1SY6H

Crystal structure of cd3gammaepsilon heterodimer in complex with okt3 fab fragment
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
219
Chain Sequence
b'QVQLQQSGAELARPGASVKMSCKASGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSAKTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OKT3 Fab light chain
publication title Crystal structure of the human T cell receptor CD3(epsilon)(gamma) heterodimer complexed to the therapeutic mAb OKT3.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/antibiotic
total genus 45
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2004-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1sy6H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1sy6H02
3HLAB 3BD4A 3B2VL 1J0YA 1YC7A 4LSVH 4WO4A 3MGTA 3QI9B 1HWHB 4U0RB 2EXWD 4P3DB 1I1FA 2ZG1A 4RGNE 3ZTJG 2AI0L 3TBWB 4MLIA 3OWEA 1J86A 5EN2A 4YHPA 4J8RB 2ZOKA 3UPAA 4CJ0A 1XGTA 3FRUB 1DVFD 3GDBA 2DKMA 1J0ZA 4UV4L 3FO9B 4F9PA 3ARGA 2J6EA 1CYGA 4XNQA 4Z76B 5DWUL 3MX0A 4YHYB 3DRQA 3T0EB 3WJLC 4KRPB 4DGYH 2PW2B 3U4BH 1F13A 4PIRF 5DR5H 3S36L 1E4WL 2H9GA 4JKLA 5GS1A 5SX4H 1A1MB 3GSNH 1NCAL 1HIMH 2AK1H 2OP4H 4F80A 3UZVB 1EGJH 1MNUL 3RHWF 2BOCA 5DK2A 4NQDD 5KSAC 2PYFA 5CZVL 5F3HA 2Y72A 5IB3A 4WI6A 2R0ZH 2RBLA 5BS0A 4MAYA 1BF8A 4NNYA 4AENA 3W5NA 5IESH 2YK1L 4OD3L 4XBEL 3KYNB 4MB5A 4R4BA 2AXHA 4DUXA 5D5MB 2Q8AL 4BQBA 1FFQA 4ZS7L 2N1KA 4MQXC 4I2XE 5JPMA 3N85L 1ZLWH 1RK1A 4XCNA 1PY9A 3X11A 5D7LD 5BQ7B 1OAQH 5FB8A 3U7YL 1J8HB 2NY5C 3I6KA 2IMNA 1CG9A 5DJ2A 3KPRE 3A67H 3V7AE 3WFDL 5TDOA 1NSNH 4LSTH 4HG4K 1YEDB 2ITDB 1AP2B 1LHZA 3QWRA 4WGVB 3QCVH 4MMXC 4V1DE 5T3XL 1X5HA 4M8VA 1YN7A 2IPKB 2ARJA 2Z31C 3GFUA 3Q5TA 3DTXB 3IDGA 1I85C 3OBAA 5TE4L 1S7VA 4BQ9A 4K8RD 4XP1H 1FZKB 3SDDD 2XTJE 4MXWL 3MODL 4Y19D 3VFVB 5K93A 1I7RB 1PKQB 5ESVA 4RMVA 3RGHA 3DSNA 5C0EB 3KLHD 2VNCA 3ZYIA 1X5JA 1ZLSL 1AKJA 1LP9E 3VJ6A 3RIAF 4GW4B 4ZPTB 3NCCB 4X83A 2ZKHL 4G3YL 4PJFB 3QQ9C 1IMHC 1Q0YH 2QADC 5MEOA 3NOIA 1SQ2N 4WI9A 4JB9H 5A2KH 1DQJA 3E6FB 4CNIA 1I9JH 1ED3A 3QEQA 3CLFL 2VDKL 2ZPKH 2MQ0A 1QLEH 3OR7A 4NKOB 4CVZA 3QXVA 4UU9A 3FZUD 5EO0B 1ZA6A 5HYJD 3GJEB 1YN6B 4MD4B 5JDSA 5I8OH 4Q74A 5JIHA 5LAXA 5CD3B 2VKXA 4RGND 5B4MD 2ADJB 5ANME 4K23L 4LLMB 3P30H 3PWUA 4JZJB 3LHPL 4FZEL 4PREA 4JKPL 4NJAL 1FIEA 1N6QL 3ULSA 2HTLD 5E08L 3BJ91 1EEQA 3C5SB 4QRTB 4CMMA 4WEBH 1A5FL 4JM2F 2RHEA 1L9NA 5F70A 4ODBD 1CK0L 4LDLB 3HZYA 3FO1A 5DJ6A 2D2OA 4PTTB 4RMRA 1I8MB 5T5NG 4G9FA 3BYTA 3SGJA 3QAZB 5EG6C 2NZ9D 4JRXE 1DQMH 3WXVH 5ITBL 3UAJC 3B6SB 1MCPH 4R26L 1QLRA 2FLRT 4MDJB 3QDAA 1ND0A 4M1CC 2YD1A 1TNMA 3QH3A 4CBPA 5KSBF 2C26A 3M17B 2WBJC 1YNTA 4XC1H 4ETQB 2HJKA 4HC1H 4IIQA 3U1SH 5TH2B 1UXSB 1DVFB 3MFGB 3OJ2C 5H8DA 4LP4A 1D9KA 1BM3H 1I7UA 8FABB 1BGXL 2BVPB 8CGTA 4GXUN 3VGHA 3QRGL 2L7UA 4OLXH 5IFJB 3EOAB 1E27B 2GTZA 4XP9L 5HI5C 3MRIB 1YEIL 3FTGB 4GRLA 4XCFH 4MD5B 4M7LL 3H9SA 3U7WL 2Q76B 3H42H 5C08E 4KI5F 5JPNA 2BSED 2IPTH 5KVFL 2XZAL 1E4JA 4WU7A 3G6DL 3MLPA 1UFUA 4HEPG 2VXSL 2DRUA 1AHWA 1S9VA 3TZVD 4YBQD 3JVGC 2P45B 4NQDB 1F4XH 2DMCA 4OZGA 4Y0GA 2F8OA 1JWUB 1CDJA 1WC7B 5ADPH 5JORB 2DD8H 2LFGA 1SEBA 4RFOL 2P47B 3CSYA 1MJ8H 3GO1H 2DBJA 1OLLA 4NM8H 1PDKA 2J88H 5DHYA 4HSQA 3RWCB 4U1GB 3QG6B 3HE6A 1TZIB 3BKCL 4MCZB 5GZND 4FXGA 5J6GA 3PXJA 4X6CA 1TVDA 3ZT5A 4BQ6A 1CLCA 5E9DD 3U82B 5HDBF 3H7LA 1HKFA 3FONB 4RRPG 1CLYL 1I3GL 3TBTB 4BELD 3I3EA 1NCCL 3OF6A 1SHMA 1BX2B 4LQ1A 1FNAA 3BD3A 4NC0B 1OP3H 4MNGB 1K8DA 1RZJH 3S96B 3CH1A 1YY8B 4R7NB 1R5IB 1G9MH 2RFXB 2HVJB 3V7MA 4PJEB 5C0FA 3G6JE 4CN1A 2VDOL 4IOIB 4Y7MA 2P7TA 3T3ME 3EYQD 4NQVA 4Y19B 1K3ZA 1ORSB 2WIMA 1H3XA 2Y07L 1ES0B 4OM1L 2YMXH 3GBML 2LVEA 4M61A 3LB6C 4PJ8C 1XGYL 4OZ4A 3N1FC 3NIFE 1Q0XH 1J12A 2X70A 3VXME 1YA5A 2VDPL 3I6GA 4Y8DC 1JWMA 2FR4B 4NSKB 5L2KE 1E4XI 2VH5H 1A3QA 4JPKL 4OLUH 5MP6H 2RCSL 3OJVC 5T1DH 1X5AA 1QA9B 5GGTH 4KUCF 15C8L 4ENEC 3DVIA 3IJYB 4PJIA 1WAAE 2GK0A 4JRXD 1FFOA 1S7TA 4NRYA 3K8MA 3DXAD 4K3JL 2YWZA 3UBXB 5HPMB 1MH5B 1ODAA 3BP7B 4N1HB 1UWGL 2MHAB 4LRIA 5IVZB 5HYJB 3V6FA 5HHPB 3IS1X 4OZFH 1GGBL 3C8KA 3SPVB 1CL7L 4XC3H 5GJSL 5DZNA 4R4ND 4JAMB 4O02L 5TDPB 2YEZB 3A6BL 4RGNB 4LASH 3TNMA 4PJBA 4KKLD 1TFHA 3NIDE 2EYRB 1BOYA 5GS2D 4S1SL 3UTTE 1UQSA 1GC1L 2EECA 4OBRA 1M6OA 2YA1A 2DDQH 1U9KA 1FYHB 2DMBA 1U42A 3QDGE 5AYUH 3WL9B 5HYQB 5L2JB 3KPSE 3ZYOA 3O81A 4GBXC 3N9GH 3LKQB 2Q6WB 1KJMA 1AD9B 5IB1B 2ZG2A 3SCMD 1RUQH 1U8HA 4LPYA 3RTQA 4POZC 1XEDA 5HHVH 1U8PA 5C08D 3QUZC 2P44B 3CZFA 3KDMB 4YXLH 43C9B 4XWGL 4NWUL 2R0KL 4K55A 5CGTA 4DW2H 4R96A 4ZUUB 4H1LB 4LCUB 1I3UA 4HS3A 3QR2A 1QSED 5CEZD 2BSSB 