3KYKL 3C8KB 2NXYB 2CRZA 4XPAL 2NCMA 1A9BB 1JUFB 4XNQA 3FN3A 3MLVL 4M1GH 4FQIL 1ZHNA 3DMMB 4RA3A 1JPTL 4W4OA 3W0WE 1V3JA 5INDB 4PG9B 1GIGH 3HUJA 3LN5A 3SE9H 4ODTH 3JVGA 3D6GA 5JMRA 4FQ2L 5FK9A 4PRHD 3CUPB 4PFEA 4NDMA 2VXSL 4IDLA 4Q6YA 4PRID 3O8XC 4OCNC 4KKCC 2HG5A 4PS4L 4CVUA 4P2YA 3O6KH 2R1XA 4HWEL 3CDGA 1FH5L 4YXLL 4KROD 1R3JA 3BESR 2FBJH 3KLSA 4D3CH 3X11B 5C0NC 2Q86A 2Y1VA 3NFSH 5D7JB 3U7YH 4WO4D 3CMOH 1WT5C 1OTTD 3DSFL 4HK0B 4L3EE 1NH6A 4JFFE 1X4ZA 3T0VA 4FFYL 3GI9H 1U8LA 1DVFB 5GGVY 2KZWA 1KC5H 1AGFA 3WXWL 4MJIB 2WWMD 2DQHH 3T65A 2IFFL 4NCC2 1LD9A 3D18B 4M9PA 4LAJH 5FHBH 4KZDL 4KI5F 4NRXB 4UT7L 5FYJH 2E6JA 3L1OL 3NCCB 3L3KA 2DOCA 3C2AL 2EH8H 4EOWL 2E7LC 4RIRA 2O5YH 4ZFZA 5CCKL 1RUPL 3MLXH 2V9QA 4JKPH 4NRZB 3I6KA 4ENED 4K8RC 1QBAA 4CN6A 4N0RA 4NP4L 3D85B 2WWKO 2A6DA 3RGVD 5FFLA 1QBLH 3ARGC 3NCYP 5L88H 5SV3A 3B9KB 4KDTA 3LSOA 1T4KA 1U8HB 4RAHA 1Z2KA 2NR6D 4D9QD 4KHXH 3TYGL 4XAWL 1I8IB 4UV4L 3TN0C 1I7TA 1DL7L 4PP1C 1GXEA 2NX5B 3O2DA 3KPQA 1RQ5A 4MA7H 5JDSB 4FQXC 4QXTA 1N3NB 3GUTA 3PWLA 5D1ZC 1UWGL 2IJ0C 1JF5A 5I19L 3C60C 5D2LE 1RFDH 3VWKC 4ZMAT 5I0ZA 2AGJL 1ZE3C 3C5JB 3QJFA 4HAFA 5T3ZL 5CSBA 1HHIA 4HFUH 3U46A 1OGAA 4H0HB 3GMNB 3FT4A 3Q1SH 4X98A 5M94B 1FYTB 4K9EH 3E1F1 2E9IA 3HZVB 3KPNA 2X9WA 4GMTH 4JZJB 5IB4A 2FO4B 4HHAB 1BGXL 3KLAB 3SJVD 5B3NA 5GZOD 4YHZL 2E9BA 5IBUG 3KJ4C 4FQHB 1UKTA 2GTWB 3M17A 1X9QA 5CGYC 4LK4A 5IBLC 3WBDA 5L7XL 4WI3A 4QTIH 2DDQH 1A1OB 1H8OA 3V4UL 3SOBH 4E41E 4K7FA 5CILL 1K2DA 2D7PA 3IRPX 4XNZC 2PCPB 4PJXB 1JPGB 3GBNL 1JTPA 3B9VA 3PXHA 3QIBB 1CFQB 1Q8MA 4BYHA 3GHEH 4HKJA 1MCEA 3H6JA 3QG7L 2QQKL 3MRHA 4YHPB 5HHQB 4FQJH 3PP4L 4I9WD 4PJ8C 1BF8A 3UYOD 5JLZA 5EU5B 4X6BB 1JF6A 3O2VL 4L9DA 4WUUE 4X4ZA 3QFDB 4TUOA 5EUOA 4JPIA 1JHKH 3VH8G 4LHUB 1FNEA 2A9ML 5JXEA 3OGOE 4HKZB 5J11C 3WMSA 4OZIB 1A7NL 2PW2B 3BVNB 2B2XL 3AFLA 4UT9L 1K9TA 1ONQA 1AP2A 2ZUWA 4K7PL 4YGVA 4WW2A 3V5HB 4XBGB 3SO3B 1MFDL 4YE4L 3RY6A 1FBIH 2EKJA 4EN3B 5KG9A 1S3KH 1IQWH 4M8QA 5EBMB 3PHQB 1MREL 1KCRL 1RJYB 4RWYH 1Q72H 4GOSA 4Y4FD 5KVEL 2QKIB 2F9BT 4WY7H 5E6YA 3SDYH 3KPPA 3DVGA 4TNWK 2UYLA 