1SY6H

Crystal structure of cd3gammaepsilon heterodimer in complex with okt3 fab fragment
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
219
Chain Sequence
QVQLQQSGAELARPGASVKMSCKASGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSAKTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human T cell receptor CD3(epsilon)(gamma) heterodimer complexed to the therapeutic mAb OKT3.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/antibiotic
molecule keywords OKT3 Fab light chain
total genus 45
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2004-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1sy6H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1sy6H02
2XWBA 1QFWL 4HCRL 4LDOB 1RZ7L 1XIWD 4LLYA 2JF1A 1AR1D 2WUBL 3CLFH 3VDBA 1D9KC 3HCVB 2BMKB 1UVQB 5A40E 2FDBP 2IG2H 2C3VA 3BOVA 5I1EH 3BZEB 2H6PA 3MACH 5BV7C 3GMOB 3VGEA 3EYQD 2P44B 3FT3A 2X1PA 3ULVD 4GOSA 4Q97A 1RJCA 4Y19D 3UTTD 1WWAX 3RUGA 3PABA 3CXDH 4XXCA 3PIQA 3PDOA 1JV5B 3WNKA 4G6KH 4AENB 3MLVH 4GMSL 4I1NB 3MLXH 2F53D 4MXVF 3S37H 3PWJA 5I1JH 4P9HL 5HYIA 1FGNH 3VI4E 5AWNL 4TTDC 3WIHH 4HCRA 4F7MA 5GJSL 5I1HH 3FT2B 3EOYG 4Q58C 5D2NA 4ZSOA 3MBXH 4L9LA 4JPIB 3VXRB 5E99H 4WFFE 2VAJA 1CGYA 4HS6B 5KSBB 3ARRA 4G6ML 3D3VB 4N0UA 5J6GA 4YHIB 3OTTA 3KGRA 4NQSB 5F88B 3NPSB 1HQRA 3VXUA 3QG6A 3C8KA 1WIPA 3VRIB 2C1PA 4LLWB 5DJXA 5TJWK 1EXUB 3SDDA 3S37X 1DQQA 1DANU 3HNSL 4G7VL 1CXHA 2I9TB 1OAQH 1Y18A 4YFLF 3LS4L 2X2YA 5GGQL 4M48L 3FO9B 3PQYB 2FIRT 1OP5H 1BBDH 2CLZB 4Z18A 2KZ1B 1FFQA 5DD3L 5CZVH 1CFVH 2AI0L 1FYHB 3RX8A 1A14L 1YY8B 1NUDA 5FO9B 4C4KT 4FABH 3RVVC 1JPST 2VIRA 4AQ1B 4EI5A 5B38B 3SJVD 5KW9L 1WC7A 5I6XC 1ZHNA 2VLKA 2XQBL 5CEYB 4KI5C 5FYJE 4LFHG 1GZPB 3WUWG 3WNPA 2BRRL 3U6RA 2AV1A 2AGJL 4G7YH 4NN7C 3G5YB 1RZ8A 2Z9TA 2D7TL 1AKJD 3EFDH 4EI5C 4QGTA 3W82A 4P5TC 1A6TA 1I8KA 1B0RB 2EXYC 3BYYA 5IVXE 2NY5H 3RKDC 3FO1A 1KJ3L 2BNQD 4GG6A 4Z7OF 4AIZA 1X5YA 2NW2A 3AM8A 3QG6B 1HQRB 1OP9A 1JMZA 5D5ME 3BT2H 2F8VA 3BUTA 1X7QA 3HR5A 3ULUL 3QDGB 2D9QB 1GGCH 2HLFC 2QKIB 3TA3C 1UA6L 4LLUB 5HYJD 3GSWA 3RI5F 3SJVB 2Y6SC 1I7ZB 4Z6AT 5CJXA 3KPNA 1YEJH 4M48H 2JB5H 2YPLB 4R90H 1WLHA 3NH7H 4UDTB 3L1OH 2GJJA 2WWKO 1SVCP 3PWJB 5FHBH 2KL6A 4OSUH 5C6WH 4AMKH 1A14H 3HI5H 2ED7A 4IMKC 4JG0H 4LHJB 4EI6A 5H2BB 5JOPD 1F4WL 1JZ4A 1JV5A 3V7AE 2X9YA 4OZHA 4F58L 4OCXH 3TBYB 3UEZA 5BS0D 3MJ7A 4S1SL 5D7LE 4RGOL 3V95A 3ZLQC 1I1AD 5E24E 3JUZA 2ZNWA 3P4MB 2AJ3B 5BCAA 4UBDC 1WZMA 1YECH 3MRIA 5F3HA 2VLJA 4O2CB 4C56D 4BSVA 4L8CA 3MBEC 4YR6B 1BX2A 6FABH 5JO5B 1I1RA 5IOPA 3OJDB 3UYRH 2ZG2A 4PJGA 3CFDB 1BF2A 1P5UA 4N68A 2X44D 4LP5A 2X41A 4PRDA 2HFTA 2F74B 2F53B 2E5EA 4EVNB 1H8SA 2Y07L 2VQ1A 4PBXA 4GKZB 2BVYA 4H26B 3WNOA 2R2HB 1MCOL 2I27N 3FQUB 4J7RA 5I19H 1UWEL 1FO0B 3OAYK 2WSKA 5D6CA 4XTRC 5KSVA 1JPGB 4YHKL 4LEOB 3V79C 3EDKA 1NEUA 5BRZD 1S9XA 1T2XA 1RQ5A 2FWOB 4U6XA 5J11C 3HUJE 3RVXD 5C9JB 2JELH 3TT1H 4RGOH 1JZ3A 2FBJL 5AUMB 3NCJL 2DAVA 4J3OC 1WFTA 2VDLH 1H0DA 4APQA 1B88A 4PJ5D 3L5XH 3P11L 4P2YA 5TF1H 3G04B 4G9FE 1ITBB 4ONHA 4JZOA 4L4VB 3G6JF 2YUVA 1VSCA 4KJWC 2VDQH 2YUZA 1NBYB 4G6JH 5GISH 5HHXL 4LIQE 3UTPE 4JDTL 4N0YH 3M07A 3BWAA 4FMFA 4P99A 5ANMA 3NACL 4PJBF 2A9ML 1F58H 4WWKA 3QXUA 6CGTA 2Q8BH 1G7QA 2HVJB 1U8IB 3D18A 3GBNH 3VFVB 2DQCL 3VFRA 5DEZA 4X6EA 2XRAL 3NIGE 1JWUA 1YNLH 2JB6A 4PJEB 1M4KA 3HI6L 2OR9H 2V5TA 4X6CE 4GMTH 5EO1B 3HLAB 1VFAA 1V7NH 3ARYA 5JOFB 2BHYA 2D31B 4H0GA 1VA9A 3MROA 1QYGH 4Y4KB 3TNNA 5IWLC 1JYNA 1PLGH 4DW2H 5E99L 3SDYH 4R6UA 1R3JA 5JW4M 1OD9A 1R3HB 3S88H 1QBML 4KRMB 1J0KA 4J6RL 2ICWI 1U8MB 1QRNE 4B7LA 5I1DB 1CR9L 3SE4A 3V5HB 4UV7L 1K6QH 2VAAA 4IMLB 4MQ7B 3KPPB 4J1UA 2VLRD 1XF1A 4GXUM 3WFEH 4IDJH 4D0CA 4PJDF 2R56H 1PZUB 1IC4H 5DJYB 1GPOL 4XB7A 3FCTB 4JRYA 2R15A 1AGEA 3SDAD 1E4KA 4Y19E 2ADJA 4G6FD 2HFFB 2AXFA 3QUKB 3QNXB 2EYSB 3RWHB 1LE9B 4KY1L 4A2LA 5GQBA 4HWNA 1RUML 4NZTH 4YAQA 3NVQA 4X6CA 4AJ0A 4LCUB 3R8BB 3GNMH 3JXAA 2WQ8A 4ODTL 5F93C 2AGJH 4GKSA 4PRPB 4HSQA 3IJYB 4Z7WE 4V1DD 4RNRA 3VU2A 3T2PA 4TVSa 4CKVX 2D31A 1VFAB 3KXFD 4M1DH 4JVWA 4OKVA 4ZS6C 2BFVL 3IETA 3Q2CA 2DLIA 1IT9H 5E2JA 3KJ4C 1XCQA 3QQNA 1K2DB 2ZOKA 1DFBL 32C2A 3CFEB 3MC0A 4QWWD 1CE1L 2V7HB 3QA3B 3NZHL 4QLRA 3O6KH 1XF2B 3FN3A 2J8UE 3VE0A 1K9TA 3KPSA 2EDNA 3RUGE 3GUTA 4YDVB 1A1OB 3TIDA 1I9IL 4ZAKA 3WE6A 1NC4D 4LCCC 1FNGB 1RJZA 3MRQA 2QSCL 2Q6WB 4OFIA 5FYLE 2BJMH 1I3VA 4WWID 5BOPA 4L4VA 1CICA 1EJ6A 1UEMA 4IRSB 3QUYD 4X5WA 4ORGB 5ILTL 4LSUL 15C8H 4JG1L 4UT6H 1YN6B 1YQVH 4JQIL 4JY4A 3W2DL 5T3XE 5C0BE 2QQLH 1DVFC 1H0DB 3G5ZB 4LARH 4XB8A 1P9MC 3OF6D 2VDNL 2B39A 3TBWB 3BKJL 1A22B 2WUCH 2NY0B 2O61A 3QDME 5C9JA 3QCTH 1T1YB 5CGYD 1YECL 1XR9B 5F3BB 5KSVB 3P4NA 4XHJD 2Q3AA 4RFNB 2JE8A 1QLFB 1N3NA 4Y0GA 2YC1B 1EGJA 1BVZA 5TGBB 2APTA 4PR5B 4OBRA 2AJUH 3AY4A 3L9RB 4NSKB 2VQ1B 2XQBH 4F9PC 3GJEA 1QOKA 5MHSE 3PHQA 3C9NA 1NUFA 1DLFL 4Z9KB 1FGVH 4QRRD 4S0SD 3N85H 5HD8D 3RU8L 5C0GB 5T1DL 3D39E 1MCOH 2PCPA 5DLMH 2QSQA 2N4IA 4PJBA 3QBTB 1JGDA 3QXVA 4PJDB 2VC2L 1U8KA 3LKQB 2BVQA 5C0FA 4XHQA 3TPKA 3MCLH 3P4MA 4HXBL 4I0KA 1G0DA 5T3ZH 1L7TH 1MAJA 2FJFB 3UTTA 