4OCRL 1LEGA 2GUOA 2VIRA 3AM8C 4FA8A 5CGYC 4BK4A 5J12B 5JQ6L 2B8OT 4LSRL 3VXQA 1R5WB 4WENB 3C2AL 3BPLC 3PP3K 3ARYA 3O6KL 1XIWC 5F7UA 3LIZL 2VDLH 3P11L 4ODVL 2BCKA 3UBXI 2OR9H 1IGFH 2NTFB 3QIUD 4OM0L 5IMKA 1PQZB 4DKEL 5FYKL 1UKTA 1MUJB 4I2XB 4XXCA 3EJYC 4FABH 5EU7C 2X42A 4JFQB 3HZVA 3TNNA 3NMEA 4YR6B 4LLVB 5CLWA 4ALAL 1IC7H 3O9WA 1QO3A 1L7IL 2OR7A 3KPRB 1U8QB 5IW1A 1UKSA 4PRIE 4V1DB 2ORBL 1RJYA 5C0RL 3CIQA 4WHTA 1KTLB 3DETD 4Z0BL 5TDNB 1DBAL 1G7HA 2AJVH 5DDHA 1VPOL 3ZT7A 1MCWM 3F58L 3FHAA 3RDTA 1A6TB 2V2WA 1KG0B 2JE8A 4X6DF 2R69H 2VABB 1P9MA 3ZT6A 3DUUA 2XTJB 3UYPA 2B0SH 2QR0A 3CMGA 5DJDA 4A6YB 4BZ1L 4JFOA 1LEIA 3B9KC 3DLQR 4HJJH 3C08H 1LP9B 3LZFL 4I18C 4PJXA 2FCBA 2OTWB 4G5ZH 2CMRH 2OK0H 2C1OB 2AQ3A 4GRWF 3HA0A 5D1QC 3STZB 3VXMD 4HS8L 3VD7A 3ULVE 4WFHD 5L2KD 1ZGLP 5HHOA 3VRLE 5E9DB 4P5KB 3WCYA 2YD6A 3B9VA 4K94L 3I50H 3QA3A 1IM3B 2CH8A 3ZLQC 2FBOJ 2LTQC 1DR9A 3T77A 4MA7L 3P77A 3HC0B 4HIXL 2NY0D 1T7VA 5L9DL 2ADFL 5EUOE 3TC9A 1XF3A 1FHGA 1PSKH 4I4WB 3MUJA 4L4TA 4ONOA 1FN4B 4U7KA 4NJ9L 5D8JL 5CJXA 4X9HA 4RIRA 1Q9OB 5ANMB 1AH1A 4D9LL 2I5YH 1HEZB 4PBWD 4L29A 2FATL 4F7TB 4TUJA 4WW2A 5SWZD 3UTTD 1BQLH 4QRRD 1TPXB 4LARL 1VKXB 1MREL 2Q8BH 4YZFE 1BLNA 3PHOA 3F8UB 1N6UA 3KPSD 4MYWB 5HI4C 1JTOA 4OUOA 4UBDC 2FHCA 2RAMA 1MCDA 4QF1A 2HT2C 2IH1B 4GKZA 4LIQH 3E1F1 3GBLA 3QNZB 5TE6L 4FFZH 4M5ZH 4JRXB 1GGYA 2NZIA 4NO0D 1NGWB 2OI9B 2P5EA 3DXAB 1WWBX 5I74B 1T0NA 3A6CH 2ARWA 1Q38A 1FJ1A 3X3FL 1MQKH 1FNSL 3C5ZD 3BE1L 4K9EH 4DZBB 5C6PB 1XF2A 5MEQB 5DMJB 5I2IA 1FO0L 4HUXB 2BY3A 3BP4B 4PRAA 1CT8A 4AY0A 5T3ZH 1I7ZA 5EO1B 3FQUA 2QSCL 5SX5K 4F3FA 1EEYB 1OAKH 4LSSH 4OJFL 3WHE0 3BMWA 1LO5B 3M1BA 4HKBB 4TSCL 2DI8A 4ZFOB 5HHQA 2AV7B 2P48B 5HDQL 4POUB 3CK0H 5C0BE 2BY0A 2V7NB 1UJTA 4OIIL 3O3AA 3PGFH 1X6LA 1R24B 5IB4A 4LOUC 4XMPH 3CVHA 4QRUA 3SE9L 3PL6C 3QXWA 1T5WA 3SCMB 2IAND 5E1AB 3VFUA 4FQCH 3HG1E 4YWGL 3IFOA 4PRDB 4M48L 1FLRH 2DM2A 5C08B 1UWEH 1WUNT 2DLFL 3EOBA 4OZHF 2I60H 3RPIA 2NX5A 3R0MA 3CPLA 4X7DC 4UIMB 1NAMH 4KZDL 3EW3B 1A0QH 2A83B 2AJUH 1QSEB 2FEDD 2FIKB 2BVQB 4J3WA 3SQOL 1B4JH 1ZHLA 5E24E 4OGXH 5BW7A 4YO0B 1INDL 1YEJL 1KIQB 3QWQB 5I8EB 1A8JH 4NHCL 5L0QB 1INEH 4FRWA 5F1NB 3TO2B 4JVUA 4JM2C 4PJAA 3O8XB 1ZHNA 1XT5A 1UM5H 4TUKH 4MJ5B 4OLYH 3QIUB 1NCDH 4GMSH 1A6VL 4EBQL 5CLTA 1T0MA 4ZNEE 3DMMA 1DE4B 1MCJA 4X5XB 4YH6A 3G04B 4LEXH 1ROWA 3L5XH 3ULVD 2X4UB 5KOMC 3HLAA 2W0LA 4S0SD 4HWBL 3CFIC 1OOAA 4X7SL 3QI9A 3D69B 1W0VB 4P3DA 2FWOB 4DEPB 1B88A 2MJWA 4EJ1C 1JTTA 3ESUF 1JNLL 1KTDB 3OXSB 4PGCB 3FO0L 3L1OL 2GJZB 2F5AL 4J8RA 5C0GB 5C0ND 1NC4A 4HGWA 3FRUA 3C5JB 5GXBB 2CLVB 5TJWK 4X8XA 2D7OA 4KK9D 4MGXA 5IKCB 2HJFA 3FO9A 4LPVA 2BDNH 4C58B 4Z76A 2Z8SA 1FL3A 3MBED 4GAYB 3C9NB 2PW2A 4G8IB 5A2FA 5F71A 1WTLA 1F58L 4ONFH 4O2CA 4TNWF 3GK8L 2GCYA 3FRPA 3VXMB 5BVPH 5A2LH 1A1MA 3GBNH 5FOBA 3QIWD 4KI5C 5L2KB 5LCVH 4AK1A 5C2BH 5CUSL 4X8JA 1RZFL 5JHDD 1IAMA 4M8QB 5DEGB 4MVBC 2ZOLB 1P2CB 5CD5D 4CL7A 2NY0B 3RP1A 4KAQH 5JOFB 2MKWA 2QKIB 3FT3B 4Z8FL 4ZUWA 3KYNA 3WEXB 1RI8A 5D5MA 2DWDB 1J1XH 1MF2H 2W92A 1QPPA 4MQ7B 1HHGA 3H3PH 1MAJA 4JCLA 1WWWX 5SWZB 5E8OB 2E7CA 3UTTB 2SEBA 2X10A 4IMLB 1ZT4B 4UV7L 1J8HA 4KWUA 2NLJB 3LQZB 2ZNWA 3KPSB 5AD0B 4LSQL 4LF3B 5CCKH 3HHRB 4XPBH 2ITDA 1AP2A 1NH6A 2CSPA 3IDYB 5BMFH 5KAQG 4APQA 2D0FA 2IPKA 2EE6A 2HT3D 3MJ9A 4MSWB 4NO0B 1P5UA 3DGGA 1HN1A 4LPCA 4M6OH 3MLXH 2AK4D 2JB6B 4L9DA 2EIZB 5GRVL 2HT4D 2IQ9L 1FZKA 3FKUS 4D94A 3C5ZB 3MNWB 4JFYB 3B2UD 1PKQA 5E4IA 3BWUC 4LGSB 4OKVB 3GJFB 5C0EA 1CGSL 4R4FH 1GGIH 1DL7L 1V3JA 1VGKB 5LGJA 5TF0A 5KTEH 4FQ1H 4GW4A 5F7KC 4ZPTA 1WK0A 3OKKB 2FJFB 4PRHE 5IW6A 5FYJL 1U58B 4PJFA 3DO7B 2O26U 3QDJA 2VXVH 3GI9L 7FABL 5F7EL 1XF5B 1NCBH 2DQUL 3VFWB 3EUUA 2R8SH 3QULA 4NKOA 1HYSD 2YA2A 5A3IC 3ISWA 4JFZH 1JPFA 5HYSB 3UJTL 5EO0A 4I48A 3GJEA 2CUHA 4JQVC 4MD4A 3FQXB 5C2UB 3ZSTA 1FNHA 3FL7A 4JZNB 5ICYA 5CD3A 3V6OE 1Z2KA 3QPXH 2ADJA 3VD3A 2F54E 3HAEB 3V5DB 1IC5L 3O3EA 3TVMD 1UXWB 4TQEH 5CP3H 1NFDE 4LLMA 3AMKA 4JO3H 4I0PC 1YPZE 1WISA 1M7IB 2ILLA 1Y0LB 2FDBP 4JQXA 4MCYA 3VD5A 3WN5B 3BIAX 3C5SA 4P2CG 2DQIL 4NZRH 2AXGA 4PG9A 3MLYH 3WFCL 3PP4L 5DT1L 3VRJB 2AEQH 2EEDA 1I8MA 1AR1C 3FB8B 4M9OA 3AU1B 3QPQD 1OWRM 2Z93B 4TSBH 2YN5A 2IG2L 4KKNA 4O4YH 3T8XB 1ADQL 3KLAB 2UZIL 2FB4H 3B6SA 5F9AC 4S1DD 4MDJA 1KTRL 1X3DA 4ELMF 4UZGA 1U3JA 2G60H 4RWYL 2Z0BA 2HG5B 3SGKC 3MRHB 3M17A 4IS6A 4P46D 4Z7WE 4ETQA 1SYSB 5EUOB 2YRLA 4NKMB 1OGTB 1UCBL 4DVBB 4P2RA 2AJSL 3M8OH 3VFTA 2AQ1A 1DVFA 1G9NH 4OD2B 4GLRI 2DKSA 3TO4C 3RA7H 8FABA 2IF7A 2BVPA 5D96B 3O2DH 3QJFB 3LQAL 2AEIT 1RFDH 1Q8MA 1E27A 2J2ZA 4KTYA 5CIPH 2PO6D 3MBEB 