5GS2D 1P4LA 3LKRA 4CAGA 4K3EL 5EC2A 3CXHK 3I6GA 5HDOA 4EDXA 3GEWB 5T1LD 4G43A 4DKEL 3ZLQC 4CVZA 3O3DA 4G9DA 2YK1H 4R7DB 4ZFFB 1RULH 4XP6L 2HFEA 5FYLH 2OL3H 4MJ6A 2P8MA 2AEQL 1VEPA 2NW2B 4D0DA 5ADOH 4KH2A 1JTTA 4PB9H 3VRJA 1WTLA 2OZ4L 4ZUUA 1F4HA 2VXVL 3CK0H 3IETA 1EDQA 1A3LL 4YH6A 4PJBA 4TSBH 3JV4B 1DBKL 2B8OT 1ZA3B 5I8OL 2VL4A 1CGVA 1L7TL 3S37L 3LHPL 1VFOA 3OWEA 1KTDB 1Q94B 4OKDA 3AVEA 1MCWM 3KYAA 4HD9A 2W1NA 1MJ8L 3IJSA 1MI5A 4LHUG 1CDJA 5CJQL 3MA9H 3TJHD 4C4KO 1KYOJ 4XNXH 3GNMH 4H20H 1WIOA 3BX7C 5A40E 3DV6A 3NZHL 1PG7L 4NQXB 2XNAA 3K2UH 5IQ9A 4GXUN 5IBTH 3CFJB 3P0YH 5HYSB 1NGWA 1BIIA 5HY9A 4MNGA 3DYMA 2YXFA 4X7CC 1IAKA 1BOGA 4ONGL 4HUVB 5KSAB 3ZKXC 1JYNA 1A6UH 2IADA 3GK8H 4JHBA 1UVQA 1WZ1L 5HJ3B 3UTZA 1V3KA 2AK4B 5J57B 4JZOA 4YBLB 4OF5A 3QAZB 4CN4A 1YY8B 5B4MC 4KHTH 4HXBH 1YUHA 1R3LA 3K74B 5DHXB 2XZAH 4P23A 3U0WH 2NY7H 5IEHA 4AL8H 4L8SA 1NCUA 3D39B 4IIQA 4RGOL 4ZPVA 5I9QC 5JO5B 2VOTA 1SJEB 1DE4A 4I18C 4DVBA 1RAMA 1WWWX 3J7HA 3QCVL 4P2QB 3VXUA 4MVBD 4OBSA 5FM4A 1WC7B 1LEGB 1A3RH 2P5WD 5KANG 2Y36H 4KI5E 5TH2A 4G6MH 3V4VH 3W0WA 3DVNA 4JRYE 1G6RH 2K7QA 2NPLX 4MQTB 4CU8A 4OSUH 4IMKC 4PRNA 1KLFA 3GMRA 3QHFL 2Z4QB 2D03L 3H9HB 4FTVB 5E9DE 1N59A 2J2ZA 1HILB 1WICA 3NCEB 1LNUA 2XKNA 1J0KA 3IFNL 4MZ2A 4RX4A 4FOMA 5AAMA 4U1JA 4ZXBD 1F90L 2A6JA 3CFCH 1A7PH 4Y5XA 3ZHKA 3IDXH 3FMGL 1OLZA 1XGPB 1A7BA 4MAYB 2J3SA 5B38G 1B6UA 5FAAA 2GAZA 4HAGA 1REIA 4JDZB 4ZAKD 2FX9L 2PYFA 2OCFD 5LXGL 2H26A 3OQ3B 1B90A 1WAAE 2ICEB 4JQVA 4XXCC 4C59B 4N0UE 1BJ8A 3ZYOA 4WU5A 1RUAL 3L3JA 1I1FB 1KV3A 2RHEA 3FB5B 4WFFD 3UX9B 3G9AB 5HYSG 3SGJC 3S9DB 1IM3A 3P40A 4N0CD 5C0RL 1KLUA 3A67H 1NFDE 4U2ZA 1FJ1B 5ESAA 1ZT7B 5C0BA 4Z7OF 5E8PB 3QPXL 4PJDA 5E08L 1N6UA 2W9EH 1HH6A 1ZKAA 1CD9B 3ECBB 1F3DH 1HI6A 1GOGA 3KPLA 4QRPB 4P57B 2OTUB 3BP4B 4XBEL 4ZOBA 4U2YA 4UB0H 1H9VA 1R3IL 1U8PA 1MCCA 3HE7B 3HE6C 3T0EE 4AJ0A 4K7PX 1MCHA 4QF1A 5HYFA 4N8CH 4P0DA 3TBSB 5DDHA 1UEYA 5JA9A 3VCLB 4Z76A 4U1IA 3PG2A 2F19L 1TITA 5BO1H 4K71C 1KIQA 2GKIA 4O58H 5GRZA 1HHKA 3O2WL 1F4XH 4GKNA 4NN5C 1SYVB 5DVMA 2EE2A 4LLWA 4GUPA 4N8VG 2BNQE 4R6UA 