3MA7A 1DR9A 3MJ7B 2BNRE 5F9WC 3EOAA 3KHOA 3EOBB 3CJJA 4CU7A 4N1EA 4NO3B 3U9UB 4PRHA 3QFDB 3LN4B 4EI6B 2IF7A 3GSVA 5EC2B 3RWEB 1VACA 1QSFD 2XV6B 1AO7B 1ZT4B 3GFUA 4G8GB 4KPHH 4K9EL 1NGQL 3RRQA 3E2HC 2A73B 1ZLUK 2BCKB 4Q7DA 4LLQB 3CZFA 4JM4L 4BELD 5DZOA 1I7ZA 4NQDE 4P5MA 5CWSB 3GSWB 1F58L 1YYMH 4LLUA 2XPGA 4HV8A 2QKIA 4WUKL 5EN2B 5ISZA 2CIKB 1A7QH 5HHOE 3QUML 4PJ7B 3LKSA 1DBJH 3IF1B 1NGPH 3SBWC 1CK0H 4RMTA 4AEEA 3H0TB 2NW2B 2X4PA 2X4QA 3TVMA 4NC1E 4XCNB 1ZLSH 4OZIB 2VISA 1A1NB 1CFQA 5HYFA 5JZ7D 5FM5M 1G9ML 1VCAA 4IDJL 3LZFL 3UBXB 1RZ8B 3SE8L 3C2SA 3U0PB 5DGRA 1OWWA 5F9WB 3OKDB 4PLKC 4YHOH 3WFHA 3QNZA 1ADQH 4NGHH 1MFBL 1WC7B 1FZJB 3D9AL 2NXYC 4R2GB 1I1FA 2GIYA 1T22A 5FO9A 1QBMH 3ZHKA 1J8KA 4PGJA 1EEYA 2OJEA 4PP2A 4DKAA 4OF7A 4HF5H 4PLKD 2IPTH 4LBEA 3P77B 3P73B 2VDKL 4JFFE 4I5BB 4AH2B 2APFA 2JCCB 2R69H 3LD8C 3TO4D 1JNLH 1KF9B 5D70L 1WITA 1YEGH 5EO0B 1G1CA 1CLOH 2H32H 2VN4A 1PW3A 2D03L 5DJAA 4E42B 4P57B 4MX7B 4EN3D 4LLWA 3OKKB 5C92A 3AY4C 1KC5L 1X5LA 3VMOA 1MHPH 2DLTA 5EBLB 2IH3B 4QF1B 3D3VA 3QH3A 5EU6E 4HS6A 4TUKL 4H20H 4ZO6A 3VWKB 2EIDA 5IB5B 5LVEA 1EAPA 3CVHH 4RRPG 5D2NB 4LKXA 5H37G 3NACH 1A1MB 1IAII 5DO2C 2BZDA 1VGKB 1SBBA 4F9LC 2XZAL 4NOBA 5FA4B 5DJ2A 3U4AA 3SDXA 1FQ9C 1HNFA 2R0ZL 1NANH 5DQJA 4D9RE 3C60C 3ARBB 2LU4A 4G80B 3FOMB 3G08B 1HILA 4N8VG 2PYEA 4ZOEA 5LGKA 4Z7UB 2LAAA 1X5ZA 3ROLA 3KPRD 4GBXC 3CX5K 4DFHA 1OM3L 4J3VA 3A6CH 4IS6B 3GMLB 1LO2H 4WEMB 5ACZB 4AG4L 2QSCH 3PNWA 4I0PB 5JDSB 2NR6D 2Y9RT 3PP3K 3QEHB 2MHAB 2DLGA 4WI6A 1S9KC 2X4RA 5C0CD 2X05A 5K9QG 1FYTD 5SV4A 1CR9H 2ZUYA 2P8MB 2NY1B 1J05B 1FH5H 4Y4HC 3NAAH 2Q7YA 2IALA 3V0VB 1HQ4A 3QYCA 5K33A 4YE4L 4WFHD 1QSFB 5CEXB 5CJ5A 5SWZD 4GUPA 1CXEA 4KTEL 1ZGLP 2Q86A 3EZ8A 2FLRT 5GRYA 1O5DT 2AJVH 4X7TB 2V17L 4Z5RA 4OUOA 4D8PB 3F5WA 1KNOB 3RAJH 4U6YB 3RWIB 2JLLA 5GJTL 5CEZH 3AS1A 1MCIA 4U6HA 1GZQA 2IG2L 3QZWG 3ARFA 1VEPA 4UQ3A 4HXBH 5HVHC 4Y1AE 1NBZA 3TYFA 2R0KH 2ZG1A 4E0RA 1CG9A 4G8FB 35C8L 1H3XA 1BFVH 1I85C 2R2EA 2D7PA 2FATH 2HH0H 4JFEE 4MWFA 1T80A 2CGRL 3VXME 1AD9A 1HHJB 3RDTA 2EIEA 4TSBH 4RMQA 5EBMA 4EOWL 1K6QL 3KYMA 1LGVA 3UYRL 1FNEA 4O00A 3TN0C 3ALPA 2XWTB 2JJVA 3V5DA 3VFSB 4LRNH 2W60A 4HG4K 3NFPB 4OT1L 5D5MB 5LCVH 3VFMA 3MRKB 1P5VA 4HJJH 1K3IA 1YNTB 2A38A 1OAZH 4LSSH 1YEDA 3ARED 1VFOA 5HGHB 1ZSDB 3BKCH 2KQMA 4X8JA 1IQDA 4Y8AA 3MLXL 1N26A 4M1GH 4YDJB 5FOJA 3QCUH 2ICEA 5E94A 4KJYB 4M62L 4L1DA 2H8PB 1ZHBB 1DDHA 4HFWA 5AYUH 4AEHH 1OB1B 3FONB 1U8PB 5BW7A 3EFFB 4CGTA 2MCG1 1BFVL 5HGBB 5IHZB 3BEVA 3P9LA 3TN0A 5I30L 1QSVA 1F2XK 2A6IA 3LEYL 2DM2A 4Y5VC 4YFDB 5IQ7H 4XPTH 5GRVK 4HG4J 1BGXL 5BS0E 1JGEB 5CSZA 3TCXA 2FJHB 3U0WL 3RTQA 2GSGA 1F11B 2R8SL 4OD2A 2VITA 3R1GH 3RUGF 4N0FA 1AQDA 1Q94A 2IBGA 5J9PB 3DSNA 1E4WL 3VMNA 1G7JB 4DKFL 3QEGL 2FR4A 4NKDA 1FFRA 2DLFL 2H32A 1U92B 5D96B 1Z0NA 4XP1H 4MJ2A 4DAGH 8FABA 5D7IB 1KIPA 5HVFB 1IAKA 4O2EA 2MTPA 1T1WB 4LFHD 5DJCB 5IVZB 3QHFL 3UTSA 5A2LH 3TBVA 2ERJC 3FRUB 4N5ED 3QUZC 2E9JA 4TNWF 1UA6H 4MA3B 4S11A 1EO8L 1S7SA 3RPIA 1IC5H 1U95B 3DVIA 4K07A 5DF0A 4Z95H 2KKQA 1RZJC 3TZVD 4JKPL 1WF5A 2PTTB 1RVFL 4ZOAA 2G75B 1PLGL 5KBNC 3L5WB 1KCVH 5D1XD 3HI1B 3NPZB 3EJYC 4N90D 5L88H 4PTTB 2LQRA 3GSUA 1TVHA 3NA9L 1XT5A 1N64H 4R7DB 3CCHB 4JHWL 4NNPL 5TQ0H 5EU6A 4I9WE 4QHUA 2ITDA 4JB9L 4NDMA 1F45A 2VN7A 3SY0B 5IMLA 5JXAH 2FHFA 4S0TD 1RZGA 5C2BH 4P49A 4R0LB 3PWUA 3GHEH 3ALWA 4M7LH 3AXLA 3BPNB 1OAXH 5DMYA 5JORA 3UX9B 1I3GL 1IGJB 4G8IA 4UIMA 1IEBA 3LB6C 4HCRH 4HKJA 3VWJD 1AIFA 5FAAA 4RDQG 4DQOL 1OGAA 2X1WL 5HHMD 4XVSH 1LNUA 3S35L 4Y4FD 4AM0B 2JJTA 5C0JB 4HC1L 3EIFA 3OJ2C 5EBWB 3N1GC 1T03H 5E8NA 4JPVL 4JJHA 4LCWA 3LZFH 2H1PL 4MJ4A 5C0AB 4L3AA 3MZTA 3P0VL 2X1QA 1BBDL 1I3RB 3S5LB 4KJQD 4XRCB 1OAKH 3BH9B 4E5XB 1ADQL 2BVOA 3ZYIA 3CMOL 2W59A 2DQDL 3OR7A 5IESH 2DIJA 4CU6A 3VJ6B 4L4JA 5B21A 3O6KL 1C08B 3SDXE 1J9CT 2ITCA 3U9PH 4PGEB 3MNZB 3QSKB 3QNYB 4MVBC 1MQKH 3QQ3A 4OUUB 5LXGL 5FECB 3ARGA 4DN4L 3S3PA 5BOZG 4UT9L 4HK3N 3NAAL 5C0BA 5KVDL 5AZ2L 4Z8FH 3BZFB 4KH2A 1TCRB 5MENB 5I75C 2OP4H 4NC2B 2M8XA 1BF8A 3PJSB 3BSZL 3WS6C 4XP6L 4PJGE 5E1AB 3UP1A 2OYPA 1FDLH 1EUTA 3AS0A 3IB4A 4NN6C 4UIKL 3UCRA 4U49A 5DHVB 5I74B 1A9EB 1QFHA 4A6YL 3WCYA 5E8PB 2ZOLB 4B50A 5D72H 1J8HD 1KEML 4OF3A 4KGJA 2VKXA 1B4JH 4UT7H 3BO8B 3H3KA 5I15L 4J4PA 4MNQB 5IHUH 1MCCA 5GRXG 3T3ME 1IE5A 3KPRE 4NQVA 2VR4A 3ARSA 3GMPB 4GQ9H 5BV7L 5DHYA 4ZD3L 4HKZA 5J4MA 3P3YA 3CMOH 3REVB 2UUDH 3KLAA 4NZUL 1R3KA 2KZWA 1HH9B 5EFIB 5F89A 3D5OF 1IEAB 2HFGL 5FA3A 1S3KH 4RISL 4UOW0 4C58B 2VL4A 4DKEH 3L3HB 5I1CH 1WK0A 3LV3B 4HS8H 4N0YL 4FNLL 2EYTA 4F33B 1FVEB 1D3CA 1IFHL 4JAMB 1KIUA 4TTGA 3QXDA 1MHHA 4HZAA 4RX4D 4MNGA 1GGYA 3IAGC 4DZBA 1CQYA 3HRZA 4TTDD 4FXKA 4HPYL 4HWUA 4NM4L 1KJ3H 1ZWIA 2RR3A 4XCEA 3VXSA 2P5EB 1Q0XH 4NYLB 4PY7A 5D2LA 3QPXH 5B8CC 2VZUA 4P2OC 3VMPA 1YMME 5FYKH 4GAYB 3RVTC 2DQIL 2B5IB 1C12A 4HZLA 4I3SH 1NBVL 3K8KA 1NL0L 3DUSB 5EIQA 1WTGT 2VUOA 1FG2A 4GW1A 4PGBA 4YHNA 3CXHJ 4LPYA 4QXTA 5E4EC 4OLEA 1BBJA 2AJZA 1B90A 1KN2L 1AJ7L 2P5WB 1DEEA 2HRLA 4F9LA 1AXTH 3ZTNL 3PE9A 3QDMB 4HHAA 4FTVB 3ARUA 2V7NB 2KQNA 4D0BA 2GJ6B 1XF4B 5JW4R 