3L6FB 3F62A 3EIFA 5I1LB 3FO2A 4MD5A 3NFNA 2APFA 4OGAC 5I1JL 1I1YB 3AAZA 2Q76A 3VFOB 3T1FB 4YDIH 5DJ0B 3ARQA 3CDGA 1LO4H 3TT1H 3WXWL 3BP5B 4JO4L 4RCAA 1EX0A 1IKFH 1N5YL 4AH2A 4GAJL 1BBJB 2YXFA 1AC0A 3BKJL 3QUMH 5JHDB 4XTRC 5I75B 3HMXA 4NQDA 1G1CA 5IQ7H 5FGRA 2VDRH 2XZQH 3B4NA 2BNUA 3S37X 1JWUA 1WC7A 5M7QA 3PIQA 3NCEB 5IBTL 3DX9B 3PF2A 1YYLL 3GSNB 1FC1A 4LLWB 4PRHD 3RWCA 5IFHL 1JFQH 4MCZA 4BH8B 3QHZL 2BOBB 5D7LA 1ACYH 3FN3A 5FUZL 4X9IA 5A16B 2W65B 5EA0L 4WTXA 3VH8B 1OAXH 3MUHL 3OXRB 3NH7L 4FQJL 4M1DL 4OZIF 3TBTA 1MRFH 1PLGL 1BX2A 4WWKD 1IT9H 2J8UE 3HG1B 4OBSA 1MCCA 2JJSA 4I3SH 3S96A 3SE8L 1CD8A 1YY8A 1A47A 1MI5A 4H8WL 4R7NA 5J0BA 5JW5B 1R5IA 4PJEA 3S7GA 1KELH 4PJ7A 1J1PH 4Y5XB 5EC1B 3SDDA 5AG9A 4MS8C 4Y19A 3T2OA 1CTOA 4N5UA 4ZYKB 5EOQH 1QNZL 3G5YB 2JELL 3EDJA 4KY1H 4JG1H 3BRGC 1EVTC 1YMME 4XP5H 5C9KA 2FR4A 1RIHH 2JCCA 3MUGB 1VGEL 2ICEB 5DEZA 1NMCB 3LRGA 3MLSL 3AY4A 3CFCL 1QA9A 4YK4C 2B20A 3IJYA 1AIFB 2A74B 1CFNB 2BMKB 2WV3A 1MFDL 1PG7L 5HHME 1B3JA 1F02I 1NCTA 5E99H 5DYOB 2RIKA 4P23C 4XCEB 3UBXA 1MH5A 3BP7A 2NY4D 4GG6A 2NY1D 5IVZA 5HYJA 3INUH 2F53E 1OY3B 3K4ZA 2VDQL 4X5LA 3SPVA 1JGEB 4KJWD 5ENWB 1JN6A 5MI0C 1C5DB 1CDCA 2YEZA 1MCWW 2EDLA 2YC1B 1AQDA 5F9JB 3TVMB 5F7WC 1FQ9C 4JQIH 4HPOH 1FYTD 2EYRA 2HA1A 4PJCE 3RVVD 3ARFD 2QHRL 2A6JB 1T1WB 2AJXH 4YHZL 3KYMB 1Z5LB 3ZO0A 3MCG1 1NLDL 3W11C 3WL9A 2E7HA 3BWAB 1S9KC 5HYQA 4X9BA 5E7FA 5L2JA 3LKQA 4XNYH 1DQLL 1PYWA 2Q6WA 3N1PC 3VXNA 4JFFE 5GSRA 1AD9A 5ALBL 5EU6D 5IB1A 1O5DT 5KVDH 1CBVH 3U2SB 3LOWA 3UPCA 1BBDH 1ETZA 4G8GA 1WJ3A 3KDMA 1E6OH 4NDMB 3MRJA 43C9A 2FIRT 1RU9H 3FFCD 3E2HB 4EIZC 5FV2A 2ESVD 5D6CB 2UZYB 1MRDL 2ZUWA 3BGMA 4H1LA 4LCUA 1KPRB 3HR6A 1FZOB 1X4YA 3IVKA 3MBXH 4WO4C 1G6RH 1A7OL 1IQWH 2Q20A 5I1AB 1YY9C 4U1NA 4OCYH 3ZDXE 4LIQE 1R5WA 4RAUB 4P46B 5FO7B 5C9JA 4G6FD 5J1TC 1EO8H 2YPKB 3F5WB 2G9HA 3LDBB 3MV8D 3UZEA 1KACB 2AXFA 1QHOA 4GG8A 4G7YH 2NTFA 3MFFA 1PQZA 1SMAA 5BO1L 2ZCLH 3MNVB 1DEEA 1UM4L 1MUJA 4L9LA 1FZMB 4ODUB 4JFQA 3QFDA 4ONGH 3MJ7A 3CFDA 4HLZG 2VITB 5E70A 3QRFM 2EIDA 4YR6A 2PO6B 3PXHA 3QWOB 4F9PC 3FB6A 5DD0L 4NUJB 4UB0L 5T3ZE 2D3VA 4FQIL 5BXFB 4R2GC 1V7NH 1TLKA 1U8QA 5CEYA 5FK9A 4PLJC 1UYWH 5T1LB 5IHZB 4NN5C 2ZJSL 5TDNA 4OFVA 4G6MH 3EFFB 3KNBB 3TZVA 3ZMRA 4IRJA 1P6FA 1A6TA 5JZ7D 4HXAL 4ODHH 4XHJD 1MCOL 4UDUB 4M02A 4N0RA 4ODSH 3AS0A 3IU4H 1MIML 3T3PE 4H20L 1B6UA 2BC4B 3TIEA 1Q9KB 3CFJA 3DGCR 1J0IA 5HSFA 3V4UH 3UC0L 2OTWA 4OFYD 4PRHB 2C1OA 3RVTC 4FQXD 5IHUL 1KYOK 1SY6L 4PJGF 3ETBF 3VFMB 4PV8B 5C0JA 4JREC 3VRIB 4HT1H 2BVUA 1HWGB 4NN7B 5E9DA 1GC1C 4P5KA 1JZ8A 4PPTA 1QFWL 2V2XB 4KDTA 3E8UL 5HHMD 1YEGL 1IM3A 1XGPB 3SO5A 2PXYC 2YD4A 2X4OA 3AS2A 4WWKB 5DI8A 3Q1SL 4OIBA 5C3TA 4LCWD 4NGHH 5FA4A 2AEPL 1N0XH 2O5XL 2EO1A 5JMOC 3TFKD 4J6RH 2XQBH 3BQUD 1KPVA 3K4AA 5K59E 1A7NL 2YRZA 5FDWB 1Q9OA 2B1HH 5ANMA 3O0RL 4XNMA 4KROC 4OLEA 4EXPX 2X1XR 4F7TA 1P53A 4TRPL 4JHWH 4GSDL 2XA8H 1TJIL 3ARXA 1A6WL 4ZO8A 3BIKA 4XMKH 5E00B 3LAFA 2WWKO 4JVPA 5J13C 1TTUA 3L3GB 3MOQA 4JN1L 1JF1A 3BZ4A 2E27H 3D3VD 2GQHA 3S4SB 1T04B 3QIBD 4JFFD 5CZKA 5E6ID 2IH1A 4E41E 3QNZA 4QXUL 2VR5A 1S7QB 5BZDA 4QWWC 4KDVA 2FX8H 3CSBA 1NGWA 2W1NA 4WNQA 3DXAA 3RJQB 3QO0A 1OWWA 4IRSD 2NY4B 1IAKA 3FN0H 4Z77A 1Q72L 2EC8A 1DUZA 2PR4L 5MEQA 4NFDA 2JTDA 3BP4A 4ORGB 5ISZA 2R15A 3CCHA 3WNNA 3QXDA 2EKJA 4QHUB 3HC3L 4Z7WB 3HB3C 3SDCD 3SGEH 1OAZH 2DYPD 1EEYA 3BISA 4M7JH 3ARFB 1LO0L 3R1GL 5J3HD 1N64L 4OAWB 4YX2L 1JGVL 1YQVH 4W4OA 1VERA 5FGCE 5EORH 1N6VA 2AV7A 5CINL 5C0IB 2V7NA 4OZFB 2RQ8A 5CSGA 1R24A 3WDHA 4Z7UE 2CXGA 4I3RL 3VFNB 5T3ZD 4TSAL 5EU6B 3SCMA 1TENA 4X4ME 1NUFA 3A0OA 3FB5B 3QDHA 3PDDA 4PRDA 5DUML 3GMPA 5DMGC 5C08A 5DFWH 5F1OB 2VAJA 1ITCA 2EYSB 1MJJA 4J3SA 3FFCB 4CDGC 2ESVB 3K2UH 3PHQA 2FIKA 2A83A 1QSEA 3PWLB 2BVQA 1N2RA 3L3IA 4YO0A 2CGRH 4FS0A 5I8EA 1IAIL 4U6YB 2DS4A 3GRWA 1NAKL 5F1NA 5ECJE 4G6FB 2WP3O 5I1IL 5KJRH 5J57B 1IGYA 1S8DA 3QIUA 4YFLF 1JHLL 1C5CH 1W8NA 4AIZB 1DE4A 4X5XA 1YUHB 3EO0B 2NYYC 2X4RB 1TETL 4NQED 5J7CC 4MDIB 4P59L 5I76B 1FC2D 1D5XB 2NY5H 2NY2C 3TPKA 4OQ1A 5CKAA 4GRLC 3D69A 1W0VA 3ARDC 1CLZL 1LMKA 4HCRA 2WAHA 2YBRA 4AEFA 1UC6A 4MB4A 4P2OC 5C07E 5KSUB 1KTDA 4PGCA 4TVPH 2J8UB 4Y2DC 2GJZA 1RHHB 4LQFH 1VHPA 1JHKL 5C0GA 4W68A 4D9QE 4XP4L 4LKCB 2VXUL 5T5NF 4S1RL 5GS0L 3NTCH 4GXVH 5IKCA 4X6FB 3S37L 3HI5H 4OCWL 4X99B 5DRXB 4AYFA 4GAYA 3C9NA 4NKDA 3O3BB 5TFSL 4HQQH 1ZTXL 1BZ9A 4XZUA 2VLKA 4JJ5A 4HUMB 3KR3H 5MHSE 4JGMA 1MFBH 2XTLA 2ZSVB 5KN5B 4M6NL 1WCQA 5E2TL 3D9AH 2IGFL 4KC3B 1OF2B 1QFOA 1LDPL 2BVYA 1RUAL 2NY6D 4KTDL 5CWSB 5HHMB 4M8QA 1BJ1J 1NUGA 2ZOLA 6FABL 3U30B 3LEYL 