3PWPB 4XH2B 4ODWB 1IEBA 3RJDA 3DI2B 3LEYH 5D70H 5DRXA 1A6WL 3F7QA 1BVZA 1AKJD 1FLTX 5IG7B 4PP2B 3S35H 2VH5H 3OKDB 3S4SA 5J1TC 2X4TB 2D31A 4LPCA 3C87A 3GKWH 5D7IE 3U82B 4M4RA 3AREB 1MCNA 4I48A 3RVTD 4PJHF 4Y4HC 3RWIB 3MV9E 2C3WA 3HR5B 5IHBA 3BPLB 2FX7H 5IW3A 4AEHH 1TZHA 1DTUA 1CFBA 1S5IL 1G9NL 4POZC 3ARQA 4P9HH 2BNRB 4BZ2H 3HLAA 4GKZA 5E2UH 5AUMA 3AB0B 2QSCL 2R2HA 5I71C 3DETC 3FO2B 2CIKA 3T3ME 4NNYB 3IKCB 1IAOA 1MIEH 3QEQB 1NGQL 4E41A 3IRZA 3LAFA 1S7XB 3T2NH 1KG0A 4XWOC 2PTTA 5A2JH 2IMNA 2NLJB 1TETL 1A6AA 1T0MA 1D9KD 1J8KA 4NQDB 1EFXD 1VHPA 4P2RE 4KJQD 4M7KL 2DQGL 1NDGA 2AABH 5DRNB 1E4WH 4JLRB 4OCRH 3BMWA 5DLML 2H3NB 4P3CH 2C3HA 2D7NA 3QISA 1A2YB 4KVNH 2OR9L 3TWCL 4R3SB 3VFSB 4OCLC 3JV6A 3VG9C 5DYOA 4S1DD 3RPKA 2LFGA 3CSYB 3G6AB 2F54D 4LPXA 5I66B 3RNKA 5TDNB 1C5BL 4EZMA 3MODH 3G5VA 3FONB 4YZFF 1PLGL 1LEKA 4NN6B 2PYEE 4R4ND 1G1YA 3FQUB 3MOAL 2HJKB 3BRGC 2ITCA 4YHLH 1OTSC 4LLDB 5I1HL 3PHOA 2FJHA 4R97C 5M7QA 2GFBA 2E7MA 5D2NB 3ZHLA 4X7SL 4WEBL 3RQ3A 4EUPH 1H5BC 3SDAC 1K3ZA 1AQKH 4G6AD 5MI0C 2IAMA 2WP3T 3TH3T 1H15A 1M1SA 1UQSA 2AJYL 5F9WB 2DM3A 4ODHH 3LN4A 3D69A 3QA3A 4XNQB 3QHZH 2JE8A 1BM3L 4FZEH 5T5NG 2VZVA 2XA3A 4HX1A 1ZHNB 4G7YH 5FM5M 5AG8A 1J1OL 1KEMH 2OS7A 5DEZA 4NHCH 3HUJB 3UMTA 4FQPA 1UCBH 4ZSOB 5FK9B 2D2OA 1G7JA 4NDMB 3F58H 4MCZA 5C1MB 3CIQA 4N8PA 3X17A 1DQTA 2HT3C 3BGMA 4EEEA 1QUNA 4ZG1A 4FN0A 2HG5B 1H3TA 1IFHL 2E3VA 2YRPA 2R1XB 2AQ1A 3CDGB 2AEIT 1R3JB 2ZCLL 4YUEH 3VA6A 3EFDH 3J8F7 3ZZ1A 3ULUH 4PRHA 2Q86B 1I4FA 1FVDA 5SV4A 2Y06L 1T2QH 4BK5A 4KK6C 4DN4L 1FG9C 4XP4H 4M61A 4RAUA 1IC4H 4JRXB 3RWCB 1U8LB 3VA2C 3ZYZA 4TUJB 4QRRE 4GG6F 1AGFB 3T65B 3C9NA 1LD9B 3HB3C 1M7XA 1VFMA 2EE3A 5HHMB 4HJJL 5I8EA 3GGWA 3L3KB 3MLTA 4RIRB 3VFWA 5JQHC 2IQAA 3VW3H 4GAJL 4ZFZB 4PJ7F 3LY6A 3I6KB 2GQHA 4J3XA 1J0ZA 3FZUD 5GRVK 5DJ0A 2VDNL 5MEOA 3BIAX 4UNUA 4XB7A 5J12B 3RNQA 4U3XA 1RMFH 4Z7OE 4DJMA 4I0KA 4HMDA 4HCRL 3SE3A 1K4CA 4J6RL 3VG0H 1T4KB 1N6QL 3GJEA 4RFEA 5DUMH 1AR1C 1IGFL 3B2VL 2Y6SC 5HGGS 1T1WA 3BDBA 2ED9A 4LRIC 4OKVA 1RZIA 4X5WA 4LHJB 3KPQB 3VXMD 4EIZC 1N5YH 3RGVA 4QXTB 5E2VH 5ACLA 