5BO1L 1EO8H 5FYKD 3IDNB 3VD5A 3X12A 1P7HL 1QFWM 3EJZD 1JP5A 2B2XH 1EMTL 5BQ7B 3O41B 1PDKA 5J1AA 1FL6A 4P4KA 5BXFB 1TMCB 1MI5B 1DN2A 4PJBE 2PUQT 4QRUA 2IPKB 1CE1H 3ILPA 3F58L 3B9KC 3MUJA 1A4JA 1I1CA 3GBMH 4OLYH 1C5DB 3JTSB 3HTLX 2X40A 5FGBC 2BHZA 4HMCA 4CNIA 2GI7A 1UGNA 3HZVA 1U42A 2AK4D 2CDGB 1ES0A 4JQXC 4ZUTA 3AU1B 4PRBA 1IGCH 3IS1X 4ENED 1NGWA 3PP4L 2F54B 1KUMA 3O4LB 1T89A 5DRNA 1KB5H 3EW3B 3FQNB 4XBGB 4ODWB 3HFML 3BN9D 1S7QA 3L3GB 1RD6A 5EC1A 4XNMA 1O7VA 2D7NA 3AUVA 4K7FA 4PJFB 4HK0A 2P46B 4O02H 5CHNA 1E27B 4HF5L 3GJFA 4Y7MA 5EOCJ 1CT8B 2Y5TB 2A6JA 3BVNA 3CK0L 2FZ3A 5T1MB 5T3ZE 2VDLL 1F3DH 4NPYA 1U8NB 2EKSA 2EDTA 43C9B 4OGAD 3VI3E 4NHUA 3GKWH 4TUJA 1FCGA 1NQBA 5B3JF 2DYPA 1EFXB 4XVJH 3F12A 3DVGB 4CRPA 1EAJA 4ZUSB 3UPCA 4OF6A 5CBEA 3BGFC 2X42A 3TBTB 5L6YL 2DQHH 5GISL 3EGSB 4YHLL 1Z5LA 4PG2A 1SJEB 4PJAB 4V2CB 1V7ML 3TIEB 3LEVL 2YSSB 3C8DA 3MLSH 4HWEL 2VXTL 1A5FL 1H3PH 4LNRB 3PXHA 5DD6B 5E5UB 5M94B 2DLFH 1UCBH 4OQ1A 5EO9B 3WD5H 1YEEH 4XX1G 4NOFA 3T3PF 1VFBA 5D1QD 2YRLA 5E08L 3OKOB 2DL2A 4FQXC 2DQFB 4ELKA 4NKMB 3IDMA 2IFGA 3BZ4B 4L5FH 3IU4H 5DDHA 5JHDA 4R4ND 1DUZA 4JDVA 3B2VL 4TNVK 4HUVB 3M8OH 2R2BA 1UM6L 3C60B 3T77B 2IANA 1AGFA 1S7RB 3QEUB 3BPCB 4XC1H 2R1XA 1YDPB 4U1JA 1BOGB 4F2MA 3C60D 1JTPA 4LASL 5FGBA 4K71C 4FQLH 3TBSA 3ZDZE 1SM3H 5MEND 1CLYL 1YYLH 4QXGH 1BQHG 3RNQB 2AK4A 3LS5L 1NGZA 1TETL 5L6YH 5CD5D 1RV6X 4ESKA 3BPOC 2CJUL 2YBRA 3ZKND 4RA3A 1FFNA 2OSLA 4HK3J 4NZDA 1BFOA 2BOBB 2OL3H 1I7UB 3U30C 2CLRB 1CDYA 1FNSH 1KJMA 5EOCH 4OGYL 1KBGH 1RIUH 1OWRM 4NO0B 1KTDA 5C07B 4BH7A 2VLMD 5C0AD 4KY1H 4X6BB 2X4UB 1U3JA 3O2VL 1UWXH 3PV6A 2LV4A 4GRMB 5IB2B 2R23A 1QFUL 3AMKA 4MCZA 4MA1C 4GQPH 1FAIH 3QUXD 3QUXA 1XGUB 3PWPA 4U1SA 5IEKB 3O45A 4MCYB 5E9DB 1CN4A 4MD4B 5E7FA 2GY5A 1IT9L 5I1LB 5HY9B 1YA5A 2V9RA 4JO2L 4LLVA 2XNAA 3ELAT 4OV6F 3WUZA 5ESQA 3TH4T 3VI3F 3KPLA 4KKLC 4CBPA 1JTOA 3ZKXC 4ZNCD 1KCRL 3T09A 1DSFH 3GEWB 3HZYB 5DK2B 3A67L 2YA0A 2VQTA 2V2XA 3X11B 3SDAB 2OMBA 4LIQL 3FQWA 3KPSE 4L3ED 2DRUA 2PYFA 1BD2A 1MQKL 1CXIA 4F80A 1T1ZB 4GXVL 3KXFE 3DYOA 3V6ZA 1E6JL 1YEFL 4B41A 4NWTL 1HXMB 1QTYT 4OFPA 1HCFX 5GRJH 2GJZA 4H8WL 4OF5A 4URTB 4GRLB 4JREC 1QEWA 4MNQD 1U58B 4Q6YA 2VWEC 4JFOA 3GMQB 3BH8B 3R8QA 2CKNA 1UM5L 4QT5A 4JHAL 2WUBH 1JPSL 3W2DH 3ZKMC 4ELMF 4I4WB 1CGUA 1J0ZA 1E4XI 3W0WB 1NCAH 2EDXA 4L8DA 4DZ8A 2B2XL 1DBML 5I2IB 5DMKA 3FFCE 1IKFL 3FO0L 3SQOL 5GZOD 2OQJB 2YRZA 4LCYB 5CINL 1T1XB 3FB8A 1KPUA 4WUUD 2FHBA 2X6MA 3M1BB 3QQ4A 4MDIA 3RKDD 4MLIA 4JVUA 2YKLH 4NZUH 2FL5B 4WI7A 2FB4L 2Q8AL 3SE9L 3MJ9L 4XI5C 3VD9A 1LO4H 3LPGA 5DJDA 4K3JL 4JN1H 4QCIA 4DN4H 3IKCB 1GC1L 1ZTXH 2J5LC 1KXQE 1F4YH 1G9EA 1AGBA 5SX4I 1C5BL 2FX9L 2EDFA 3MZGB 5DK0A 5FDYA 3EOTH 2XG5A 1JGUL 3GKWL 5TDNA 4C56E 3PWPE 5E5MA 4G8EB 4P2OD 4AY0A 5ID0B 3HMXA 4Z7WB 2R0ZH 5BS0B 4N8CL 4ZPVA 1AP2A 3M17B 1D5BB 3L7FB 1RAMA 2UZIL 4UINL 5CP3A 4ONFL 5E2VL 3DPBA 4YXKH 3TM6A 3VDAA 1KB5B 1R24A 1S7VA 1RHHB 4WI3A 2XA8H 2BERA 1OTUC 1ED3A 4U1KA 1CD1B 4NBXB 3GM8A 3R0MA 3DX7A 2IMMA 5EZOH 4K7PH 3LEVH 2APXA 4QRRE 4FFWD 3X3FH 5HYSA 2CD0A 2HTKC 4CVZB 1WBZB 4OZHE 1J1OH 5F7YC 1CFVL 1H3VA 2AI0H 3L95A 3GIVB 1J88A 4HGMA 1VGEH 3W11D 4X6FA 2Q76A 3ECBA 1ZK9A 5EU3B 3CDGA 4PJCB 5DVOA 4TOYH 3R06A 4JCMA 3BX7C 4DFIA 3W5NA 3B3IA 3I9GL 2JELL 4Z7NE 4Y1AB 3TFKC 1CL7I 4QRTA 3DROA 4U1NB 2EDWA 1IBGH 3QO0A 5DD0L 3Q6FA 1MCBA 2H9GA 5IR1B 3WHXA 3RTQD 5C6TH 2HKFL 3FJTA 4CW1B 3P9MB 5M7QA 4BQ8A 1ROWA 1B0WA 3K1KC 4FQ1H 1HDMA 3UZEA 3GBLA 4YXHL 4ZMAT 1H5BB 1M7IA 1MCDA 1YEEL 4MS8D 2E7LA 5C1MB 4TSBL 3TZVB 3OF6A 4OCNC 3GBML 15C8L 2YUXA 3IYLW 1A6UL 1M05A 4G6JL 1H15A 3K81A 4JG1H 4M3JA 4PLJC 1YPZB 2EO9A 1BZ7B 5ICXA 1FZOB 1L9MA 3HE6B 1HEZB 2CPCA 1LP9F 5JHLH 1PYWB 1X5KA 3LQAC 2A2QT 2FO4A 1IL1B 5DJ0B 1NBQA 3EDFA 5CFHA 1OF2A 1JF1A 2FSEB 5FGRA 4QNPE 4F7PA 2Y72A 4O51A 5D9SA 3DX9B 3QI9D 4P4KD 4AMKL 4ZDHB 1GVIA 5HPMA 5BZDB 4J23A 5SX5H 4O02L 2V5RA 1YC8A 5D7KE 1ORSB 3QULA 2FX7L 5TFSL 1CD8A 2E8ZA 3O3EB 3WNLA 5M95B 4OCRL 1OGAE 4I2XB 3EJZC 1S9VA 2EIZA 5LCVL 1T0NA 3F7QA 4HUWB 5CIPH 3X14B 2IAMC 5I30H 1A6PA 1NCBL 2Q7NA 5HGGS 2APVA 2OL3B 1LK3L 1RK0A 1JNHB 2CMRL 5LAXA 2YXFA 1HSBA 4JFPB 5SWSD 4I3RH 1GIGH 1RU9H 4Y5VA 2Y06H 3VA6A 4DCQA 1EGJH 5K9QI 4LKCA 4ALAL 3RY5A 4EQ2A 2K9UA 4PJ8A 3S35X 3SKJL 1AD0B 1A2YB 1S8DA 1WTLA 3FQRB 4L8SA 3X3GH 1FN4B 2ZG3A 3EAKA 4PY8J 3BIKA 2XZCL 3QJHB 3QUXC 3MLYL 1EFQA 1MJJB 1F4XH 2AK1H 5E00B 2XA3A 1BGXH 1D9KD 1IGIL 1GOHA 4N0CC 4NZTL 2ZUUA 3DBXA 1MY5A 4NJ9L 2PNDA 2G2RB 4M5ZL 3SGJC 2QL1A 3GSNB 2QHRL 3U7YL 4G9FA 3FO0H 4HKBB 2EICA 5DC0A 4YGAB 3TFKD 3MV8A 2FATL 4QTHB 4DTGH 5CD5C 5D7JC 1DQJA 4X5LA 4HUXA 5KAQG 3NA9H 3ZSTA 1U91B 2CK2A 3MRLB 5E95B 3VRLE 5IK3A 2R4SL 3NABL 4R0LC 5FUZH 5IB1B 3HC0B 3FB6B 4Y5YC 1NJ9A 1AGCA 4Z76A 2VJXA 4JM2B 4P46C 5TQ0L 4F7CB 2AABL 5D7SL 2CKBA 5KZCD 4MA8L 1ZTXL 1I85A 5MEPB 5C70A 4ZODA 1Y6KR 4P2QD 1BZQK 3UJTH 1NL0H 5F8QC 2PETA 2IBZY 1UKTA 3EYOA 3ARDB 3STBA 1GL4B 3UPRA 1RK1A 2YWZA 4MAYA 5GHWL 5F6IC 1NFDF 4DUVA 1FV1A 4ELMA 1HXYB 3OG4B 3RVUD 1G9NC 4YNYB 2YK1H 2CO6B 5CLTA 4QOKA 5JIKA 1N64L 1P7KA 1RZ7H 1ZOXA 4LSUH 4PV8A 3KLHD 