4EN3D 1JBJA 4H0HB 1NGYB 4CUCA 4XNZB 1DBJH 4KXZH 1MHPL 5D6DC 5E2VL 2ZSWB 5TPWL 1XZ0A 4KKCC 3BQUB 3IRPX 4AMKL 2DQCL 4MQ7A 1FDLH 4JM4H 4JDVB 4K71B 4PJCB 5SWZA 3UTTA 5C3LD 4QRRA 4IMLA 1ZT4A 2CK0H 4NKIL 5EB9A 3BHBB 1M7DB 5GRWA 2ENYA 5JW4M 3D3VB 3VXOB 3OR6B 4OCSH 3QIBB 1HSAB 4JFFB 4JPWH 5E6IB 2EDYA 1IILE 1IGML 4XAWH 5CJOH 3IKKA 2ZCHH 3RZCD 4N0CC 4MSWA 3TH2T 4NO0A 1H0DB 4NHUB 4ONHB 1AJ7L 3V0AC 4YHMH 2JB6A 1OSPL 2EIZA 1A7RH 4IRSB 3EYVB 2R0WL 1ZSDB 3NZ8B 1LD9A 1B0RB 2F9BT 1T83C 4OKVA 3ILQD 2N56A 5D7IE 4A6YL 3GJFA 1RUKH 4S10A 2FSEB 1VGKA 1CIDA 4LVNB 1XMWA 4KK8D 2AGJL 5AWNH 2FJFA 2FLBT 1U58A 4TULH 3SDCB 4NN6C 1OTSD 3GM8A 3BH9B 3KJ6L 2IQAB 3DO7A 1A6UH 12E8H 3PHSA 1M71B 3BRDA 2UZXB 5EPMB 1ZMYA 4LCIL 3VFWA 5FECA 3QEGH 2XY1A 5GRJL 1AO7D 3JWDC 4M1GL 3SQBA 2A77L 5E03A 4NOFA 4U1JA 3MRDA 5HYSA 1CGXA 3TPUA 2IANA 3ZL4H 1CDHA 4Y1AE 4JKWA 3QUYA 4JZNA 5JW3L 2MQCA 3RTQC 2EH7L 2V7HA 1SM3H 1NMAH 1I9IL 1T80A 4UINL 5F89A 5A2JH 3OGCA 3HAEA 3EJZD 3V5DA 4X6EB 1UXWA 1IM9B 4IRZL 3NAAL 1JZ2A 3O6LL 1FVDA 5D7KD 2CJUH 5EZOL 1M7IA 1FSKB 4YAQB 3WN5A 3IDUA 4O5LH 1JWSB 1J87A 4F15B 1FNFA 3P0VH 3DHMA 4P9HH 1EFXD 1I3RB 2VWEC 2H3NB 4X6BB 3MLVL 2AERT 4M7ZB 3AB0C 3FB8A 3WE6B 1CLOH 2FX9H 5JIPA 5GRYA 3AU1A 1XFPA 1NAMB 3O6FD 5SWSE 2Z93A 1EV2E 5DD5L 1KF9B 2X9YA 1G0XA 4XXCC 1IL1A 3KLAA 2DLIA 4QHKJ 4NQEB 5MHSD 1F42A 1ZEAH 3LKOB 1P4IH 1OM3H 1J18A 3SDXB 2X4QA 4N9GA 4Y5YB 5CILH 2A9ML 4XMLH 2HG5A 2ZP0T 5E5MA 3MRHA 1SYSA 2VDNL 5GRXG 4DVBA 5HGAB 4Q9RL 4OD2A 5E4EC 3KS0J 3WKMH 5HVGB 1AY1L 5DMKB 3QJFA 1XR8B 1JMZA 4D8PB 2Y36H 4HKXB 2I9TB 3MBEA 2VQUA 4GJTB 3WIIH 1DLFL 5ICZB 1JIBA 3NFPB 1I1YA 4Q6IB 3T1FA 4OFDA 1Z9LA 2E9JA 3KHOA 3ALWA 5DJ0A 3QIWA 1K2DB 2CQVA 3BP5A 2PTVA 2ATPB 4R9HA 3EYSL 1LE5B 3PNWB 4QHLB 5C70A 1BBJA 1UM6L 2NY6B 5JHDA 4M4PA 4JFHD 1TNNA 4G8EA 2V17H 4EN3B 3EFDH 1KEGL 2IBGA 2NMSA 2ADGA 1RZIB 2XT1B 4FP8H 4WTZG 2DLEA 3B5GA 1OL0A 1CICC 3G9AB 1XF4B 3HUJF 3GSNA 4NYLA 1KSRA 4LLWA 4MZ2A 3VXRE 5E2WL 2EDBA 4QYOB 4JFED 4BH8A 1MCIA 4BA8A 4YHNA 1ONQB 1EGJA 2BOBA 4DJMA 2BHZA 2D7QA 4OT1L 5A16A 2FJGB 1CFSB 2W65A 5FGCB 3VH8A 5EUKB 1K5NB 1XGQB 1QQDB 1CN4A 4Y5VB 4MA8H 2V2TB 4Z7UB 2NY3C 3O6MH 2P43B 4EDXB 4YHLH 1N3NB 5J6HB 2AABH 3RZCB 4JPIA 1S5HB 3Q6GH 1ZGLA 2R4SL 4QXTB 5JW5A 4WI2A 3JTTB 5B3NA 5LJYH 4MNHA 3SO3C 2AK4A 4Y5XA 3X14B 5MENE 3EGSB 4LLDB 3VFGH 3MCKB 5IROC 3MGOB 5I1HH 1UH3A 4GKOA 4LCCB 5KG9B 2BNRA 1QPXA 3G5YA 5CZXD 2DQHL 1MVUA 1TXKA 5J1AB 1IVLA 2WLZA 5D93B 3DBXB 2ERJB 1KB5L 3I9GL 4R0LB 1ZANH 3MUGA 4L5FL 2ICEA 2C7UB 3TBYB 3SOBL 4M7KL 3AGVA 3UCRA 3GSVB 3LN5B 2A74A 5EU5A 5SWSD 1FAKT 1NL0L 2Y6SC 5DQDH 2F5BL 2KBGA 1AO7B 5DYOA 3RVXD 4XCEA 1TZGL 3TJEH 4M43L 4LPUA 3QUXD 5I9QC 4PJDE 4HJGB 4H88H 2YHGA 1PGRB 1DBKH 5EZIL 1JGEA 4JR9H 5ENWA 5B3JE 1C5DA 2J1KA 5HBBA 4L8SB 1JNNL 4QTIL 2YC1A 5DZLA 3ZE2E 5F9JA 4BK5A 2N7AA 4RISL 4YC2C 2R0LL 2UWEA 2O5YH 5CBAB 4ZDHB 2A6JA 3DX8B 5BOPA 1CR9H 1Z5LA 3RIAK 1F8TL 3DIFB 3QNXB 2BHUA 3BWAA 4ZO7A 1L4IA 4AEIH 5C71A 3FQTB 3ZKSD 1EFXB 3WLBA 2PYEE 2WIIA 3EYUL 1LK2B 5ADOL 3I75B 3D18B 3ULUC 4L3AA 4XPFL 4L3CA 2MNUA 3OAZK 4U1IB 4XX1E 5ACLA 4ODXB 4EEEA 3T0WA 5I6XC 5F44A 1AD0B 1MCEA 2EDDA 5D6CA 4DKAA 2GJ6D 5TE7L 4HPYH 1FZOA 2O5ZH 1LK3L 4LU5L 4D9RE 1NGXB 3MV01 2WUCL 1N5AB 3MRNA 3NIGE 3QDMD 3WFZA 3K80A 4U0RC 2IAMD 1I4FB 4RAUA 4P46A 5FO7A 5IIEB 2FX7L 2YPKA 3EDEA 3F5WA 2W60A 1JPSL 2PUQT 2CLRB 4OGYL 3P3YA 4X7FC 1S9WB 5CSZA 1QSFD 3VXRD 5IVXF 2GFBB 2EXYD 4ODUA 5DSCB 1OARL 2VITA 3HKFA 3SE4A 3ZE0F 3GSUB 3QWOA 3BW9B 4O58H 3TBSB 5BJTB 3T0EC 5BXFA 1LP9F 3QCTL 4KRPC 2CO7B 1SJEB 4UQ3A 2R4RL 3VGGA 4LGPB 3ZKNC 5IHZA 3OAUH 4JDZB 4J3VA 3TYGH 3BKML 5DJXB 5FHBL 4QCIB 4TTGA 2YD8A 3KNBA 5CIPB 4EDWH 1JGLH 4WIQA 1T2QL 3VDCA 4NO3B 5MEND 1QFUH 3V4VH 1T7ZA 2WBKA 1CTNA 2BC4A 3MRFA 1YJDL 4JN2B 4FOMA 3RGVA 1F3DJ 4YPGB 1F90H 2NW3B 4LSUL 4N8CH 5GISL 3HCVB 1CU4H 5BS0E 3P9MB 4I1NB 4PG2A 4PV8A 3IRZA 2XPGA 3QUMB 5ETUB 3GI8L 2VKWA 3ULVL 3CU7A 1JRHL 1PBYA 4YDKL 3CVHH 1MFAH 3W9DA 4E42A 3B8SA 2V2XA 5I16A 2CDFB 3V2AR 1CZ8H 1DUYB 5IMOA 1T3FB 3OAZH 3TJHC 4ZUVB 3L95B 4R7DB 4WWKA 1K4CB 2GITB 5I0DA 3DVFA 1FGNH 4Y4FD 1CDIA 1OT1A 1WZ1H 1FFPB 4XBPA 3CFEA 2X1OA 4R8WH 5DD1H 4C4KO 1CDGA 1SBSL 5FDWA 4LHQB 5KOVC 1KN2L 4WV1B 1PFCA 3WD5H 5DZOA 5I30H 4WEUD 4LSVL 5CGMA 2XYCA 4G7VH 1EUUA 3HE7D 1AFVH 5DQ9B 5E00A 2HFTA 2C4XA 3H7BB 4TVPE 4Q0XH 3UYRL 3NN8B 5JIIA 5D1XD 3S4SA 4XPGL 3IKCB 4F57H 1SVCP 4ETYA 5SWSB 2OTUA 3BP6A 4HGMA 1D5ZB 1CFTB 1FNGB 3DJ9A 2CLZB 1TVHB 3QUXB 4QEGA 3X3GL 3D25B 4YXKL 4P49A 4TOYH 5HI3D 3U4BL 1R3IH 1I1AD 4HUKB 5F9WB 1P7HL 2VTFA 4RFEB 5EO9B 4D9RD 3QXAB 3VE0A 2DMKA 5GGTA 4Z7WA 