1IGIL 4FQLH 1T03H 3GUTB 1OAKH 1F3JA 3BD4A 4NKDA 2WMPA 4ODVH 2VLKD 5DHVA 3S36H 1U3HC 1H8SA 4LASL 1MCWW 1HHIB 3U46B 4NQTA 1OGAB 2WBJA 1HYSC 4X98B 1O5DT 4B0MM 3KPNB 4JM4L 1WAAA 1A6PA 4NNXA 1Q9LA 1KN2H 4MS8D 3CLFH 3BZFA 5B3JF 4JDTL 3CXHJ 4Q9RH 3GJFK 5BVPH 2BFVH 2NY6C 2IQ9L 1MCOL 2VLJE 2GTZA 5FYKE 1IEAA 2VO5A 1NFDA 3VDBA 3BPNC 3LRSA 3M17B 3KXFD 3ZTNH 2VDPL 3CH1B 3QUMH 4K7FB 3BSZH 4AIZB 1K2DB 2O26U 4PJHE 2NY0B 5K9JH 3QEUA 3IFLH 3SJVA 5JW3L 4NZJA 1QFWL 5EN2A 1RZJC 3T0EA 3MRFA 1HQ4A 5E2TH 3I9GH 2APXA 5BV7H 3MRHB 4A2LA 1JFQH 3X13B 2F5BL 3PQYD 1ZHBA 4UU9A 5JLZB 1A7QH 1FFPB 4TUOB 4JPIB 3SCMA 3UPAA 3WDIA 3LS5H 4LBEA 3WXVH 1FNEB 3JZ7A 5I1KH 4OQTL 4F80A 2ZCHH 2B1AH 5L8KB 3C5ZC 5E4IA 1CBVH 2HN7A 4IOFC 4D94A 3KPRE 4XVJH 1ONQB 1N4XL 4MA8L 5I8KH 1AP2B 4YGVB 4WW2B 4D8PA 4XZUA 4OLXH 5EG6C 2YMXH 4I1NB 4IRZH 5KG9B 5FYJD 5D7IA 4UILL 2QADD 3LQAH 1BEYH 1RIVH 1F42A 1M6OA 1UZ6E 2ZPKL 5H37H 2GITA 2X05A 4NM4L 2BMKA 3KPPB 3DVGB 2UYLB 4UT6L 1XF2A 1BFOA 3RWDA 2VUYA 3EO0A 1P4LB 3D87B 3LKRB 1CFTA 1RHHA 2NY1B 3BN3B 5IV2B 1CDHA 5EC2B 5F3HA 4LVOB 1F11A 4DTGL 5FECA 5KTEL 3I6GB 4EDXB 2B4CL 4UAOB 4YZFE 4JFHD 3IXTA 1FPTL 2YUVA 4CVZB 4OGAD 2R69L 1MCKA 2DQEH 3O3DB 1H8NA 2B39A 4G9DB 4Y4FA 1JRHI 2IMMA 2HH0H 3KLHC 1FV1A 2HFEB 4OFIA 2VC2L 2EC9T 4MJ6B 3LV3A 2P8MB 5J13C 4LNVA 4D0DB 1T7VA 1G9NC 1XF5A 2DLHA 4LQFL 1W0YT 3VRJB 4X6DA 1VGKA 4ZUUB 4OT1L 3IETB 1A7OL 5DGRA 1ZVHA 1F4WL 1KB5L 4PJBB 3MJ7A 4MJ4A 1GC1C 3O6FD 4DUWA 4APQC 5EC1A 4P2RA 4U7MA 5D5MB 3C6LB 4XVUD 1MHPL 5CP3A 1QFWM 1QRKA 5IWLA 4G6FD 2J5LB 1H3GA 5GJSL 3RTQA 1TQBC 2QSQA 1T80A 2V5SA 1KJVA 1TPXB 2IPUK 1KNOA 4WVRA 3D9AH 3EOAA 3IJSB 2BCKA 4YDIL 1YPZF 2YA0A 2CDFB 2HFGH 1MWAA 3WE6A 4LSSH 3OBAA 4M8VA 3GSQA 1S7RA 2XNAB 5IQ9B 3U9PH 3GM8A 1P7HL 1FAIH 2PYEA 4TSAL 5CP7A 2BJML 1NLBL 1NGWB 1BIIB 1FNLA 4MNGB 4R0LA 2X4RA 1D7FA 1IAKB 4DGYH 4TVPH 2IADB 1L9MA 5DXWA 3WNOA 1UVQB 2XZQL 5F72S 4AIXA 3K4ZA 2QQNL 4JZOB 4JZNA 1OAYH 2CMRL 1QZ1A 4R8WH 4G8IA 4R96A 1I75A 4K3DL 4P23B 5IEHB 1GGIL 4L8SB 2FATH 5FCSH 4ESKA 4IIQB 3O45B 2QQQA 3KPOA 3VXQB 2UZYB 1DE4B 4DVBB 4U1HA 4RCAA 3B83A 