4DEPC 3GSOB 1BVKA 3IU3A 5IUSA 2JIXB 1ZMYA 2UZXB 2ADFL 5B39G 2A74B 1UT9A 2EXYD 1ZGLB 4ODXB 5GS0L 3BP4B 1UEYA 4M7JH 1NMBH 4NHCL 3MACL 2C3WA 2WM0A 4MDJA 4C57C 4JRWA 5AYUL 3MLWH 5C0CB 1JGVH 3MUY1 3MUHL 3RWJA 3PGFL 1J8HB 1F8TH 1I75A 4OB5H 4OCYH 3VGAB 5L2JA 4M7LL 3CXDL 4MVBD 4W4OA 3TO2A 3W0WD 4YGVB 4HGKC 1KPRA 4JRXB 5F1NA 3BE1H 1VADB 4MXVE 2J5LB 3QJFA 5EPMB 1T5WA 3TA3B 1XEDA 1DSFL 1E6OH 3W5MA 5ITFB 2QQNL 2HG5B 3UBXG 1GOFA 5IQ9B 1N6QH 5IVXF 3HE7B 4PJFF 4POYA 3WJJA 3FQTB 4JDZA 3GI8L 2VZ3A 1N59B 4OGYH 4LSRH 1E4XH 5LQBL 5TDPA 1S7TA 4WDIA 1NCWL 4GXUN 2RJMA 3KXFA 3LEXB 3FFCD 1HH6B 3DVFA 3BKCL 4C55A 1BD2E 3FB5B 1YMMD 2B4CH 4F9PA 1QBBA 3LKNA 4TNVF 5HI4C 1RUMH 5FCUL 4OZIF 4MQTB 3HUJB 1MCKA 3RVWC 3GZKA 3E6FB 1B4JL 4UT7L 1S9YA 1FBIL 1SMAA 2G60H 2J3SA 3KDMA 4U2ZA 1T7XA 4LRIC 3DGGB 1QLEL 5JW4N 3F7VA 1D9KA 3DV6A 3ARTA 4YUEL 4F57L 2W0FA 4Y4FB 1P6FA 1ZVSB 5FCSH 1MNUL 2AJXL 2QLVB 3QCVH 1QSFE 3P0YL 1R0AL 2ENSA 3QQ9D 4MNGE 3T3MF 1S7UB 1DVFA 2FB4H 2Q8AH 4Z7NF 1D5MB 2J88L 4XCYB 5DJ6B 1C16A 5JQ6L 1CFTA 2FGWH 4YWGH 1KLUA 2NW3B 3QUZB 5C08A 1H3GA 1PVHA 3F6LA 2YPVL 3BXNA 3EYQC 2VXTH 1UC6A 2GK0B 3QXAB 1PY4A 4JZJB 1Q9WA 1RUPH 5SWZB 2ZJSH 2D9CA 2CSPA 5IJVB 5ITBL 3W9DB 3HE7D 1QKZL 1JPSH 5J6HA 4GBXB 2VL5A 3LCYA 3BT2L 1JNNH 4OLWH 4LVEA 1TJGL 1HHKA 3WLBB 4X7CC 2WINB 3VFUB 1JNJA 1XF5B 3HRPA 4PGZA 4X6DA 3QDJB 3C2AL 3FN0H 3P0VH 5K9OA 1YMHB 5JPMA 4QHNA 4TSAH 3U4EA 1ZXQA 4YXLH 4TRPH 3Q1SH 3QHZL 4QRRA 3BUYA 5E70A 3MXVH 4P3DA 2ED8A 3PHOA 4LL9A 4R4FL 3L6FB 4Y4HB 4X98A 1BJ8A 3Q48A 4FFYL 3ALXA 1OTSD 4Z78B 2CJUH 2G5BB 5SWSA 5GGSA 4H0HB 3LSOA 2D0GA 3ARBD 1C5BH 1V3JA 4OGXH 4TVPD 5ACMA 1IGML 3WLWD 3OQ3B 4WCYL 1N5AA 3S97C 4O2FB 5I1AB 5JTWA 2G5RA 1CXFA 4IM8A 2D03H 1I1YB 4NQDA 4X9FA 1RIUL 4P5KB 3MRRA 5HHNB 4EUPA 2E6JA 1W8OA 4I0PC 4WTWA 1I9JH 4P2QB 1A6AA 1E28A 5DUMH 2ADGA 1MREH 1PG7H 3O2DL 1WBYB 1RIHH 4YIQA 4OCSH 3WFBL 1YJDH 5KS9B 2C4XA 5GS0C 4JFYA 5FB8A 2OTWA 2QHRH 2YPKB 3U7YH 1RJLB 4KKBD 5E2TH 2F54E 3GMRA 4NQEA 1BIIA 5I66B 4NZRH 4IDLA 5FKPB 2SEBA 4J2XA 3GIZH 3MNWB 5A2IH 1FHGA 3GSNH 3NIGF 4MXWH 3ESVF 2DDQL 4GQ9L 5BV7H 4XAWL 3UJIH 4QRPD 3VW3H 5I1GH 3IDUA 4JLRA 4IRJD 4XPTL 3DTXA 1TZIA 5HYJB 2EZ0C 5H8DA 3U9PL 1NFKA 3CDFA 1S7WA 1S3KL 3ZSSA 5C71A 1UXSB 4TUKH 1OSPL 1IM9A 4KROC 3P4LA 2R4RL 1QG3A 5B22A 4ZYKA 5F9AC 1G7IA 3MODL 4Y5YA 1X9QA 2ESVA 3OAZK 5FV2A 3MBXL 4ZFOA 2X9WA 5HHPB 1VB9A 3GJFK 1D5IL 3OJVC 4H8WH 2NZIA 4GW5B 4XPGH 3UTQA 4GAJL 1N5YL 4HIHB 4WIQA 3D85B 2C9AA 3VFGL 1WBXB 1LK3H 2XZQL 4JJ5A 5A2KH 4LSQL 5I0DA 4JY5L 3IJSA 3VD7A 2HFEB 3UJJL 4YHYC 1BJMA 1TZHA 1QVOA 1KG0A 3OXSB 5JNYB 2GCYA 3T08A 2NNAA 3SCMD 1OQXA 3VXOA 2Z31D 2CIIA 3QPQC 1E4XL 2H41A 4X4YA 5K93A 4AQOA 1MFAL 1Q9OA 3WEXA 5EU5A 2FGZA 1SY6H 1P4BH 3RJQB 3G5VB 4U6VH 2BC4B 3OGCB 1K5NA 2A0LC 4JANA 3S3SA 4APQD 4WWKC 4TNWK 4Y16D 2EIBA 1AHWC 3IU4L 4W4NA 3C5JA 2BRRH 1QBLL 4HS3A 3LPWA 4PJHA 1OCWL 5MEOA 3KJ6L 4OJFH 1PKQA 3V5KB 4TYUA 5IW1B 5AD0B 1SEQL 4JFED 3BDYH 1KPVA 3AAZA 3T1FA 2CGRH 4WFEE 4MYWB 2CMRH 4K23L 5F7WC 4YX2H 2M26A 2VDQL 2EYRB 5ADOH 1VERA 1DTUA 3OKNB 4XMKL 4UV4L 3QIUC 5EUOF 3D69B 4X83A 5HGAA 3H8NA 4HIXL 2F58L 3MRGA 4HKXA 1DQML 3LB6D 3WUWB 5BMFH 5T1LB 3O4OB 4JR9L 5DTFB 5D1QA 1IGCL 1DE4B 4YDKL 2DF3A 2JB5L 1U3HB 4QHLB 3MLPA 5FIEA 1P1ZB 1RUPL 2RFXA 1HCVA 3LQZA 3DUUA 4XNZB 4M7ZC 4PJ9B 4FZEL 1XCTB 1ZA3A 4HH9B 1KT2A 2XRAH 3E8UH 1EHLH 4WWKD 1JRHI 5GGRB 3IGAA 3OKLA 4FQQA 1TETH 5K59F 3LKOB 4MB5A 1MJ7H 3ZKXB 2XI9A 4LRNL 1XIWB 4IMKA 5GS0H 1OM3H 1H3UA 2W0LA 2XY1A 2Z31C 2Q87A 3WN5B 3BPLC 4NBYB 3JWDH 5DUPL 1YEHH 4OF0A 5T1KD 4EN3A 3TYGH 2P8LA 4AK1A 1HN1A 3BP6B 5IQ7L 5FO7B 1G7LA 2Y7QA 4WGVB 1WFOA 4EQ3A 4YXHH 1KJVB 4XPBL 4OCLC 5ESAB 1Q72L 2ESVD 2MSPA 4OCWH 4WW2F 5KANG 6FABL 1E6OL 4LP4A 1F6FB 3Q5TA 1QA9B 1U8QA 2PXYA 4XXDB 5I6XB 5F6HI 5KS9F 3OAUH 2P7TA 5CCKL 2VDOH 1UJ3B 4KKBC 5KTEL 3NBNA 2J8UA 3U46A 3G6JB 5C0IA 5K9JL 3KHQA 4LAQH 3C2AH 5I73B 4U1IA 5GRJL 3C87A 1FNFA 3RVWD 4UAOB 3SKOB 5C0EB 2VMFA 3MRBA 5ICZA 2P24A 4J6RH 5D8JL 2PW1A 1N2RA 5TH2B 5CJXC 3QUYC 4V1DE 3PL6D 2R1WA 4KPHL 1OTTD 3KNBB 1NFIB 2YPLE 4NN5B 4X6DF 1YQVL 4HLZG 2X1XR 3MFFA 2BSSB 2DWEA 1F00I 4H0IA 4OM0H 1QFPA 5E2UH 3D0LA 4HT1H 3QEQA 3HG1A 4P46B 4GLRI 4P4RA 4ZQKB 2V5YA 3MV7B 1JGLH 4KUZH 4ZPTA 2B4CC 4YK4C 5ELIA 4P23A 1FJ1B 2RGSA 1A02N 5FXCH 3ZE1E 4BFIA 4KVNH 2QR0B 2GITB 4NKOB 5FO8B 3NTCH 4P5TA 2M2DA 1JPTL 1JUFB 2HLAA 4YFLI 1HOCA 3VXTB 1OAYL 2GSIA 3LKRA 2P8PA 3LRSB 4JB9H 3JV5A 2EH7L 5F7FA 1YY9D 1PFCA 1G6RH 4XVTL 4X9IA 5C3LD 1NSNL 1ZT7A 5I73C 2Z4QA 5CD3B 1IKFH 3SQOH 3ES6B 4YDLC 4MAYD 2HJKA 1NCCH 5HHVL 5GS1B 4NRXA 5T3XD 4CN4A 5FUCE 3O9WB 3P0GB 3MRCB 2JK5B 2I5YH 1JN6A 4PJAF 5DI8A 4H1LA 2XA8L 1MLCB 2QADC 4B5EA 4YBLB 1TJIL 1JNNL 3F6IA 4R3SB 4PRIB 4UU9A 3O3AA 3WXVH 4CVUA 1D7FA 5TDOB 5FEBA 4EZMA 4NUJA 1T4KB 1OT2A 4KDWA 5JOPE 2BJML 3QCVL 1KC5H 4FQHB 3LN5B 4LU5H 2V9QA 2BOCB 3VXRD 4Q9CA 3F58H 4K55A 3I9GH 1T89C 2HN7B 4LIQH 5CGYC 3HZMB 1FGNL 2NR6C 1A47A 4FFYH 1NAMH 2YD5A 2AXGB 4MA1B 4Z0XA 5KVDH 1N8ZB 5E5RB 1G7MB 2ZSVB 1TIUA 3BRDA 4QHMA 2D4FA 1NFDB 3D0VA 3NZ8B 3KPQB 3IRPX 3BHBA 4KMTH 4HXAH 3HE6C 1UWXK 3FFCA 4M6ML 