1HIML 2AK1L 1FYTA 4FFWC 4PGBB 3MRGB 1AE6L 3ARFA 3U9UB 4K7PY 4QLRA 2WK2A 2L0DA 3RUGF 4Y16D 5F1IB 2D0GA 4JZJC 3U0WL 5KAQF 4KMTH 5JHLH 1ZVYA 1DQQB 1CXLA 4JHBA 1H9VA 4RRPA 3ECBB 3LS4L 4OZFA 3EBAA 5IESL 3VFNA 4EUPG 2C9AA 5EU6A 5KANG 3H9YA 4KHXL 3FB5A 3PJSA 4I77L 1ZS8B 2JB5H 1CFQA 4NM4L 3QAZC 4U3HA 5B8CB 1VFAA 4X7TB 2QSQA 3RU8H 5FCUH 1NKOA 2FH8A 1QBMH 3FFCA 2ESVA 4U6VL 4B53A 1JYVA 1YECH 2GJ6B 4G9FE 2VISA 1DJSA 3MROB 3PWLA 3GMOA 5J4MA 1S7RB 3A67L 2BNQD 3B83A 4LEOB 3QCVL 2IAMB 4U6YA 5I8CB 1R0AH 3ARUA 3MV8A 1A9EA 3IDXH 3WS6A 4HK3J 4AM0A 4LP5A 1LNUA 1JGUL 1QSFB 3BXNB 1LEKA 3VXRB 5E8PA 3G6JF 4M3KB 2R2CA 5LGHH 4BSWB 5BS0D 1YUHA 3T3MF 4U3XA 1KBGL 1X6NA 3DV6A 4YHKH 1K3IA 1U8NB 4MDIA 5KSAD 1G6RB 3OPZL 1D5XA 3LH2L 4LGRB 1GGCL 5E0QA 5EOCH 3RKDD 1FIGL 5ALCL 4OQTH 4BZYA 4NNXB 1ZK9A 3NIFF 3RWJA 2D9CA 4B5EA 1GGUA 3U9PH 1BQUA 2XWTB 1HI6A 4XH2A 4JB9L 4M62H 1T6WA 1NMBL 1WAAF 3H9SE 5FUCE 1QLEL 5EZLB 4LKCA 5DJYB 2QV2A 1SVZA 5MENB 4KGJA 3QZWB 4LSPH 1JYXA 3IGAB 3UTZB 1OTUC 3B2VH 5B38B 3CDYA 1UENA 2GSIB 1GIGL 2OSLA 1ZWIA 3RRQA 3WMSA 2X9WA 2EKSB 3QEUB 4W6YB 1TCMA 3FN9A 5BVJB 4FQXA 4I0CC 4TVPD 2AI0H 3QHFL 5HDOA 3NIDF 4OZGE 5EBLB 4U1GC 5D2LA 2ZSVA 1KXQE 5KN5A 1EZVX 3RL1B 1OF2A 3V95A 5HHNA 1D5MB 4UV4H 1D5IL 5CWSA 5E6ZA 4ESKA 4TVSa 1DQTA 5ESQB 4PJDB 5DWUH 3JUZA 4X6CE 3WIHL 4XGZB 3RQ3A 4PJ9A 4Y4FB 4LCWA 2VUYA 3QQ9D 3S36H 1MCPL 1RUMH 1NCAH 4M4RA 4O9HH 1FAIL 4HUUA 4K8RC 4JDVA 4FQQB 3HE7B 1M7XA 1TCRB 2EC9U 2R2HA 1MNUH 4YGVB 5JMRA 1LO3H 2FYYB 3BHBA 5CZVH 1M7DA 1IAOB 4K7FB 2GAZB 4JKKA 3D3VA 4ELKA 3VXOA 5D1XB 3QIBA 1HSAA 4JFFA 2ZUTA 5E6IA 2NR6D 2YK1H 4XBEH 3NCJH 3V79C 2Q8AH 1BM3L 3K4DA 4ZS7H 3AY4C 4WWID 1H0DA 4NHUA 5EU4B 3RAJH 2CIKB 3N85H 4IRSA 1NCNA 3NA9L 1ZSDA 3SKOB 5JXAH 1B0RA 5DQJA 1I1AB 2H1PL 3FZUC 4PJIE 3U7YH 5HVHB 3SBWA 1MHEB 3HPLB 4GRMB 2FSEA 2OZ4L 1JNHB 1QBLL 2OL3A 1IC1A 3WFDH 1DBMH 1ZVSA 4MA1B 2ICWB 1FZJA 4RGNC 4FHBD 5T3XH 3SDCA 5B4MC 2DYPA 3BH9A 1Y6NR 3CXHK 3WFEL 2OTPA 4Y16B 5EPMA 5DURD 1I1FB 3UROR 2ED8A 4EXKA 5CJ5A 1CXEA 2HTLC 1BVZA 3EZ8A 4PJBE 5GS0C 5EN2B 4IMKA 4YHPB 1D6VL 4MXWH 3MODH 3ALPA 2ZUVA 3I6LD 3BN9D 5ADPL 4L4VD 4LMQE 2DD8L 3K3QA 2MWCA 3EO9L 3GSRB 1MJ8L 1WBZA 4YGAB 1ZLSH 1X9QA 2Q3ZA 3T4AB 3HZMA 3JBG7 2NZ9C 4G3YH 5B38G 1YC8A 5C09E 3ULVF 3DRQB 4F58H 1NDMB 3OKEA 3VRLF 1WQVT 4FG6C 4PJHF 1RY7B 3H9SD 1RJLB 3S35L 4HZLA 3CLFH 3N1QC 4YAQA 4P4KC 2VDKH 2BNQB 3CH8A 5C0AE 1I7TB 1JWSA 3OGOE 1FLTX 4Z7VE 1JYNA 4NP4H 5J12C 3UTQB 4HMEA 5F1KC 5EUOF 2BOCB 5DK2B 4XPHL 3WE6A 3LMJL 1MVFA 4K23H 3T08A 5BS0B 1S7WB 4GRWH 4NQEA 4R4BB 5KSAB 2HFFB 3FAXA 3LHPH 2ICWI 4FZEH 4HF5H 1S7XA 1N6QH 2KH2B 4YZFF 3SDXA 2LAGB 3E0GA 4WFEE 5I15L 2R1YA 5GGUB 1CK0H 4HWEH 2J5LB 5K9JH 1Q1JL 2DLGA 5HGAA 1CG9B 2WBWB 5TDOB 3KPQB 2IH3B 5DMKA 1U8LA 5ITBH 4XVUD 1L7TH 1XR8A 4YBQC 4R26H 2I25N 3SGEI 3VW3L 1YN7B 1R5VA 2ARJB 2P49B 3GB7B 2XTJC 4HKXA 4JO1H 4WHYH 1P7QD 2WSKA 5C86A 2CK2A 4XX1G 1CS6A 1S7VB 2C5DC 4Q6IA 1ERNA 1DN2A 1CE1L 1K2DA 3V0VA 1PY4A 1V05A 5GZNC 1AGBA 1LE5A 1AKJB 1I1RA 1QBBA 5AYUL 1BGXH 4P3CL 3N9GL 3QRGH 3DUSA 1J0KA 4EN3A 4IOFD 4M5YL 4XP9H 5ID0A 1YEIH 4PJ8D 1RZIA 4DN3L 2Z92B 3N1MC 1H5BC 3ZKMC 1DANU 4EIGB 3U7WH 1F5WA 2IBBA 4CVZB 4PGJA 4GO6B 1DFBL 1MOEA 2XZAH 4OCXL 4DW2L 3G6DH 4ENED 1FCGA 7CGTA 1RZ8A 2EDJA 5I73B 2I27N 4W6XB 2KL6A 2VXSH 1N8ZB 1YNLL 3MV9A 4L4TE 5E56A 5EUKA 4TNWK 4HW6A 1TPXC 1XGQA 1QQDA 3VWKC 4OD1H 4Y5VA 1KJ2L 5JOPE 4PREB 2OR9L 1IGFL 1VDGA 1QSVA 3ULSB 4X4MA 4EDXA 3GZKA 1NGPH 4RFOH 1HE7A 3RZCA 1CQKA 1T21B 4CMMB 1RZKL 5J9PB 3JTTA 3WO3B 2NXZD 4WI7A 5C09D 3X14A 3VI4E 1GXEA 4PRPE 1KCSL 4FZ8L 1I8LA 3MCKA 5I74C 2W0KA 4LCCA 5KG9A 4LAJH 4LFHD 5J1AA 2P5EE 4HFWA 5IBUG 5IB5B 5C0AD 3DBXA 1I3GH 5GRUL 3V5KB 1NCCH 1BD2A 4R0LA 4R4NC 5C0DA 1QLRB 3T0AA 4N8VB 3TBYA 2C7UA 3QH3B 4KKLC 2AJVL 3ZHDA 3QUZD 3LN5A 2FEEL 5FM8A 3QO1B 3R8BB 5DURB 5E94A 4XP6L 1RK0B 1KGCE 3DVNA 5EWIH 1AO7A 2A6IA 5KS9F 2HJKB 4PYHA 4PV9B 4OM1H 2Y07H 4HJJL 1WEJL 3GBMH 1CDBA 1D9KB 3BUYA 2AJYH 2CMRL 2OK0L 1XGYH 2EC9T 1RULL 1XIWD 3W0WA 1E4KC 1A21A 4L8SA 2CKBL 1HHJB 3MLWH 3W2DH 2VDPH 1Z9SA 5CHNB 3G5ZA 4KXZI 4GMTL 3EJYD 4WI5A 4ZDHA 15C8H 3DX8A 3I50L 5CBAA 1LILA 3H9SB 3O4OC 4UT7L 4K3JH 2NX5E 3QNXA 4WU7B 4IDJH 3FQTA 3CX5K 1EFXA 5L0QC 1AHWB 4ODTL 1LK2A 3V8OA 3I75A 1GGBH 3D18A 1CL7H 3O8XC 1A3LL 5GJSH 4HIIB 3RDTD 4F2MB 3EYFB 1FG2A 3O6FA 4M03A 4O02H 3A6BH 3QIUC 4FQHB 5CP3A 3P73B 2Q87A 4YNYB 4ODXA 4PJAE 3H6JA 5DEFA 1GC1H 4WW1A 2Q8BL 4L1DA 5EBMA 4D2NA 1G7LB 2N7BA 2YR3A 5DHYB 1NGXA 3LS5L 1N5AA 1KT2A 4FXGB 5ITFB 1I4FA 3TT3L 4DEPC 5IIEA 2E3VA 3TA3A 5D1QD 1WIOA 3DETC 1KV3A 4S0TD 3L3JB 1RIUL 2IFFL 