1YZZA 4GG6E 1N26A 2ID5A 1AI1H 3PGDA 3VXUB 1Q9WA 1Z5LA 3GIZH 3RIFF 4KC3B 4FMKA 5KANI 4BZYA 4L8BB 2OSLA 5TH2B 3W0WB 3DVNB 5B21A 3QO1A 5FKAA 3DURB 3AU1A 3NH7L 3GMRB 4PRNB 1A6VH 2EKSA 4PJ7E 4YBQC 3QT2A 5F9OH 3EO1A 1G7MA 5DO2C 4OM1H 1LNUB 2XKNB 3TCXA 4U1JB 4Y5XB 1ZLSH 2P5WA 4X99A 2N4IA 5TFSH 2G75A 5F70A 4LCUA 4NGHL 2QQLL 1P84K 2UY7A 2GAZB 1Z9MA 3V9FA 5JW4N 1QSED 4TOYL 1HXYA 4BQCA 1AJ7H 1JHLH 1MCIA 2PYFB 4EBQH 2V7HB 2H26B 4K94H 4OCXL 4ZXBA 5LQBH 4DFIA 1GGBH 4WU5B 3L3JB 4QRRA 1IM3B 5FYLD 1KLUB 3N9GL 4YO0A 5ESAB 3NCFB 4LCWD 5C0BB 2OP4H 3ZYJA 1GRWA 1IILE 2J1KA 4PJDB 2HKFH 4PJGA 1HH6B 1P4IH 4ZAKA 2Q8AH 5ALBL 1HI6B 3KPLB 1J18A 1RUML 3QXWA 4PGDA 1OT1A 4YLQT 4I77H 4J23A 5EZLA 4M6ML 1U8PB 4PRPE 1K8DA 1Q38A 1SEBA 4NRYA 3NIGF 1A02N 5DDHB 3HMWL 5GGUA 5B3JE 1UYWL 3PJSA 3F7PC 1BFSA 4U1IB 1G7HA 3PUCA 2A74A 5JZ7C 1EIBA 2C3VA 2VR4A 3SE8H 4WCYH 1IGTA 1KIQB 2C4FT 4OB5L 2WQ8A 3OR6B 3P4LA 4M43L 4GKNB 5HHVH 5F88A 3LPGA 4OLVL 1FFRA 4LLWB 2VDQH 3LQZA 3WLWD 3TPKA 4MX7A 1IEBB 2DBLL 1LEIA 5DRXB 2FD6L 3A6OA 4XVSH 3RWFA 3S4SB 3VD9A 1OWRM 1CD0A 2D31B 1H3PH 5KW9H 3WS6A 2L7JA 4JPWH 4YHMH 3TBTA 3CFBB 1NAMA 3H9SE 4I48B 4JFYA 5EUKA 1Y6KR 2I26N 1TZHB 2EDTA 3QIUC 2EEBA 4KTDH 4XCCH 1II4E 2DD8H 2XTLA 1EEYA 3OAUH 1XZ0A 5JHLH 4Z0XA 1B4JL 3BZDA 4YQXL 3FFCD 4ZUVB 1WT5A 2OM5A 3HLAB 4GKZB 5AUMB 2VLJA 3MRNB 1JGVH 2R2HB 3K0WA 4DKDC 4LPWA 2VSCA 3QUYD 4RMRA 1UM5L 2CIKB 4Z18A 1IAOB 1M05A 4U1LB 4E41B 3CGTA 1CGYA 4QO1A 4DQOL 1KG0B 4OCSH 4WRLA 5C08D 5ESVA 2PTTB 3HZMA 4ORZC 4DUVA 5F1OB 1A6AB 5GISL 1MVFA 2IGFH 4Q0XH 2IF7A 4WFHD 5GPRA 2HTLD 5GZNC 3TT1H 1I9RL 1NDGB 1CS6A 1UWEH 3ZL4H 1RU9L 2J4WL 3ZTJH 4WUUB 4XWGL 3WKNA 3R8QA 3DUHA 3JV6B 1L7IH 1X5GA 5CJXA 4LOUD 2AS5M 4Z7QE 1D9KA 1X4XA 2EDHA 3RNKB 3KPRA 3WD5H 4HUXB 4OGXH 3G5VB 4U1GB 3VRLF 2BY3A 4RFOL 2WP3O 2BC4A 3IDIA 3S4SG 4GBXC 1NGXA 1T1XA 2ITCB 2EDBA 32C2A 43C9A 3PHOB 2FJHB 4Y4KC 5CHNA 2GFBB 3DRTA 1YY9D 1QLEL 1RUQL 3ARZA 3MLZH 1CIUA 1OSPH 2FECI 2IAMB 2MQ0A 4I4WA 2YA2A 4E5XA 4YDJA 1KSRA 1HN1A 1UQSB 4A6YH 5F1NA 4J12A 3EO9L 3W2DL 3BPOC 5L2KE 3LN4B 1AIFA 3X3FH 4HJ0C 2GYSA 3OTTA 1PY4A 