4Y4HD 1MJUL 5FK9B 3QIBD 1LP9A 4DKDC 3EO0B 3T3PE 5EZJA 4G6FB 5DYOB 3D25A 5FM5O 2R1YA 5LXGH 4IJ3C 5T3ZL 1LEIB 1I9EA 1ZV5A 1DBKL 4GH7B 5CUSL 3V6BR 2IQ9L 1IM3B 4WW1A 1IAMA 5HDOA 2BNQB 5GRVL 5GGQH 1P7QB 4DGIL 4CMHC 1MIMH 4M1DL 3O6FA 1OD7A 4KRNA 1H8OA 1AXSA 1YEKH 5EUKB 4Q9QL 3HZKB 4JRYD 2F53E 4X4XA 4XTRD 2O26U 5ERWA 4JFEA 4J3TA 3WIFB 1MRFH 4G9DA 4IIQA 3EYVB 4N9GA 1Q0YL 5CKAA 3IXAA 3PWVA 1UZ6F 1AGDA 5ID1A 3WS3A 4L4TE 5CJOL 2MCPH 3GK8L 2GFBA 3VFTB 2IEPA 4GW4B 4EDWH 3RL1A 1M71A 1ZA6B 5EBGA 5BMFL 2P5WD 4OLZH 1OSZA 2X5PA 3GI8H 2NLJA 1WAAF 4JFXA 5GS1C 2HT3C 4KTEH 3FFDB 4WO4B 3HAEB 3K2UH 5JUEH 3CC5B 2NX5B 3TPUB 3W39A 4BFGA 4Z7VA 2I24N 2B0SL 3H3BC 4FZEH 2PO6A 1MREL 4ZAKC 2NY4C 2XZQH 4M93C 4KZDL 1EHAA 2HJLA 1UXWB 1OP3K 1RZIA 2R0WH 1YPZF 3CFJB 2C1OB 3MRFB 5EUOB 3F7PC 3M8OL 4FFZL 3NFSH 3OKMB 4HIJA 5HI5C 2VLJD 3CSYA 3BKJH 1ZEAH 4G6MH 3DVNA 3OSKA 4EXPX 2OXHA 4GKNA 3T4AA 1RUQL 4LOUD 3FT4A 4JG0L 1CGSL 2XXMB 2YEZA 4I3RL 1UZ8A 2OM5A 1T5XA 1MF2L 2FGWL 1G6VK 3MCKB 5FYKE 4OLXL 4PY8I 5DS8A 1R5IA 2ZUVA 5L2KB 4KAQH 5GSRA 2NXZD 5CGMA 1E4KC 1JWSB 2CLVB 3DX6B 2HKFH 3G6JE 2NY6D 5KVMC 1ZT1A 2BNQE 4WY7H 4HPOL 3BDYL 3KPRB 3VH8B 3TCLB 3DSFH 3KPMB 4NRZB 5IVXA 4QEGA 2N7BA 3QR2A 2Y25A 4R8WH 4J4PD 2DQCH 1P2CA 1QFWH 4ZFFB 5ENWB 1DQDL 5IVNA 3UPAA 5FDWA 4NQUA 43CAB 4Y8DC 5D72L 2B1HH 1ZHKB 2PW2A 4XH2B 2VDKH 3HNVH 2DQTH 3DMMA 3N50A 4I0PD 4QRQB 2QQKL 3MNVB 3E6HA 3PDGA 5FYLD 3EFDL 1PQZA 5C09A 2IH1B 1Q9KB 4MD5A 4RIRA 4U3CA 4HEME 3BW9B 3P4OB 1U8LA 1HHGB 2C4FT 4QTIL 4OZFA 4XHJC 4FQIL 5JXEC 2AXJA 1F4WH 4WV1A 4XVUD 1UH2A 2F8OA 4DGVL 5ALBL 2B1AH 1EZVX 4LK4A 4UDUB 1J5OL 3TJEL 2W9EL 1BHGA 2W9DH 4IHOA 1WCBB 3ULUD 2EDLA 1LO2L 3SGEI 4G43A 3B9KA 2BSTB 2EXWC 4RBPK 2NTFA 2X4SA 5HTSA 3JUYA 3B6SB 4PB0H 2ILLA 2B20A 4PJ7F 4XCFL 2IFFL 1MFCL 3DSFL 4DVBA 3IFPB 3TYGL 1NAKH 3O3BA 3HI5L 3WL9B 3DNKA 2EDBA 3MRNA 1NCUA 5C0RH 5JW5B 3KYOA 2AEPL 1HHIB 1MUJA 1X4YA 2CUMA 4N8PA 1LHZA 3CU1A 4BYHA 4PRIE 3WYRA 3NFNB 4MD0B 5IG7B 7FABL 2DKMA 2VZVA 3H9HA 3SE8H 3D39A 1IVLA 5L0QC 2J8HA 1KIQB 5J3HD 3S6CA 1X5GA 1FYTB 3QDGD 4U1LA 4MNHA 2XWJB 2C26A 2LVEA 5FM4A 1QP1A 2FEEL 3RWCB 2ICWB 3HS0B 1YNLL 4LPVA 4FQXB 4ZS6D 1T2QH 4KK9C 3QUMB 2A1WL 1GC1H 4NQCA 5K59E 1I9IH 5CMAB 1DL7L 3L3JB 2E7BA 3GM0A 4PJ9D 5I18H 2X4TA 5CBAA 5ICYA 4HWEH 5HYJE 2Y07H 4G42B 1NDMB 4OQTA 1U8HB 5LGJA 2RCSL 4NCC1 5BRZB 3WKMH 5IW6B 1K4CA 1NDGA 4UQ2A 2EECA 2ZCHH 4K8RD 1XH3A 2FYYB 2VH5L 5IFJB 1KELH 4KVNL 1D6EB 4R7NA 1QR1B 3QFJD 4XVUC 5E2VH 1HYRC 1A4KA 5ILTH 3VDCA 3I6GB 2OI9C 4BSWA 4JRXE 4MGXA 5DVMA 3MLTB 3RZCA 4PV9B 3PWNB 1FFOA 1ORQB 2FECI 2GTWB 3L3OB 5D7LA 3MBEA 4MSWB 3QZWA 4Y5XA 1Z9MA 1A7BA 1IC4L 4JHZA 3KYNA 1KEGH 4UUJB 1R5WA 3K4AA 1I4FA 4ZG1A 4RAVA 2AV7A 3DX8B 5ITBH 2W65B 1JVKA 1U8OA 3BQUD 2VE6A 4PP1D 4LVHB 1QSEA 4F58H 4L29A 4LQFH 4RAVB 1T2QL 3I75B 4JM2C 1R5WB 3REWA 1BWWA 3T0EA 3BWUC 2I9LB 4HIEB 4EDXB 3UTTE 3ROOA 4P2RE 5LG1A 2Q3ZA 3D6GA 4M7KL 5BJTB 5EORL 4BSJA 5FOBA 4LHUB 4CADA 3ARZA 5DLML 1AC6A 1MLBA 2HYMA 3V6OC 3SCMB 1HNGA 1S5IH 3HAEH 3DV4B 4MHHG 4NCC2 1QR1A 4QY8B 2V6HA 3LOWA 3BFOA 4X80H 3P9WB 3LQAH 3QIWB 1T04A 5IV2B 3EO1A 4ETYA 4OD1H 4UQ2B 1UB5B 1K4CB 1I8IB 3K7UA 5E8OB 3T04D 2ZCLH 2EH7H 4OD3L 5BVJB 5HDBF 1HI6A 4X5XB 1GC1C 3RVUC 2VDRL 3GGWB 3AREB 4JFDD 2HTLC 3QHTC 2UYLB 4HGWA 3ZHLA 4UNVA 3ZT5A 2E9IA 2KBGA 4C83B 1NEZA 2OCFD 5H35A 3GMMA 5EIIB 5FV1L 1HHHA 5IGXL 2EDEA 3HS0A 3CUPB 3UDWA 1SYSB 3RNKA 4NRYA 3K80A 4CMMA 4O58H 2VDPH 2NZ9C 3A67H 2RAMA 3BJ91 1K8IB 2JJUA 1VEMA 4NQCD 2IAMA 3SKNB 1QBAA 1L7IH 3T2NH 2BNRB 3N1PC 3WFZA 5KG9B 1QRNA 1YN7A 4FNLH 1JK8A 1IC5L 1BREA 5MERB 1FORL 3T8XB 3ARFC 3QIBB 1JPFB 5DJZA 1H5BC 5JPNA 1T20A 3S4SB 3STLA 1HHIA 3TLRA 5I16A 5DEFA 3AC0A 4YHPB 3MRNB 1G1YA 3BP7B 1KLGA 3O3BB 2Z92A 3CFBB 1BEYH 5C8JA 1FG9C 3OAUL 3RWGA 4NO5A 4JZNB 5F21B 2ARJB 3JV0A 1B0GA 1W72A 1BQUA 3IDJA 1YUHB 1IC7L 1UJTA 2DI8A 4QRSB 5IB4A 1D5IH 4PJXB 1INDL 3VGDA 5FF6B 4HLZH 3N85L 3E1F1 4XWOC 2XKNA 4A2MA 2AQ1A 1AR1C 4HWZA 3SE3A 3BEWA 4HX1A 4OIIH 1CGXA 1U8LB 4Z7QF 5KSAC 1QFUH 2OTUB 3TA3D 3Q5OA 2J7LA 2EC9U 3GSRB 1JF6A 2FECL 2VABA 1NH6A 1RJYB 3DRTA 3VWJA 1MNUH 1AHWA 3CAFA 4GRWH 4V1DB 4ISVA 5L8KB 3V4VH 4XH2A 1FZKA 1XGRB 1KJ2B 1SYVB 2V2WA 3PF2A 4G6KL 3U7WH 3T0BA 4Y2DA 5DSCB 5ENWA 3NGBC 3VFOA 3OHXB 5EUOE 2J2ZA 1NCDL 1OW0C 5GGTL 5E6IA 1KTLA 1B6DA 3AMLA 3U36A 5INDA 2BVTA 1N6VA 2CLVA 4WNQA 1BLNB 5KOVC 5FKAA 3H9SA 1YEFH 3SO5A 4KGLA 5FYLL 3TEUA 3O3UN 1F3JA 5HI3D 1NCCL 5HHVH 2OMNA 1XGPA 2BSRA 4JY6A 4QNPF 4DAGL 1UZ8B 1I9RL 1MEXH 3TO4A 5C0BD 2I5YL 1P4LB 5KVFL 4XMKH 4O5LH 4NNXB 3SKMA 5I8EA 4WFHE 2Y1VA 3SDCA 3V6FA 3DVNB 1SEBB 4K3EH 1CQKA 4Z0BL 4OZGB 2ADIB 1CDHA 4U7MA 2BVPA 5DEGA 3U2SB 5EZLB 2RCSH 2BK8A 2Z31B 4YLQT 4KZEH 1QQDA 4ZUVA 1R3IH 5MHSD 2XFXA 3ARFD 3FB7A 3L3IB 3MV11 2DQHL 3L3KA 4QYOB 5I1CL 1OGAD 1UCTA 1HIML 4M93B 3FFDA 4POUB 4G7YL 4WO4A 4LLDA 4FG6C 1W8NA 5JHLL 3QO1A 1A0QL 2EE6A 1CXKA 3MLSL 3RA7H 3RIAK 5LGHH 4RA0C 3IDXL 3CIQA 3VFPB 4ZD3H 3KPOA 5D1XA 5JR1L 1NLBH 3WJLA 3AB0C 5GS2D 4HULB 3WIFA 3QI9C 3C5ZA 3SPVA 5ERWB 1GIGL 4LLMB 2B1HL 1KIRB 4Z77B 1KB9K 1T83C 2VLLA 2R0LL 1FBIH 2G60L 4GRWF 1DLHB 