4XWGH 1MQKL 3BDYL 2R0KH 3WYRA 4GUPB 1KCUL 4HXBL 4DK6A 3CH1B 1P7QB 4JEGB 4L4TD 3TBSA 5EOTB 1MJ7L 5F6IB 4OCRH 3CU1A 4AEHH 3T0DA 5JQ6H 5ICXA 1SJEA 2P7TB 4LSRH 3R8QA 3C2AH 1JNJA 4WFGD 4RMSA 5JOPD 1OAKL 1OQOA 4PUBL 4Y8AA 3RPKA 4JJHA 2AQ2A 3LIZH 3P11H 2DM4A 4RMTA 5DJXA 5DJCA 4NQUA 4HBCL 4OM0H 4QCIA 4R3SB 2CRMA 5INDB 3OMZA 2H2PC 4L8BB 4JE4B 1CFVL 3CK0L 5CIPA 1ZGLM 5IJKC 1J05A 3I6GB 4PRPD 3OKOB 5HYEA 3QCUL 5E8DL 2XZCL 4ALAH 5F96H 4Z5RB 3FOLB 4JN2A 4UBDD 1FFOB 1S7TB 3AUVA 4NRYB 4YPGA 1UWEL 1L7IH 2YXMA 2HT2D 3DHJA 4LVEA 4O00A 1NBVH 1NAML 4JFEA 2ORBH 1YMHA 1URLA 3V6FB 1IGIH 1NFDF 2AJUL 3RX5A 4Z0BH 3C8KB 1YPZF 1AXIB 1VPOH 1EAPA 1X5GA 3F58H 5GGRB 1KGCD 2CDFA 4PJBB 4P9MH 4YBHA 4XB8A 1PX4A 2E7LC 4JHZA 4ZUVA 3L95A 4R7DA 1UQSB 3ZTNL 4BZ1H 4NO2B 3GUTB 1K4CA 2GITA 3MACH 2FH6A 5C7XL 4UTAL 1J8HE 3LZFH 1FFPA 3IDYC 5E2JA 3VXTB 1J9CT 2XOTA 1WGOA 2NXZB 3L5XL 5C09B 4HS8H 1KJMB 2HVKB 3W39A 4WV1A 3UDWA 4NT6A 3C5ZC 2X05A 4K94H 1QYGL 1WFOA 5C0AB 4LOUD 1HHIB 3LY6A 3EOYG 2NX5D 3B43A 3CZFB 4Z7VB 4UNVA 2Y5TA 4GQ9L 3NN8A 5B39B 5L9DH 1PKQE 1NGQL 1XR9A 5I71B 2YKLL 3QUZB 4WDIA 2FO1A 3OL2A 4NJ9H 5SWSA 3DURB 1WFTA 3SHSA 3VDBA 5D8JH 1D5ZA 1CFTA 3VXQB 4AQOA 2DI7A 3ZYZA 1U0QA 3D39A 2BDNL 2CLZA 1GOGA 1TVBB 4PJFE 1F2XK 1Q94A 4FXLA 4V2BA 2FATH 4XI5D 3QDJE 3VI3F 2I24N 2BJML 2Y23A 4LARH 1BOGA 1MREH 4RFEA 5EO9A 3ORJA 4JM2D 1XIWB 3KJ4C 4WCYH 2OS7A 3MRQB 4DGVL 4ZFFB 2WMPA 3S6CA 4PGBA 4AL8H 1QO3B 5C2BL 1W72L 4GW5B 2EIBA 5TE6H 3NPSC 5F1IA 2FEDC 5GZOC 4U05A 5IG7B 4ISVA 2GYSA 4WU5A 1RJYB 2YPVH 3ECBA 4WHTB 1FNSH 3BE1H 3THML 3WFBH 1G7HB 2YD3A 4EOWL 4P5MA 3Q5OA 4WEMB 5LXGL 1FO0H 1K8IA 1YJDC 3EHBC 1MF2L 3RDTB 2V2WB 2MPAL 4AT6B 1ZS8A 3GMLA 3DUUB 3WNLA 4X7TA 1SYVB 5C0CD 3BZFB 4JO2H 4OJFH 1PD6A 3ULVC 2H8PA 1J5OL 4DKFL 2GJ6A 3P0YL 1SJVA 2Q1EA 4TSCH 3MXVL 1EH9A 1S7RA 5CCKL 3QDMA 5GGVH 1MQ8A 2IAMA 2VRAA 4OIIH 1E6JL 4I9WD 3BZEB 3SE9H 5CBEA 2JIXA 2J8UF 5D1QB 5FGBA 1QACA 3MLXL 4M48H 3TCXA 3C09B 1QSFA 3BXNA 3P77B 3T2QA 3VXRA 3RY6A 5DK3A 1OW0A 2DLHA 4KK9C 4BSWA 3HNVL 2CRIA 2Z91B 3OV6A 5D96C 4KZDH 3LKSA 4BFEA 4P2RE 2XXCB 1U8NA 3SQOH 3O11A 4L4TB 1G6RA 1GGIL 5KTEL 2ZWLT 5TQ2L 1INDH 1YEJH 4RIRB 5D72H 5T3XE 4NHCH 4NNXA 2DKUA 3QSKB 4L29B 4TUJB 3MO1B 2XWTA 2VXVL 3GHBL 3VFPA 4LFHG 1D5BA 3HFML 4WUUD 1EAJA 3CMOL 4EBQH 3PHOB 1GOFA 4NWTL 5DRZB 1T20A 4K2UL 5DJYA 3F7QA 4JFZL 5DO2C 4R97B 5I75C 1A6ZA 4QF1B 5MENA 3QZWA 4PRPB 4LLQB 3IGAA 5CKGA 3UTZA 4ZFZB 4N9OB 5CD5C 4HWBH 2VZ1A 2FD6H 4U2ZA 5IOPB 4U49A 1MLCA 1PKOA 2P5EB 5KW9L 2EKSA 3QEUA 4NQDE 1ZT1B 4UTBL 3PWJA 5GRVK 5BVJA 5AUMB 2QJDA 3OG4B 4YIQB 4X4YA 3FO0H 3D1MC 3L1OH 5IK3B 1T7WA 1XF2B 4PJCF 2F5AH 1CT8B 3ROLB 1F4YL 4X6DE 1D5MA 1XAUA 4IHOA 3MRPB 5FF6A 5FHAL 5D1ZA 5ESQA 4MXQC 3QDJD 1I3VA 5D7LE 4XGZA 1CQYA 4J4PC 4BZ2L 3FB7B 3M1BB 1FPTL 3QYCA 4S1QL 4Y4FA 2R2EA 2B4CH 4NUGL 4ZD3L 1F58H 4GRWE 3MYZA 2HT3C 3GK8H 1A64A 4O4YL 3O3AB 2FECL 1JYWA 5IB4B 1KENH 3CVHB 4QRUB 3LKNB 1RSFA 4KUCD 1JJUA 2CDEB 2G60L 5KZCD 3ZZ1A 1MSPA 2COQA 4P5TC 5CUSH 4PYGA 3IFOB 3HE7A 2DQTL 1RZFH 4YJZL 5A3ID 1MI5E 4YGVA 3K1KC 3EOBB 1U92B 5DLML 4PJEE 2NX5B 4PJ7E 1QRNA 2DJSA 3CDCA 1IAOA 1Q9LA 4B50A 3ZDXF 2UUDK 4Y19E 1TTGA 1IGJA 5H37H 3DO3A 3M8OL 1ZHLB 5D2NA 4U6HB 2R29L 3KPNB 4OCNC 4F9LA 3JWOH 1NMCC 3TWCL 3PABA 35C8L 4IEFB 5EU4A 3SE3A 2MOVA 2JCCE 4AIOA 1ZHNB 1MY5A 1HYSC 4BSJA 4MX7A 3SKOA 5FIEA 3D0VA 1I1AA 3WKNA 3O2VL 1MHEA 4UIKL 4XNXL 3HPLA 3W81A 4GRMA 4HS6A 4JM2B 1KCRL 4LSQH 1FFNB 3D5OF 1G0DA 5FM5O 1SJXA 1LO4L 3RVUC 2ICWA 1IKFL 4OKDA 4GG6E 5HYJE 3TVMC 1QFWM 2ZUQB 5LQBL 3QUML 3Q48A 3F65A 3NZHL 4Y16A 4NCDA 3S3SA 2GTWB 1TDQA 4NNPH 2I26N 2IQ9H 1CGTA 4P2RD 1NC4B 4HGWB 5F7DA 3GSRA 5I1DB 5FYJU 1FGVH 4NRZB 5I8KL 1YEEH 1YEHL 5T3XD 2HJFB 3T4AA 2N4IA 2XWJB 4A2MA 4U1SB 2YPLE 3CXDL 5FYJH 2A9NH 4JKMA 4WVRA 1H3PH 3JV6A 2GHWB 4W6WB 4PY8J 1FL3B 1WIPA 4MXVF 1NDMA 4GT7A 1GL4B 5F7EH 1OAXL 3E2HC 32C2B 4S1DC 4ZTOL 3S9DB 1RJLA 4O2CB 2B39A 2GCYB 2BNQA 1KB9J 4G8GE 1I7TA 5FOBB 1EERB 3UTQA 3UJTH 4AJ0A 1VACB 1OB1B 1MWAL 4X8JB 4M93B 1MHHA 3UO1H 3LDBC 3DUHA 4OZHE 2BY1A 5HGHA 5K59F 1KCLA 1Z9MA 3WIHA 3EJJX 3KWWA 1IC5H 5FA3A 3UTSD 5C6WH 1S7WA 1HK6A 2UUDH 4XTRD 4ZUWB 5DJ8B 2HFFA 5KSAA 3ZTJH 1KCKA 2PO6C 3VXSE 2GEEA 5A1AA 2X4PB 1HHGB 2DQIH 2NPLX 3L3HB 4U1MB 1U91B 3WNPA 3F6IA 4CGTA 3WFCH 3PP4H 5GGUA 2SEBB 3SEPA 2DM7A 4G43B 4DQOL 5DT1H 4DZ8A 1UWXK 1JF6A 3REWB 1HILA 4EI5D 1A9BB 4NRXA 3KPQA 4FMFA 2IH3A 2P8PB 3DVGB 2UZIH 5CMAB 4APQB 5L88H 4KK6D 1KXTB 4X7EC 3GB7A 1MI5D 3DGGB 3DV4B 2X4SA 2QTEA 3KPPB 5E5RB 3HN3A 4I5BB 2Z31A 4JQIL 4HPOL 2EDKA 1F11B 1H3WM 1I85A 1YEFH 1UCBH 2AJSH 3OZ9L 4OCLC 2OZ4A 