4OZFA 2MPAL 1F00I 3D69B 3QA3B 3MV11 2IAND 5BMFL 3N50A 3TIEA 5EOCH 3O0RL 4PD4K 4MXQC 4BFBD 1I1AC 3BE1L 5TQ0L 2YD8A 5MENE 3ARFD 3KYKH 5EOCJ 3GRWL 1C1EL 4XPAH 2H8PA 5T3XE 1QEWA 2A83A 1S78D 1A5FL 2PN5A 3MLVH 4MCZB 1GH7A 4FQIH 4XAKD 3BGMB 3TLRA 3ARRA 4Z78A 2P5ED 1JPTH 3STZA 4HPOL 5D1QC 2EEDA 2V5TA 4NSKA 1KGCD 2Z31A 4Y88A 3BZ4B 3FB7A 1VACB 4F2MA 4FQ2H 2JJTC 4LKXA 3DTXA 3FO9A 2VXSH 5IF0A 4PRHB 1I4FB 3KS0J 1FVDB 2D7QA 4UDTA 4AM0A 4PS4H 3MJ9L 3S8WA 4HC1L 4H88L 1BVKA 1FFNA 4M61B 4RAUB 3TPUA 4HWEH 1FH5H 4YXLH 5JA8B 2X44D 1OTUD 5L9DL 4KROB 5DEGA 5ENWA 4WI5A 3C9NB 1KCKA 5A3ID 5I8EB 1IT9L 3DSFH 3SY0A 5FGBC 4FFYH 3WLBA 3VFWB 2IQAB 3ALPA 2UZIL 2CRMA 3EDDA 1JVKA 4V1DE 3NAAL 1MHHA 1XIWD 3WXWH 4RDQF 2IFFH 5MEOB 4KZDH 5JR1L 4QRTA 4GRWF 4UT7H 3L1OH 1T83A 3O9WD 5MEQA 4N68A 4PJIF 3RNQB 2NY3B 3C2AH 4EOWH 3RZWA 1K4CB 3SE4A 3QJHA 5CCKH 4WWKD 1RUPH 1UB5A 3NFNB 3ARUA 2C1PA 4RFEB 4L8DA 3Q6FA 1HH9A 1T1WB 4CDGC 4OKVB 4QHKI 2DIAA 1A8JH 1JI2A 4NP4H 1RZIB 4X5WB 4PG2C 1DBMH 4C56D 5E9DB 4L4TD 4XB8A 3NIGE 1XR8A 2OXGA 1F3JB 1ZSDA 3UTPE 1NC2D 4OF3A 4NKDB 2VR5A 3L7EA 2CDGA 4Z95L 5FA4A 3P9LA 3TYGH 4XAWH 1YQ2A 1RUKL 2X89D 4UV4H 1CLZH 1DL7H 3IYLW 2O5ZL 3UTSE 2E7BA 5EZOL 1EERB 4WI6A 1TJIL 5BOPA 2WBJB 4ISVA 4Y1AD 3VXMA 1G9ML 5KS9A 1UWGH 4NNXB 3DMMC 1DUYA 4I3GA 5I19H 1Q9LB 3EYVA 3BZFB 2YN5A 4K3JL 2AW2A 2AGJH 2GTZB 2GK0A 1IEAB 1I1CA 3GB7A 4KKAC 5T3ZH 3IJHA 12E8L 1NFDB 3LRSB 3RVUD 3VDAA 4EI5C 3T0BA 3DROB 3MNZA 1BGXH 4X6CE 4YHZH 4WU7A 4PRPA 2RB8A 3FFCE 5EN2B 1JP5A 3T0EB 3MRFB 2B0SL 4JY4A 1NGPL 3MV7E 3T1FA 2YSSB 5CS7A 1BWMA 1HQ4B 5L7XH 4KMQA 1QKZL 2FLRT 3V4UH 2DQUL 1YEKH 5D7JC 5CILH 1ZHBB 5I0DA 2OX5A 2Q7YA 3ULUD 1Z9SA 2MMXA 3SCMB 5IHZA 3GBNH 4LBEB 1DLFL 1BBDL 4KK8C 4MQ7A 4DGVL 3REVA 2H32A 3HMXA 3ESUF 1OGTA 1DVFC 1M7DB 2R1YA 5F93C 1CDUA 2HN7B 1CLYL 3QG7H 2QQKH 5KSUA 5CEXA 4QRUA 3PP4H 2HYMA 2W07A 4IMKA 4XZUB 3RVWD 5IB2A 3O2VH 5JMOC 4JFED 3HFML 2A9MH 3OJ2C 1BLNB 1NMAL 5D7IB 1DBJL 3RX8A 3AGVA 1M6OB 4RAVA 1A7NH 2CUIA 2GITB 2B2XH 4FNLL 4UT9H 2EIBA 1QG3A 1UJTA 3H9SA 2BMKB 5FF6A 4K7PH 1XF2B 5JXAL 1BFOB 3EO0B 1ADQL 3VGAB 1CFTB 