3OXRB 4I8DA 4K3DL 4XNUL 1MCHA 3DO3A 5K9JH 5HYQB 2N56A 1IM3A 1DUYB 4L3EB 2XICA 4C4KO 4PGCA 5HJ3B 3QB7C 4F37F 1NC4A 4BZYA 5D96C 5FHBL 4AIXA 5IIEB 4ONOA 1X6NA 5EU4A 3BPNC 1CYGA 1CDJA 1D5XB 2DQJL 1W0WA 1OW0A 2AKRA 3DRQB 2UWEA 3I6LD 4KTDH 3AS2A 1QNZH 2IPTL 3QFJE 4JY6B 2EEDA 1L4IA 1F3JB 5BO1H 3HPJA 5B8CB 2ZSVA 1OY3B 3PHSA 5A2JH 1LK2A 4PYHA 4OI9A 5LGHL 2P4AB 3MJ9A 1JHLL 3LMJH 1MVFA 1FZMB 4OFYA 3HZMA 2EH8H 4YJZL 4X8XA 5SX4H 5B38G 2PTVA 2HVKB 4D2NA 1FFPB 1T7VA 1BAFL 2A83B 2XOTA 2H2PD 1X5IA 3QCUL 2YMXH 3B2UD 1M1SA 4JPWH 4WO4D 4M8QB 2E6QA 1F6AB 3DMMD 3NN8A 1T4KA 1OLLA 2X10A 4Y16B 3MYZA 5KN5A 1XZ0A 3R0NA 2QHLA 1L7TL 3RDTD 4POZD 1S9WB 1UACL 3F7YA 1KYOJ 5I1KH 3ILQC 4YZFE 3HFMH 3B43A 5HSFA 4R3SA 1NCNA 3ZKSD 1IGFL 5F6IB 1UWEH 3RL2B 2VLRA 1JN6B 5INCB 3S4SG 4HX1B 4RAUA 2H2SC 4YHML 5JLZA 1OAYH 4E41A 4D9LH 4Q6IB 4MMZC 1BEYL 2FJGA 4PJXA 3ES6A 2Z4QB 4M8VA 5TE4L 1UB6A 5IFAH 4WCYH 2CUHA 4X99B 5KSUA 4DKFH 4LMQE 2BY1A 3MOAL 3RFZC 3NCCB 4RMVA 2X7LB 1SVZA 1KLGB 1CF8H 3N1MC 1CK0L 1HOCB 2JTDA 5MI0B 4HQQL 1H9VA 1G7PB 3U1SH 2G9HB 4DOHE 2PR4H 1SJHA 3QIUB 4YPGA 1I7RB 3G6AB 3TP4A 5IF0B 1BQLL 4JFFB 4ODUB 5BVPL 4ZQKA 4O4YL 1KCKA 3MOBH 1BZ9A 4TQEH 1U93B 1TVBB 1IRAY 2DWEB 1HWHB 5I8OL 1BVLA 1CL7L 4GAFB 4XAWH 2AK1L 4ZFZB 2K1MA 4GRWB 5I8CB 4ZAKD 4YH6A 2PW1B 5EOTB 4K3EL 4WHTA 3ZO0A 1NGXB 5GGTH 3BP5A 3MREA 2W9EH 3H42H 4JO1H 5I17A 3BGMB 1XGQB 3G6JA 4L4VD 1OP5K 5MP6H 5MENE 1RPQA 2YN5A 3Q0HA 4H5SA 4P2RA 1DEDA 4M61A 3ABZA 3VXMD 1UB5A 3EO1B 5JXED 1U8QB 3UTZB 2H26A 3C6SA 3HE6D 4ODSH 5E08H 3NTCL 5ESAA 3SCMA 4M00A 4NO2B 2W07A 2ORBL 2P5WE 3F7RA 4LHUA 4UNUA 2YWYA 2E7HA 4RGNE 2PXYD 3CVHA 2VSDA 4HJ0D 2AJSL 4EDWL 3ROOB 1MJ8L 2F9BT 2YHGA 3WN5A 1XGTB 1BQLH 5IKCA 2I9LA 1PKOA 4ZUUB 5CJQL 3NA4A 1L0XA 1MIML 3LIZH 5DD1L 4J3XA 1OHQA 4G5ZL 4UTAH 1W0VB 4RGMC 3LN9A 4LSSL 3QWRA 5T1KA 5IJKC 3LKPA 1AKJA 3LKOA 1NGYB 4WJ5B 1INQB 4NUGH 1MCLA 3FTGA 2LVCA 1GGBL 4WJ5A 4HUUA 3LKPB 5HYSG 3CDYA 1P1ZA 1W0VA 1U3HA 4YPJA 5CJOH 5ETUB 2WBJD 4KRPC 2A9MH 4Y5XB 1LEKB 1CWVA 2XN9D 5EA0H 3RBSA 1PSKL 1M6OB 4ZXBA 5E4EB 3IS0X 3IDXH 3CPLA 4JKMA 4BSWB 5L88L 3OR6B 4L4TA 1ADQA 3ARDD 3OKNA 1F13A 3HC4L 5AG8A 4YX2L 4KV5E 4R4FH 2A6KA 4Y4KD 4U1MA 2H26B 3LDBC 4NM8L 3HI6H 3IFLH 1NDGB 4OLWL 5IW6A 4WFFD 1YY9C 1LO3L 3T0EE 4IRSD 1VFMA 3V5KA 2XTJE 2NCMA 4IOFD 5CBAB 2C4FU 1F97A 2MQCA 3VWKD 2RIKA 3EOTL 3I6KA 1FSKC 1B2WH 2ICES 2V17H 2DD8H 3LH2L 3DO7A 4NUGL 1MEXL 5JHDE 3U0WH 2K7PA 5KOMC 3VFNB 3OGCA 3E3QE 5T5NG 3I2CH 4WW2C 1QNZL 4OZ4B 3DIFA 1FYTA 4U1LB 3B83A 3F65A 2CIIB 1RZKL 3RIAF 1JFQH 4FFWC 2VXQL 1Z3GL 3VXMA 1OTTC 1YMMB 4XZUB 3V4UL 1ODAA 1LE5B 1I7RA 5EA0L 1V5JA 2NNAB 4OIBA 2DTMH 4NKIL 4PRPE 1SJHB 3N9GL 2G9HA 1MUJB 4Q9QH 5F70A 3X17A 3GRWA 1G7PA 2IQAB 3C6SB 5IESL 4ZXBC 3ZL4H 1DQDH 2ZCKH 3O6FC 1KENL 1UKQA 4R4BA 4X0KB 5EZIH 2YMXL 4JPWL 1MWAA 1NCDH 4NC1C 4KQ4H 2QQKH 3UYPA 2NXYB 4R2GC 2AJYH 3UTSE 3CD4A 1N0XL 4ONGL 4UDUA 4FXLA 1WGOA 5EOTA 4KUCF 2CRYA 3K4DA 5CIPA 3RGHA 2GTZA 2E9WA 5I8CA 2F8XC 3C08L 4ZFZA 4J3SA 4RBPH 2VLRB 3WS6A 2X70A 4KJPC 2VC2H 4XGZB 1TVBA 1TQBC 1RULL 2IC2A 3WNMA 2BXZA 4K7PL 3SN6N 2BHUA 3JV4A 5KJRL 4ODUA 4G8GD 5C2BL 5I66A 4Q0XH 3GMRB 3VFWB 1EO5A 1RJLA 4D0DB 3NN8B 4WHCA 2CR3A 1MHEA 4M8QA 4I77H 3O6FD 1OAXL 1ZHKA 4XNYH 4OFVA 43CAA 5C0DA 3ZTJH 2BNUB 2DQJH 2X7LA 4I9WD 1A6AB 1FFPA 5JIHA 4H25B 4EUPB 1HSAB 3WDJA 1RURH 4JHBA 4BH8A 4P9MH 1JYXA 2ATKA 2DS4A 4KQ4L 1UB6B 5I1HL 4I13B 1N5AB 2J1KA 2GHWB 4FXGB 5I1AA 4R96B 3K4ZA 4EIGB 3HB3C 1TQCC 3L1OL 5DS8B 3WKML 3MJ8A 3GSQA 12E8H 4FQ1L 3A6OA 1S78C 4RAUB 5HPOA 1RMFL 5EWIL 4ZSOE 5IWLA 3OJMB 5T5FL 4PUBL 5EIVA 5EU4B 1RUAL 3T4AB 3KWWB 1FNLA 3SDAC 4PD4K 3F7YB 1PAMA 1BJ1J 1DUYA 2KPNA 5J12B 3WMSA 3CSYB 2X4NA 1KFAL 1NMAL 1XZ0B 2W0KA 5CP7A 5B39B 4Y89A 5F96L 1MI5D 4L9DA 3MV8D 3ZDZF 4Q9BA 1IGYB 1CDGA 2C1OA 4JO4H 3B9AA 3BIAX 1CGWA 4XAKD 5HYEA 4BK5A 2NY0D 1MCPH 5HHQB 1P84K 1XF3A 5I8KL 3H3PH 4UV4H 3NIFE 3KPOB 5D1XB 1KEMH 3W39B 5BZWA 4ZFGH 4AEIH 1FC1A 4UZGA 4MB4A 3TJEH 3QAZC 5MEQA 2PF6A 3MV9B 1ZKAA 4UTBL 3BXNB 1ZA6A 1M71B 1JZ5A 2KDGA 3QUZA 5DUPH 5C08B 2NW3A 4M6OH 3QP3A 5DD1H 4XNQA 4NM4H 3WHE1 4LHQB 3PQYE 9CGTA 5BZWB 1CFTB 1NCWH 3L3IA 1T66D 3ZKQD 1MH5B 5CP3H 5J1TC 2XFXB 3FB7B 5CJBA 4I0CC 1D5XA 3VFGH 1DVFB 3EYVA 1XF3B 5HHQA 2Z31A 3OAYH 3DXAA 4IRZH 3U1SL 5FCUH 2C7UA 3BQUA 3CFIC 1X5XA 3O6FB 2XQYK 4E41D 5GSVB 1VENA 5DRWA 1P7QA 3IFOA 3STZA 3IFOB 3STZB 1QLEH 2BNQA 5GSVA 3D3VD 2UZYB 35C8H 2JCCE 4X4ME 2WBJC 4KRPD 4MXQD 4LSVL 5CP7B 3MRMA 2C7UB 5F7LB 1ONQA 3FMGL 3S9DB 1DBJL 3SDCB 5TF1L 1MFNA 4LPTA 3SPVB 3SKMB 1P4LA 3LKNB 3BGAA 2VXUH 1VKXB 4KKLD 1LP9B 2WBJA 5DA0B 2J88H 3K74B 2OXGA 3MJ8B 2ZCLL 2ADFH 4WI4A 5ALCH 1FE8L 4QHMB 2OZ4H 1OAQL 4YBLC 3O9WD 5F7UA 3V0WL 2IADA 3OPZL 5C3TA 3X3GL 5FKAB 4JDZB 1IC1A 4Z7WF 4WUUE 3V4UH 2P47B 3U36B 5CZVL 4XCFH 5EOQL 1G9MC 3WXWH 1HSAA 1B2WL 3VXNB 4DJMA 2R4SH 3NABH 3WFCH 1T5WB 3TA3A 5DSCA 1NUNB 3Q3GA 3MRJA 3VD3A 3O2VH 2V2WB 5C0DB 4YGVA 1XGRA 3V52L 1NC2A 3TO2B 4I48B 3MCLL 3G9VA 3AM8C 2OK0H 5C0CA 4FP8L 2ADIA 4BZ2H 5TDOA 2YS4A 1WZLA 3MOBL 3L3DA 5GHWH 4CVXA 3AS3A 1QACA 4LSRL 4UU9B 5LQBH 2A74A 3LAFA 2VYRE 