5LGJB 3Q6FB 1Z0NA 1JZ5A 1AXTH 3OJDA 1T89C 5IW6B 3C6LD 3LQAH 5IEHB 3RIFF 1W8OA 2YUVA 4H26B 1YEKH 3QDJB 4Z7UF 5E9DE 1AGFB 1CBVL 3I3DA 1CFBA 4G6AD 4WWKC 3V5HA 3ZKXB 2Z92A 3QULB 5I1JH 1I9RL 3V6OC 1JPFB 3WXWH 1EJOH 4I48B 4JO4H 1IBGH 5KZCB 3DROB 1MRCL 1N8ZA 5ICYB 3FT2A 4P23D 3WLWC 3BKJH 1MFCL 2D03L 5HD8C 1VFBB 4LPXA 3O3EB 2UVFA 3JSSA 3EDDA 2JJWA 1EO8L 5F9OH 2XACC 1JPST 4NFCA 4XPTL 4XCYB 1RZJC 4MCYB 3FRPG 1RVFL 5I1EH 5IBTH 2ZCLL 4Y4HC 1T21A 1YYLH 2AXGB 4PG9B 4O51B 5J9PA 4ONGL 1C1EL 3BZDA 1ZOXA 2YPLD 3TIDA 5IFHH 4LSDA 1XCQB 3W11D 4DK3A 2NY4C 5EA0H 2O61A 1MJUH 2JJTC 1UWXH 3DXAE 4G8GD 3NH7H 1TZHA 2D4FA 2VZSA 3GIVB 4FQJH 4M1DH 4PP1C 1UYWL 3V5KA 1YDPB 4N8VA 1J8KA 3JTSA 1PLGH 3LRHA 1CF8L 1HINL 3DX7A 5ACMA 5ISZE 3QO1A 3ARFC 2EIEA 3GMRB 4H8WH 1RK0A 2GKIA 3GNML 2GY7B 4IS6B 5IMLB 3DYPA 3K46A 3ARZA 4P2RB 4PV9A 3VFTB 1QTYT 4L4VA 4LKXB 4OSUL 3HR5B 3MOBH 2JELH 5FO8B 3VXSD 5I1KL 2H26A 2WBJA 1AI1H 4HUWA 5J11C 1UH2A 1UCTA 4QY8B 5GGSB 3HMWL 2HAZA 1HHJA 1F4AA 1UVQA 4HT1L 5CHNA 1PW3A 4KVCL 4QT5B 3CFCH 3FO2B 3MLRL 5D7SL 3CLEL 3FT4A 3NFNB 2O93L 1MFDH 1PG7H 3AAZB 4QTHA 1O7SA 3CDGB 4MWFB 2G5RA 1RJZA 1HKLL 3MLTA 4NGHL 4AH2B 2X40A 1QSEE 5CEZE 4RMQA 1KN4L 5KVEL 3AROA 4IRJD 1K9TA 4HIIA 4F2MA 3EYFA 2HFGH 4FQHA 3ZDYF 3S34H 5C6TL 3P73A 3UTSB 4KFZC 4YNYA 4CVXB 2BNUB 5E5UB 2CUIA 1U93B 3LN9A 4JHWL 1C12B 3JVGA 3PIQB 2QHRH 3VGFA 4YHZH 4X6DB 3J8F7 1G7LA 1NLDH 1FE8L 3WNKA 4OI7A 4Q9QL 2OXGA 2YUWA 2XQYG 2K3TA 4UT9L 2XWBA 5EBWA 5ITFA 1DQLH 1IZJA 5D7LB 1II4E 4KMLB 1BQHB 5ALBH 2VLJA 3RVTD 4EI5B 1ZAGA 2UVEA 2VSDA 1RZKC 4GRWB 5KVMC 5K9QI 3L3JA 1EZVY 3ZHLA 3MRLA 4JY5L 4PBVC 1QZ1A 3FN0L 4ELME 4GUPA 5JZ7C 1MRDH 2LE9A 3OX8A 4XHJC 1P7QA 2VUOA 5D7IF 1MI5B 2PXYD 1OD7A 1ZV5A 5EOTA 1BPVA 3O41B 2KDGA 2VERN 2QL1A 4XVSH 4PJ7B 4KJPD 3SDDB 4F37F 1OAZL 1MPAL 2J6EL 3IDIB 4RGOL 1Z0MA 3DWTA 4LVHB 1A7QH 3H8NA 4R3SA 2EEAA 5EORL 3VGAB 5BO1H 3HRZA 1UM4H 5INDA 4L8BA 3C6LB 1RURL 1BZ7A 3ARBC 2V9QA 2VLKE 2JCCB 2MMXA 4WFHE 3OKOA 2DBLL 4PJ8A 5DD0H 1CDUA 4FQIH 4Z5RA 2ENSA 3RWGB 2F8XC 4X80H 3FOLA 4XNZC 1GGTA 1WTGT 4K3HA 3TFKC 2A73A 4ZQKB 4L8CA 3BQUC 4CDHA 3DOSA 1A1NB 4GG6B 3L5IA 5FYKD 3TN0C 2YD7A 1WBXB 1DBBH 4ZSOB 4ZTPL 4P23B 3HPJB 3FJTA 3VU2A 5ISZD 1C16A 2CGRL 4K71C 3SKJL 3MRKB 1JN6B 5GGRA 3RKPA 1AQDB 2Q7NA 4J7RA 4OFKA 5SWZE 2HFEB 5KJRL 4MD0A 1MIMH 4NO2A 4QRRE 4ZOBA 5MI0B 3GUTA 4H20H 3V0WL 3F12A 5E6IC 5I1CL 2FL5B 3UC0H 3VXTA 4ERSL 2B1AL 4FQLL 5T33L 2YPLB 5IHUH 4LAQH 2WWMC 5C09A 4BH7B 1PYWB 2X9XA 4KKBD 5B22A 2HVKA 3VXNB 5GSRB 4MJ2A 1IGTB 4PRBA 2X1WL 2XA3A 4NQCD 3QP3A 1QFWH 4GBXA 1U8OB 1ETZB 3E8UH 1YEGH 1HNGA 4G8GB 5C0AA 1JV5A 4OF5A 1HHIA 3SBWC 3W9EB 4KRMB 4Z7VA 3MRJB 4LVNC 2M8XA 3UJIL 5IVNA 4P2YA 4TVPL 5B39A 3BGMB 4FFVD 3Q1SH 5LVEA 5DMGD 4ZO9A 2AEPH 3QUZA 4Y88A 1KCVH 3IVKB 2O5XH 3H9HB 4OZHB 1BZQK 5J3HC 2Z8VC 3DURA 3NTCL 2MKLC 2BRQA 2JKXA 4U1NB 3WS3B 4BSVA 3O0RH 2YUZA 1B4RA 1TVBA 5C9JB 4GAGL 3EYOB 3MPCA 2G9HB 3AM8A 4XVJL 3T65A 4K9EC 4TRPH 2AXFB 4GG8B 2D7MA 4GSDH 3MFFB 4OGZA 1TJIH 3VXSB 1DEEB 1TJGL 4L9LB 2YSSA 3ILPB 1XIWA 2LAAA 3QFDB 4HH8A 3MJ7B 3CFDB 1FV1A 3TH4T 1WWCA 3MRQA 3TYFB 4ZFFA 2UV3A 2VXQL 3FB6B 2A6DB 4ACPA 1YYML 43CAA 4PFEA 2IANE 1L6ZA 4QXUH 4GW5A 4IJ3C 3ZE1F 4X4XB 1QBAA 2NYYD 2DQGL 5CEYB 1DQDH 5FK9B 5IG7A 5JR1L 3BEVB 4U1LB 1G0YR 3UTOA 2NY2D 4LLYB 4YFDB 2VE6A 4HKJB 1Q72H 3H0TB 2DQDL 2ZZUT 3ARDD 4F15C 1UZ8A 2PR4H 1T22A 3TZVB 4IRJB 4LHUA 4P2OD 1X44A 4AT6A 3Q0HA 4M7ZC 4Y2DD 1FDLL 4F7PA 3GKWL 3HC3H 1SYVA 4JM4L 1P4LA 3BZFA 1NBZA 1LDSA 5D9SB 3TIEB 1LO0H 3NCYS 3CFJB 1N64H 4YX2H 4CN6A 1JGVH 4CRPA 1S9XB 4LPWA 3UBXG 3B5HA 4LLAA 25C8L 3WSQL 3ALXA 5DVOA 2VLKD 5C0JB 4Y5YC 3B9KA 3BZEA 4I3RH 4MQSB 4TSAH 2WQRA 5A43C 4Q6YA 1MIEL 5D1QA 5FOJA 4AG4H 2EE3A 2IC2A 5DUMH 4XNUL 4AEEA 3ARSA 4JFPB 1KIPA 4YHML 2X4OB 3NBNA 2D31B 5DI8B 3QBTB 2Z91A 3MRMB 5FA4B 1BFVH 2BVEA 2HP4A 1RUKL 1WCBB 2BVOB 2PXYB 1KPVB 2HMIC 1B90A 1GRWA 3P9WB 4XNMB 1LE9B 1IAIH 4HV8A 2JJUA 3MO1A 1ZT7B 1A6UL 3PP3H 2EDRA 2J8OA 5I1IH 5FGSA 1KFAL 3BIKB 5I1GL 1GAFH 1JHLH 5DRZA 2P5WE 4M6MH 4GW1A 2NY6C 3BAEL 1JF1B 3BZ4B 4H1LG 4X5WB 2OL3H 4PRPA 4LLQA 5DUBA 1TETH 4PJDF 4ZFZA 5DFTA 5F7NC 4P59H 4E0RA 9CGTA 5BZDB 1MCLA 5JHDE 5IOPA 5FYJE 2IADB 5EFIB 4WNQB 3DECA 5B3JF 5CFHA 3QO0B 1G7IA 1ZT1A 3GSOB 5HVFB 5AUMA 5DFVD 5I0ZA 1IAKB 2VLRA 3ZE2F 5EZJB 4N0CD 4YIQA 4Z77B 2IJ0C 1DUZB 5IK3A 5F8QC 2CJUL 4K3DH 5I19L 1CL7I 5ISZB 4XRCB 1SJHB 3ROLA 3VWJD 4XP4H 3CCHB 4S1RH 3V8CA 3QXDB 2K1MA 3S37H 3MRPA 1NQBA 4DVRL 1VFMA 3IDMA 4PLOB 4NZUH 5EC2A 4OCWH 4FTVE 4DKDC 3FB7A 3V7AG 1T66D 2LU3A 2Y7QA 5TFSH 4UT6L 3RZCC 1FVCB 1ZTXH 4HLJA 5IW3A 3LKNA 1ZLUK 