1MFDH 1RHHB 4YE4H 1WZLA 5KAQG 3V0AC 5F3HB 1F11B 5FECB 3B9KC 4NQCE 3O4OB 4KV5F 1GZPB 3VRLE 1MREH 1KCRH 1TJHL 3MLUH 4Q97A 4Y5YC 2R23A 3QDJD 4YAQA 5KVEH 3P30L 1NBYA 2FZ3A 4Y4FB 2PF6A 4P46D 4HIJA 1GCFA 1AQDA 1P2CB 2NY4D 1UEMA 1FV1B 4K3EH 3OKLA 3LV3B 1JZ2A 1XF5B 3SDDB 5D93C 4OAWA 2DQCL 3KYMA 4DKEH 1VGKB 1B88A 1EXUA 1U8KA 1DDHA 3ALXA 3MJ7B 1MUJA 1KENL 3RIAF 1KTRL 5EC1B 4P2RB 2MSPA 3B8YA 1ZLUK 4XP6H 1FNSL 2VZTA 1LGVA 3WUZA 5I73C 2P8LA 2AEQH 3RTQB 4DCQA 1KJVB 2OZ4H 3ZKMD 1KNOB 5DMJB 3UTTD 2VXVH 4JKKA 1JGLL 3EOAB 4HWZA 1A3LH 1UKSA 5GS0L 1MHCA 1MAKA 1OD9A 1DBKH 3WE6B 1H0DB 1MWAB 5I8OH 4XRCA 3O6FA 1P84J 2GJJA 4Q74A 1L7TH 3DBXA 3BEWA 4YDKL 3S37H 1S7RB 4DAGL 2QSTA 2PYEB 4MMZC 5CP7B 4F7MB 4EXPX 1I85C 5DD3L 5HDBF 2DICA 3R0NA 5DJ6B 2P45B 1MJ8H 2X4RB 4Q6IA 3T4AA 5CJQH 3QIBC 1PKOA 5KJRL 1LO3L 5T1KA 2BVYA 1FYHB 4JZNB 3NZHH 1PG7H 1EZVY 3TBWA 5L0QB 2DI9A 4R96B 3QUXD 4XNMA 5BXFA 5BZDA 5DI8B 4KRMB 3D1MC 4RBPH 1SYSB 5J3HC 1RIHL 2EXYC 2ZOLA 4ONGH 3TC9A 3KPOB 4IRSD 3QRGL 4AY0A 1WZ1H 4ZNCD 2XZCL 4GS7B 1YEDB 5JNYA 3QFJE 2LE9A 1AXIB 3MRJA 4U1HB 3EYSL 5FV1L 1AO7E 2KUTA 3PGDB 1Z5LB 3D3VE 3SO3C 1OP5H 4U31A 5MENA 2J8HA 3QO1B 4HIHA 1CCZA 4RGOH 3MRGA 3V7AE 3AU1B 4EN3C 2ADIA 4S1RL 1G84A 1DUZB 4LLMB 3NABL 3EO1B 5DMGD 1G7MB 1ZA6B 3QCVH 1QO3A 1XH3A 3QP3A 4JQIL 4JCLA 1F6FB 4GRWE 2P5WB 4X99B 1YECL 2G75B 2GCYA 2EDNA 1M71A 2DKUA 4ZNEA 3QHFH 3MRKA 1ED3A 2D03H 2FEEI 3QQ9C 1IKFL 5LBSL 1SJXA 2X41A 1HXYB 4OIIL 1G0YR 1D6EA 3IFNH 1G0XA 4LP5A 3WO4B 1F90H 2I9TA 3FMGH 5IW1A 4ZXBB 1MHEA 1I8LA 2RCSL 4L9LA 1PEZA 4QRRB 4NFDA 3ARDA 4YO0B 3ZE2E 1KLGA 2FX9H 3IDMB 4PJGB 1QSEA 5LXGH 1SMAA 1JK8A 4ZAKB 3T0WA 2WANA 2JK5A 4PGDB 1JZ3A 1G7LA 1RUAH 5EZLB 4V1DA 5MP6L 1KBGL 5C0RH 1K8DB 1MF2L 1SEBB 2P8PA 3QB7C 4NRYB 3T2PA 4JO4L 4JB9L 1J9CT 1WZKA 4D0CA 4F58L 2Q7NA 2YD4A 5GGUB 3PJSB 4LCWA 4QOKE 3MRBA 3QPXH 4QHKJ 3U9UA 5E08H 2R9HD 1S7SA 3FL7A 2IBZX 2A74B 2C3VB 4XP5L 5T33L 5GRUL 1IGTB 2F53D 3HCVA 4XBEH 4HMEA 4G5ZL 2V5YA 4OI9A 4DN3L 2RQ8A 1R3IH 5E1HB 5F88B 1FG2B 4QXWA 3LQZB 5E8DL 2VLRD 4MX7B 5C09D 3HS0A 2F19H 1LEIB 1F6LL 5LWYL 2PW1A 4YBLC 4KZEL 