5I8EB 4HUNB 3L7EB 4JO2H 1MOEA 4XGZA 1K4DB 4ZTPH 3SJVE 7CGTA 2WBWB 4ZUWB 3QIBC 4X7FC 5DK3A 4OZIE 1CGSH 2BSRB 2EZ0D 2XKNB 5CIPB 3GSQB 5D2LE 3VRLF 3RP1A 1WV7T 4JN2B 5DMIL 2DKUA 4L5FL 5CD3A 1ERNA 3IDYB 3SGEH 4KK5C 4RCAA 1E6JH 3VGGA 3T65B 1B0GB 1W72B 5E6IB 3ULVE 5KS9E 1MWAB 3LKRB 2HH0L 2GSIB 3JWOL 2AXHA 3VFOB 3D2UD 4GSDH 2HLAB 3DURA 3FB6A 4H1LG 1YJDC 5L2KE 5GGRY 1SYVA 3UXFA 1ND0A 2DQEL 4OIIL 5I16B 1CD9B 1MHEB 3V6OA 4Z7OE 5JPNB 4V1DA 3C6LA 2UVFA 4D0DA 3DRTB 1LE5A 4XZUA 3T8XA 3D85D 3UDWC 5FYKU 2VABB 3SBWA 3JV4B 4NWUL 3QEQB 1A5FH 2NPLX 3SDCC 1T2JA 2VZSA 5A1AA 3VXQA 5C0ND 2UVEA 4OZ4A 1NCTA 4D9QD 3BEWB 2W9LA 1N2RB 5TH2A 3G5XA 4PP1C 5DQDH 2P24B 3IJHA 3CUPA 5C0EA 3O2DA 1KCUL 3ESUF 4OM1H 1FH5L 4X7DC 5IB4B 4KDTC 1NAML 4RRPA 1JJUA 3Q5YA 3BIKB 1KXTB 5F96H 4POZC 5DFVC 2ARJA 4IOFC 4NO5B 1YNKH 2FX8H 1HI6B 4X5XA 4PJ8B 4WEBH 3JTTA 1PZ5A 5E8OA 2JJWA 4W70A 2WIMA 4LKCB 3S88L 2E3VA 1UYWH 3LEYH 4U1MB 1YYLL 4QXGL 5DEFB 5I76A 1KJ2L 5D2NC 4NT6B 3S96A 1JNHA 3V6OE 1WFNA 5D1ZD 4PPTA 3OR6A 4L4TB 4ODHH 3Q6GL 1JPFA 2HT2C 1I8LC 4K8RC 4LARL 1DBAH 3X14A 1YPZE 3UROR 1LDPH 1SQ2N 2DBLH 7FABH 1A6WL 2DM3A 5KSAA 5ETUA 2O5XH 2AEQL 1IC7H 3DIFB 3MMEA 2XTLA 2IAMB 3SKNA 4Y5XC 1RUKH 1ORSA 3QULB 2ZJSL 4BUHA 2O5ZH 4FQQB 4KK9D 3P0YH 2WLYA 4NRYB 3DO7B 2HRPL 3RNKB 5IEHB 1SYSA 1U8OB 3U0TA 2A9NH 3F62A 1NEZB 1FVDA 1YJDL 3LQZB 4KV5F 2BY3A 4DN3H 4JDTH 5D93C 4HGWB 1ITCA 3ULUF 1NMBL 4NHCH 4ZUUA 2PYEE 1DL7H 2OL3L 3RA7L 2H2SD 5GZOC 1FFOB 1Q38A 4PV9A 5DRXA 4DGYL 3RU8H 3LQMA 5ESVB 4I77L 1M05B 3Q1SL 1JL8A 3QHZH 3MV9D 4MMXC 3L5IA 4GKOA 5I9QC 3ZL4L 1H5BA 1M7IB 3UTZA 4NBZB 4XP4L 3O4LD 1QHOA 3T1FB 5DRXB 4M61B 1KPVB 3AAZB 4KXZH 1V7NL 4H5SB 2FLBT 3RGVC 4PJEF 5ICYB 2X4TB 5DFVD 5IR1A 4YE4H 3EZJB 3REWB 4LQ1A 4WY7L 4NQCB 3ZE0F 1NGXA 4HUUB 1NMCC 5B4MD 1X6LA 2EH8L 4P59H 5D5MF 5IEHA 1RIVH 1KV3A 1AQKH 5HVHB 2W65A 1INQA 3AROA 5E7BA 1XIWC 3DX8A 3G5VA 4X6FB 1FRGL 5EU5B 4LRIA 2A9NL 3MMEB 5EG6C 5L8LB 3KS0H 5TPWL 5C0NC 5KSAB 1U93A 1WBZA 3HA0A 4LMQI 4X4YB 4WHYH 4HC1H 1IQWL 3QZWB 4Z0BH 2R29L 3OB0H 1ORQA 2GTWA 3UTPD 4U7KA 4JFFA 3PWNA 2VDNH 4X6CF 2WANA 1E4JA 3G6AA 2VUYA 3RZCB 1JZ6A 4U0QB 2XG4A 4TVPH 4QOKE 3S36L 2ED9A 1ED3B 3MRDB 4J12A 4NO2A 3V0AC 3P11H 1A4KB 4NT6A 3S96B 3RX5A 2HFEA 1FP5A 1CBVL 2D0FA 1XH3B 2FYYA 2HA1A 4EJ1C 1AP2B 3M17A 1PZ5B 5BS0A 4P2RB 1U8HA 3B6SA 1N4XL 4I3SL 4WU5B 5TDNB 2YD4A 4JFHE 5LBSL 4X99A 5KSUB 3BGMA 5CMAA 1L0YA 2ESVB 5F7EL 4WHTB 3QUMA 2FJGB 2CUIA 4GO6B 1NLDL 3H7LA 3IJHB 4QCIB 2PTUA 3GBNL 3THML 2WV3A 3G5XB 5DJDB 4MB3A 5JLZB 1CFBA 5JZ7C 1S7WB 1CU4L 2XWJA 4O5LL 3SQBA 2AEPH 1TITA 3JBG7 1D5ZB 4XBPB 1KPUB 1QRND 4DGVH 1F3DJ 1DQLL 1BZ9B 1J1PL 1LMKA 4DUWA 2O5YH 3NFNA 4LCIL 5E56A 5IG7A 5IF0A 1JNLL 4NQEB 5D70H 1CIUA 1MRCL 5KN5B 1JGLL 4QRQA 4LSVH 1F6AA 3W0WA 2FO1A 2BVEA 2MKWA 4N5EC 1ND0B 1OARL 3KYOB 1C1EL 2LAGB 4TRPL 4YIQB 3DURB 1FPTL 1P2CB 2HVKA 1HYSC 5D7LD 1QEWB 2EC8A 4PJ8D 4L4VE 4KJQC 4AEIL 2X4SB 3VH8A 3O0RH 2GJZB 1ZT1B 4D3CL 3T65A 1FE8H 5T3ZD 1LK2B 1A0QH 1QPPA 5L2KA 4EI5D 1EPFA 4M6OL 4PD4J 4Y4FC 3HPJB 1PY9A 1J1OL 3HN3A 2PYFB 5JR1H 1J1XL 3FHQA 2UWEB 5INCA 2YEZB 4WV1B 1WEJH 3PHOB 5DK2A 5J0BA 3L7EA 2OTPA 3IFNL 3QRGH 3T0ED 1TXKA 1MCRA 5TQ2H 4CVXB 1S9WA 4F8QA 5BV7B 5C09B 1YMHA 3L3DB 2D7OA 4L3EA 5JPMB 1J1PH 3OB8A 3RZWA 1G9MH 1GAFH 4HIJB 3QDMD 3U4BL 4MJIE 1JGVL 1A7RH 1YNKL 2FX8L 3O45B 3WLBA 3CFJA 2XZZA 4CN1A 4YHOL 4JEGB 1AC0A 2MOVA 3MRJB 1S5HB 3Q3GB 4LSPH 5ACLA 3PV6B 3RGVA 4A6YB 4M4PA 5E6ID 5A3ID 2X4UA 3N0PB 2NZ9D 3VXNA 5DFTA 5CKGA 5J12C 5JOEA 2PO6B 4JN1L 1TPXB 5F9JA 1EEQA 3QXAA 3HAEA 2R4RH 2YD1A 2IADB 2W9DL 3QO1B 4YEFA 1I1AC 4HT1L 4PJ5E 1XGYL 2LE9A 3KR3L 4GW4A 3WO3B 1PSKH 1T5XB 4U05A 1C16B 3O4OC 1Z2KA 1MFCH 2WBJB 2V5MA 1V3MA 2ZUSA 1VKXA 2DB8A 1QQDB 2WW8A 4G9DB 5JQHC 3M45A 3ZE2F 2HFGH 3NCMA 1B9ZA 5IIEA 2A77H 1V8HA 4DQOH 1EH9A 5HJ3A 3HZKA 4Y2OA 4LNVA 3MRMB 4XMPH 5DEGB 2R1XB 3U2SA 2D3VA 3ZHDA 2NY5C 4Q6IC 2IQ9H 3B9EA 2R9HD 4UB0L 1GAFL 4JQVA 3F7VB 1E0OB 3BYTA 3NIDE 4NFDA 5DDHB 4AYFA 3V6FB 4KVCL 4KDTA 4P59L 3A0OA 3BPLB 3C5ZB 4WI5A 5EZJB 5BRZE 3P40A 3EO0A 4Z7VB 1MH5A 5DQDL 4OFKA 2DLHA 3CC5A 3LEXA 1RZJL 4HAGA 4XNQB 5TPWH 3KPQA 4WDIB 5GXBB 3D0VB 3NZ8A 4LNRA 2VNCA 3QEQE 3NOIA 3HNTL 4N1CA 2EDYA 3RL1B 3MV9A 5F7KC 4KKAC 1BLNA 3CSBA 2VRAA 3P30L 3TF7C 4QYOA 5F9JB 5F97E 1AJ7H 2D0HA 4OGZA 3VGBA 2HN7A 4IIQB 4N9GB 4TULH 1KELL 4JFEB 2HP4A 2RQ8A 3LH2H 4LU5L 3RGVB 4A6YA 4ODSL 1QKZH 1MCJA 3ZTNH 1S5HA 3QJFB 2DQEH 1KJ2A 1EFXA 1XFPA 1FZKB 3LY6A 1IGYA 3BMVA 2BVPB 3OKYA 5AZEL 3TH2T 5E2UL 5B39A 3FHAA 4UB0H 4OZGA 1MFEH 4K2UH 4NQDD 2Y5TA 5J89A 1SEBA 2EC9T 5KSAD 3GJFB 4NNXA 4OZFH 1V3LA 1SHMA 5DMJB 3GSOA 5CHNB 1WSST 3IRZA 3PG2A 3O9WA 4JFFD 4KQ3H 1NGQH 1GGTA 1OP3H 4NRXB 1HXYA 5GS1A 1S7QB 4ODWA 1KTKE 4MA8H 4QHKJ 3H9SB 1CTOA 4FXGA 4QRSA 2OZ4L 2VLKE 5LBSH 3NCJH 4Z0XB 1BJ1H 1YEJL 1KTLB 4PJAE 2AXGA 4R2GD 4BH8B 5E03A 4ZUTB 3W0WE 4DGIH 3RVXC 1HYSD 4H25A 1NLDH 4F7CA 3CFBA 2Z92B 5EOQH 3WXWL 1F4HA 4CNIB 4Z76B 3VXTA 1UENA 4Y2DB 2BNUA 1S5IL 5IK3B 3O2DH 5GZND 1NC2D 3S4SA 4QTHA 1AHWB 1FJ1A 1A7NH 3O2WH 1LO0L 4OD3H 1NCAL 3QIBA 4NUJB 3EDJA 3SKJH 4G9FB 5T33H 3PXJA 2YPVH 4PRIA 1O7SA 4K2UL 1B6UA 1D5ZA 2YRPA 2ZUQC 4XBPA 2BNRA 3MFFB 1X3DA 4H1LB 5DHVH 3KNBA 1A6VH 2AW2A 1U2CA 4QTIH 4MZ2A 1RIVL 4NN7B 4XP9H 3VWJC 2VDPL 1F2QA 2JJSC 3O8XC 4NJ9H 2EKJA 3SKOA 5IBLD 3GMMB 5EIIA 5H35B 2V5SA 1YUHA 1J5OH 1EHNA 1N6QL 1DBKH 2WBKA 3IDJB 1BIHA 1J18A 5C0IB 2OJZL 3MODH 4JRYE 4JZNA 4WU5A 2VXVH 4HUKB 2P8PB 1DBBH 1EK3A 3A6BL 5KVGH 4R4BB 4X0KA 2HKHL 4DCQB 4CL7A 1T04B 4DTGL 5DD5L 1JUFA 4E9LA 4QY8A 5CSBA 4LOUC 3WD5L 2IQAA 1TQCB 1HSBB 1RFDL 1KJVA 2DL9A 2QR0A 4PUBH 2Y7QB 3MRDA 5B3JE 4X9HA 1KENH 5FOBB 3VXSB 1YMMA 2ZNXA 4OKDA 4ZPTB 4M6AA 5MERA 2FBJH 1DQTA 4MNGB 4FQCL 1JK8B 1S9VB 2EIZB 1FVEA 1YN7B 2NXZC 1GPOH 3L5XL 4CN6A 1NFIA 3FKUS 3T0XA 4L29B 1QSEB 5GGRA 1P4BL 4CMHB 3EHBD 3DECA 1Z6JT 1P69B 5ICZB 1I9JL 4S1QH 5DUML 3BQUC 4E41E 4KZDH 5DZNA 3KLAB 5I8KH 2DBJA 3ARGD 1TFHA 4C83A 3ZDXF 3D3VE 2UY6A 1AI1L 2A1WH 1FYTE 3ZZ1A 2UYLA 3SOBL 1DE4A 4JE4B 3U46B 4Y2DD 2RB8A 2Q1EA 5DTFA 5F1SA 3U82B 1OCWH 3MLWL 2IMNA 2P7TB 3KR3H 1Z0MA 4FTVD 1I8IA 3MRGB 4HKXB 3BSZH 1DBBL 3GIZL 3QIWA 5IV2A 5FGCB 5HGAB 4GRWE 4R4NC 1G9NL 2B0SH 2NY2B 4NZJA 3VG9B 4IRJC 1DFBH 4RMUA 5F1OB 3TZVA 4NFCA 5FO7A 4R7NB 2P8LB 3B8YA 5ESVA 5IROC 3CPLB 1MELA 4XNXH 1FNAA 1M6OA 4ZXBB 5I1IL 4NN5C 4PS4H 3HC3L 5HD8C 4XMLL 3MV7D 1S78D 5EDXA 4YDIL 4WVRA 5MEOB 3BZFA 3QO0B 3I75A 1P84J 4DOHB 5LKNA 5GGVH 4QRTB 3KPTA 1FVDB 5FECA 3U0TB 4TSAL 1ZE3C 2ZPKH 4ELME 3B4NA 2ICWA 4WRLA 1CU4H 3EHBC 4KUCD 4PJ9A 1BFSA 1NGYA 2AV7B 3V7MA 1JIBA 1KXVC 1HK6A 5T1KB 3IFNH 4ZOBA 3GIVA 1MCSA 5E8DH 1L6ZA 3KYNB 1KIQA 4OLXH 3WV0A 4LEXL 4MLSA 5IKCB 4MSWA 1XGTA 4MAUL 3WUWA 3MBEB 3IAPA 2CXGA 3H9HB 3VXOB 1UACH 4M9PA 3JWDL 3DX7B 5JNYA 3ZE1F 4AM0A 3I6GA 4M7KH 2W91A 4JGJA 2YZ8A 4G6AD 3VA2C 5I76B 1RHHA 2AERT 3MLZL 1R24B 2QV2A 2ZUQB 3O6LL 3FZUC 3UYOD 3L7FA 1Q0YH 3D85A 4DVBB 4G8IB 3JTTB 4G42A 4P9ML 3AXLB 2VDOL 4I18C 3PWUB 5DFWH 1B3JA 3B9KB 3OG6B 4OT1H 3ZTJG 2VDRH 5AZ2H 5IT2L 4Z8FL 3BP5B 1WCBA 3MREB 1FNSL 1MIEL 3MOAH 4KHTL 4FQXA 3VXRE 4NQED 2Y23A 5T1DH 2DD8L 5CLWA 4JANB 4M43H 2X89A 2QSTA 2FL5A 2YD7A 4MNHB 1BVLB 4OZFB 3VXQB 1INEL 1OSPH 1T1XA 2DM7A 1JZ8A 5F9DC 3MNWA 1IJ9A 4XPHH 5FKPA 4MD0A 2UUDK 5F9OH 5FHAH 4KDVA 4RGNC 1GJIA 1U95A 3PL6C 5FB8B 3C6LB 2NY2C 2J12B 2P43B 5KS9A 2PW2B 3TBVB 4NIKB 1EZVY 3MLVL 3WL9A 3MXVL 1L9NA 3IFPA 1FO0H 4HIHA 1I3UA 1VHPA 3LHPH 3FRPG 1AFVL 4OCMC 4NO0D 1I1YA 5ADPH 3RBGA 5J56B 1JWSA 3OPZH 4O2FA 5C86A 2HWZL 3BGFB 5GSRB 3B5GA 2R9HC 3AFLA 4U0RB 4NWTH 4Q6IA 4JN2A 4KI5D 1R5IB 4E41B 2E27H 3MCKA 4N0FB 3CSGA 1P6AB 1BD2B 3WDHA 2JKXA 4EEEA 1IMHC 1RZFH 3CX2A 3RVTD 5H37H 4U6VL 4ZNEE 4ZUWA 1RFDH 1K4DA 1HHGA 4Y4KC 4QRRB 2GW5A 4GKNB 2A6IB 3BW9A 4K94C 5ESQB 3CVIL 3U4EB 1Q9KA 1MCEA 5TF0A 4GG6F 2VQUA 3LDBB 3CH8A 4PJIF 2KUTA 1U8PA 3NCBB 4Y16A 2OTWB 3MNVA 4Z95L 2J4WH 5D1ZC 4MCYA 2WINA 4I48A 3PWPB 4U1SB 1DDHB 1NC2B 2VLRE 1HZHH 3ETBF 4MCZB 3MLYH 1CVSC 5E94B 1U3HC 1WBYA 5IB2A 2A83A 4GBXD 4PJXF 2ADGB 4FQIH 1IQDB 5HI4D 1N7MH 3MRRB 4NRZA 5KW9H 1FZMA 3KPRA 4PJFE 4TSCH 5ALBH 1KTRL 2VLJE 4JKKA 4WI2A 5I15H 3MRKA 2D7TH 3MFGB 2CLRA 2IANE 4PRHD 5B8CA 3MV9E 1SJVA 3QPQD 4U3HA 5L9DH 1H3WM 4YQXH 4EBQH 3WN5C 3V5DB 4XT1C 5ID1B 3OAZH 1GSMA 1OQOA 4P2CG 4HXAL 4XCYA 5DJ6A 1D5MA 1TNNA 2OS7A 2AKRB 3DRQA 1N5YH 4N90E 1W0WB 2ESVE 1I9RH 2MKLC 1MHPL 3RDTB 4YXKL 1EHLL 2MWCA 4RDQF 3SDCD 1NC4B 4HQQH 4QHNB 3H9SE 4PGCB 3VWKC 5K9OB 1ONQB 1W0YT 2FX7H 5TFSH 5CCKH 4FS0A 1A7NL 3OWEA 1IM9D 5HYQA 3OKMA 1ZVSA 1YZZA 3QEUA 2P5ED 3JVGC 1II4E 4H8WC 4Y4FA 1ZLWH 5DRWB 3MRFA 5EUOA 3MA9H 2VLLB 4WW1B 3NCFB 3BQUB 2GKIA 3TYFB 1S9YB 5TE6H 4JDVB 1KIRA 1MAMH 2HJLB 3QUMH 3DXAB 4JO4L 5J6HB 5I8OH 1J10A 4UOJA 4FQJL 3HE7C 3OKOA 1VFBB 4U6YA 4XP9L 3RWIA 4WFED 4XP4H 4JZJA 4OCXL 3FFCB 3KXFB 3BHBB 4OD1L 4S1DD 3GRWH 5DD6A 1GRWA 4PS4L 4MHHI 2Q86B 1GYAA 1N59A 3RZCD 2YD2A 5C7XL 5MEQB 25C8H 2I25N 4OLZL 3VFTA 3C5ZC 1XGYH 5DC9B 1CDBA 4PJAA 3L3KB 4AG4H 1MFBH 3ZDYF 1HE7A 3IXAB 2HG5A 3B5TA 4GSDL 5A3IC 5I71B 1IGIH 1JPTH 2X4RB 1MPAL 2BOCA 3GKZA 4GT7A 5EUKA 3INUL 4OFDA 2IGFH 3EJYD 1L7IL 5D2NE 3QDJD 3T2NL 3MV01 1VESA 4XMPL 2QADB 1EVTC 3RWJB 2R0LH 2X4NB 3KDMB 1LEIA 4IIQC 1K3ZA 3BISA 3KWWA 5DYOA 1MAML 1E27A 1A7PL 4FTVE 1MFDH 2J6EL 5DI8B 1KCSH 2YZ1A 3C08H 5FUZL 3MRCA 1KSRA 2GK2A 3ARBA 1GH7A 1IZKA 1NFDA 4XWOD 4G6AC 4ELMB 1FV1B 3O6MH 3FQNA 1MF2H 4J3UA 3T0AA 3ZDYE 1MCFA 4R96A 3SKUD 3ARDA 2F54A 4WNQB 1U6AL 2R0KL 4M5YL 2AJYL 3D87B 4KMQA 5INDB 5D2LF 2BVUA 1NSNH 2ATKB 2DI9A 4OQTH 2UY7A 3PP4H 2ZKHL 4LKXB 5MEPA 2CDGA 1EAPB 4PJ8C 2AAVA 3OHXA 2WMPA 4CDHA 3J7HA 4LSTL 1VADA 2AEIT 4P5TB 4FQHA 5FO8A 4JRXA 3ILPB 5CILL 1MRFL 3BKYL 4RFOH 1AFVH 4XNXL 2Y06L 1TJIH 1FL6B 2YA1A 1MRDL 4P57A 3VWJB 4P23B 5DJAB 4EN3C 4U3XA 3VFWA 1RJYA 3EYSH 4ZNEA 5IFHL 3O41A 5JA9A 5L8JB 2GQHA 2M1KA 5D7IF 3BRGC 1T6WA 1BPVA 2X70B 3IU3B 4D0BB 4LBEB 3K8MA 1IGFH 4CU8A 4RWYL 4HHAB 1NLBL 4QOKB 1NKRA 2GTZB 4B7IA 5HHOD 3QRGL 2AEWA 2B8OT 3MRBB 4YHMH 2IWGA 5FF6A 5FYJL 3D1MC 4MAYB 1FC2D 1OAUL 1CIDA 1BBJB 3QIWC 3B8SA 4U1IB 3QJHA 3VI4F 4QXTB 4JPKL 1KFAH 1NMAH 4IJ3B 3WBDA 4YHNB 3V8CA 4XWGH 1EX0A 4FFZH 3O8XD 3RWGB 3LRSA 3JZ7A 3GHEL 2JIXD 1JRHL 1CFQB 2E27L 1A1NA 4ORZC 2PXYB 1AGCB