3QAZC 1FNGA 4TVPD 3ES6A 4YK4C 3O2WH 2UZXB 5F44A 3O8XB 2V17L 4JN2A 1QSFD 2H2SD 5IROC 1NAMB 5JHDE 1B0GA 4JFYB 5EUKB 3WHXA 1A6WH 2I25N 3O2DL 2MKLC 4PJ9D 5DWUL 1EEYB 3INUL 1XZ0B 3S7GA 4Z0XB 4Z7VF 5T5FL 2VR9A 1MCPL 3LEVH 2G2RA 4JVWA 4JQXC 4Z9KB 1ZLVH 2VLJB 3F6IA 2BX5A 2UY6A 3QXVA 1UG9A 3VMPA 5E5RB 4DZBA 1ZTXL 1X5FA 5I16A 3F7RA 1CXLA 5DD6B 3DGCR 1S5IH 4G8GE 1G9NH 4X6CA 4GW5A 4QTHA 5ESVB 1K3IA 3HZMB 1JCKA 3Q0HA 4ONFL 1RVFL 3VFOA 3IDYC 3FFCA 3WJJA 2QSCH 5D1ZD 3TGXA 4GRWH 3MV7A 2XQBL 5HI5C 4OCYL 4KV5E 3IU4L 4HLJA 4NOBA 3QUYA 3C60D 3FT2A 1NGQH 1G6RA 3VWKD 1EUUA 3KPSE 5J4MA 3MBED 5GSRA 2HRLA 2ILLA 5C08A 4PLJC 5AYUL 1TETH 3ARGB 3WIHA 2Q87A 4FXKA 1D9KB 5AZEL 1PKQA 3KPRB 4GQ9L 4M7KH 2DQGH 1D3CA 2WUBL 2FL5A 3B9EA 3AM8C 5DLMH 5ESQA 2BC4B 2DAVA 3IDIB 5ANMA 4KKNA 2OR9H 3TWCH 1NGXB 1T1XB 2DB8A 2G9HA 43C9B 5GGRY 1UH2A 3RDTC 1FGNL 1C5BH 3DRTB 5D7LE 5HGHA 3K81A 4HUKB 1PLGH 5E2WL 5JORB 3EOYG 4GRLA 3MOAH 1UFUA 1P53A 4I4WB 4E5XB 4YDJB 3WNKA 4I0PD 5F1NB 1X5KA 1RZGA 3K8KA 1WIPA 5I1HH 1JYWA 5HDBE 4OZFB 3FN0L 4X7SH 4WEBH 4Y16C 1W0WB 3ABZA 3V0VA 3DUSA 2JJSC 3KJ4B 2W38A 1L9NA 1N2RA 4CUCA 2AJYH 3U7YL 4FXLA 3MRPA 5ITFA 3RX5A 2H8PB 5DJCA 1QEWB 2AJ3A 2VZOA 2A83B 1RD6A 5F7FA 4ZTOL 1BM3H 1AXSB 1EV2E 1T7WA 2IANA 1QR4A 4Z78B 1OB1A 3RVVD 3STZB 2M26A 4WI9A 4MAUL 3BPLC 1J1OH 2BY0A 2ED8A 4JN1L 2DQHL 3LH2L 4NSKB 2Z31B 3ARFA 3FB7B 2Y23A 4D0BB 4F2MB 2DLGA 4LKXB 3FO9B 2RGSA 5T1MA 3GMPA 2F8OA 3AB0C 3UJTL 1D5BA 5I6XC 3OJDA 2MOVA 4UDTB 5DR5L 3WDHA 4AM0B 3U0PA 1IFHH 1BVKB 1J88A 2P5EA 3C5ZA 1Y6NR 1FFNB 3TPUB 1AY1L 4JFDE 4OLWL 1I7UA 3BO8A 1U9KA 3QO0A 3F12A 2ZCLH 4PV9B 1IKNC 5ENWB 2WUCL 4HUWA 5DVOA 1IM9A 1MRDL 2ARJA 3QEGL 2GJ6D 3DUUA 3RJQB 4KK9C 2Y06H 1T7YA 1KCVL 4JY5L 4DN4H 5DD1L 5D8JL 3SY0B 3WLBB 5CD5C 4LPTA 2X70A 4W81A 4U6VL 3DNKA 2YKLL 1MHHB 3RKPA 1S7UA 2ZUSA 5EDXA 4NKMA 4QRTB 5LGJA 3QFJA 4HJJH 2OMNA 1TZGL 5MEQB 4GG6B 4OZFG 2DQFA 1AO7A 3UXFA 1CL7I 3QJHB 3D3VA 4GAJH 5DFWH 4NN6C 1UB5B 2C1PB 2XFXA 3QG6A 4LF3A 3Q6FB 5CWSA 1HH9B 4HH8A 1XIWA 1CXHA 2VDNH 4Q9BA 5FB8A 1SBSL 3SBWA 5D2NC 3DWTA 4G8FA 4HCRH 1XR8B 4J6RH 2CUHA 1ZSDB