2CDEA 4M6NH 5DUPL 1P4IL 3BDBA 3QUYD 2PCPB 2IGFH 1QP1A 1LDPH 3GMPB 1RUAH 4OTXL 4RDQG 5TQ0L 1U92A 2X5PA 1DTUA 2D7TL 3PL6A 2AK4E 1MJJB 3NIGF 3LEYH 5D93C 4KK8C 2VO5A 4YLQT 2ERJC 4HBQA 1HQRB 1IE5A 3ARPA 3PHQB 1EBPA 4WHDA 1RZ7H 1MHPH 2BNRE 1N2RB 5E2VH 3L3IB 3QG7L 5TPWH 4U6HA 3KPNA 5DJAA 4AMKH 4N0YL 2DQCH 3D87B 3W82A 4J1UB 1A7PL 1IFHL 1MFEL 2YZ8A 2Y36L 3WUWB 1NEZB 3KPLB 1IGYB 1S8DB 4M9PA 3O45B 1U8MA 4JM2A 3QEHB 1FFNA 4JLRB 1F4WH 4HUVA 4L8SC 3MA9L 3BT2L 5IVOA 2MCPL 1IGMH 3IF1A 1KPUA 4LNRA 3SDAC 1EBAA 1N0LA 1HSBB 4Z9KB 2YBRB 2GTWA 1BECA 2V17L 1ZHBB 1U2HA 2V5MA 1OSPH 2NY2B 3MXWL 2DJUA 2R0WH 4ELMB 1U3HD 4FP8L 2HH0H 2UWEE 3ARDB 1EMTL 2QLVB 5KSBA 4A6YH 5I1DA 4UMGA 4P2OB 4NRZA 3JZ7A 2WINB 1G7QA 3P2TA 4Y2DB 2AGJH 2W0FB 2XWJA 3JWDL 4U1SA 3SJVE 3HI1B 5DD3L 4YDVB 5C0CA 5SX5H 1BQSA 3KJ6H 1JZ4A 2QQKL 3QJHB 4NKDB 2ITCB 5HJ3B 4CU8A 32C2A 3R06B 1WZLA 4LCIH 1QVOA 2P5WD 2Q3AA 4L1HA 5IB2B 3T04D 5GRJH 1BZ9B 4XZUB 2VLKB 2FO4A 4IM8A 4JJ5B 4NZJA 2NXYC 4M1GH 5DXWA 2A77H 1FO0B 1QD0A 3O6ML 4YHLL 1VACA 1ZLUH 1OB1A 5FYJD 1WWAX 3NVQA 4G8FA 3X13A 5JW3H 4Q58C 3LEVL 2A0LD 1O0VA 2EH7H 4UINH 1I9IH 3S36X 3MJ6A 3B9EA 4IRZH 4ZAKC 5L6YL 3NAAH 2QSVA 4KQ3L 1XZ0B 5D71H 5DJ8A 5JXEC 2DLTA 2XZZA 1AGEB 1GHFL 2W9EL 2X4PA 3L3HA 4U1MA 1U91A 1CXFA 4RNRA 3S8WA 1MAKA 3BD5A 5CJBA 3JV0A 4FTVD 4G43A 4QRRB 4HHAA 4WUUA 1WBYA 2BFVL 5D70L 3MLVH 4G6JL 3REWA 3TESA 5DQDL 1A9BA 5F7HA 2XXMB 5JO5B 3BVNB 1CCZA 1HCFX 2XKNB 3TJEL 2P8PA 2IPUG 1ORQA 3DVGA 4CADA 4HK3N 5CMAA 4N5EC 2VDML 4OQTA 5I18L 1EK3A 3DV4A 4OZIB 1X5KA 2A9MH 3KPPA 4I5BA 3LCYA 4Z95L 5T1KD 3OKYA 5E95B 5FUOH 1F11A 1LD9B 2BNRD 1D7FA 2KZWA 3S88H 3LPGA 3VWJB 3LKPA 4NPYB 3Q6FA 1UACH 4LPTA 1AY1H 4AEIL 5IEHA 4H26A 1ZA3A 2X4NB 1A14H 1T03L 1AGFA 1OHQA 1FP5A 1XGUA 3BEWA 4HDIA 5F3BB 5DTFB 5FECB 2YN3A 1DLFH 1U8KA 5F9DC 3NACH 4U1JB 3MRDB 4HK0A 4OFIA 3TPUB 2IANB 4UDTB 3V6ZB 3EYSH 2EDXA 5IBLD 2Y6SD 3DROA 4CVWA 3JWNC 3QUYB 5T5FH 1UM6H 2W59A 4MMZC 5GQBA 2V7HB 5CZXC 5F89B 3OGCB 1VFBA 2ZCKL 3MLZH 4KHTH 4PB9L 5F1SA 3MREB 1BIIB 1KEGH 2OJEA 2F15A 3VDAA 1FVDB 4U33A 2X1QA 2VOTA 4XCYA 3WBDA 5IEKA 1NKRA 1SBBA 1C5BL 2K9UA 4O51A 2R56L 5E2WH 3SJVD 1VESA 1MWAA 1XCQA 3F7YB 2E5EA 4O58L 3QUXC 1V7ML 3PWNA 1WT5C 4NC1E 3RFZC 3RI5K 1AC6A 3DRTB 5F9WC 3S3PA 3GIVA 4NQSB 5DVNA 1YDPA 1IL1B 3OAUL 4HIEB 4K7PX 4OCMC 3VFSB 4JHAL 2HKFL 4KH2A 3MLUL 1P4BL 1K85A 1WFNA 4UILL 2X4QB 4N9GB 4QNPE 4MHHI 2R4SH 3GMRA 5IWLC 1JGLL 1GJIA 5HGDA 5E5MB 3HS0A 2HKHL 4YDLB 5IMLA 1U3HB 2BSRB 1FYTE 3E6HB 4LKXA 2WUBH 3HR5A 4KJQC 5SV4A 1QRKA 5FO8A 3SGKA 2EDHA 4N8CL 1CE6A 2WNGA 1KB5H 5IM7A 4QY8A 5GGSA 1CD1B 5FYLL 3O2WL 1S5IH 4OZGF 5SV3A 3TO4A 4R90L 5B8CC 5EU6E 3CVHL 4QT5A 4M7KH 2ATKB 1MEXL 1P84J 2P5WB 3MZTA 2F5BH 2DAVA 1IC4L 3QIWB 2AV1B 1TZGH 2R9HD 4MWFA 4X98B 4M43H 3GGWB 3FFCE 1BFSA 1BEYL 2ESVE 4X6CF 3RWDB 4FNLH 3BPNC 4KU1A 1WZ1L 5EZIH 3LKRA 5FGBC 4JG0L 4G8EB 1JNNH 3UTSA 4U7SA 2DQEH 1D3CA 4CVXA 1N4XL 2Y5EA 2ADGB 1U93A 4RISH 3RY6C 3WD5L 5I30L 2EXYC 1HHKB 1OW0C 3MV8E 1HXMA 5HGBB 4A2LA 4CU6A 2R0LH 1C12A 3ULUL 3RBGA 1FBIL 3JV4B 1AFVL 3RGVD 1TQBC 4X6DA 1F8TH 2A1WL 4NYLB 3KAAA 1EEZB 5JNYB 4Z7QE 1LO2H 3AFLA 5HYSG 3FAWA 1RUPL 4YHNB 4ZMAT 4FTVB 3HI6H 4WY7L 3HC4H 1BQHA 3EYUH 5ADOH 3BH8B 4XPFH 3HAEG 4EI5A 4QRSB 3R4DA 5T1MB 3P4LA 1YQ2A 5IMMB 3PV6B 2AP2A 4JPIB 1RV6X 5TE7H 4PJIF 1Z3GL 2VQTA 1ZGLB 2XG5A 2BSTA 1LK3H 4LU5H 1NUNB 3TJHD 1Q9WA 4PJ5E 3O41A 4RFNC 4MNHB 4E9LA 2AK4B 5T1KB 2WUCH 2W9DL 2NW2B 5K9KB 4B7LA 3BGFB 3HNSL 4RAVB 2BNRB 1SEQL 4WUKL 1MVUB 1P7KA 4CW1B 3IDIA 4BM7A 3O3DA 4IBLT 1A6AB 4MJ6B 1KNOA 1PJ9A 4KMTL 5JHLL 5F6HJ 3TV3H 3C6LA 4Y2OA 1QUNA 4PJBF 3IFLL 1Y18B 1HYRC 1OARH 2G75B 5J89A 4JZOB 5L8JB 4Q7DA 5D2LE 1KXVC 1X4XA 2L7JA 4XAKE 3RWGA 5EU5B 1IEHA 2WWKT 2QBWA 2JB5L 3IYLW 1IGCL 4ZQKA 5FCUL 1QBML 1BAFH 1A1NA 1RIVL 3K8KA 4LCWE 5ID1B 1WBXA 4ZSOA 4N1EA 2XFXA 4P23A 3HPJA 4PD4J 3MRKA 4ZOCA 4DTGL 2AXJA 1HDMB 4XVTL 1T2QH 1RPQA 2XG4A 2HRPH 1F00I 2OQJA 2HFEA 2UWEB 1Y6MR 1DN0B 5DC4B 4LBEA 5D1XC 5BV7H 4TNVK 4F8TA 4DN4H 2IEPA 2FL5A 1NPUA 5HXMA 5GISH 4FFWD 2YPLA 2AKRB 3SJVB 4F9LC 5LGHL 4YDJB 2H6PB 2YD5A 4BH7A 3D3VE 4HJ0C 3SE3C 2XN9E 3WLBB 3C60C 2BK8A 2WIIB 3SN6N 3GI8H 3GMQB 3M45A 3RNQB 5I66A 1IGTA 4YDKH 4Q97A 5F7MC 4L3CB 5EOCL 3VG9C 4Q9BA 3SDYL 1U8OA 3MJ9L 2OX5A 5DHVH 1I1AC 1EXUA 5HVHC 3W9EA 3WJJA 2QQLH 1VCAA 2WANA 2L4OA 1KC5L 4GS7C 3H9HA 3MTRA 4OZHA 4J3UA 5I6XB 3MRNB 1TQCB 1SBSH 3WS3A 2FZ3B 3VA2C 3EYOA 3DI3B 1KN2H 3VH8G 2W60B 2XRAH 3VXSA 4P2QE 5HHXL 5B21A 2VAAA 3ZDZE 2XV6B 5CSZB 2P8LB 1BFOB 1HXYB 1JVKA 3ILPA 4UOW1 1IEBB 3EO1B 3UYRH 4PY8I 3TYFA 3QISA 3ARGC 2PTTB 2A6DA 2WP3T 4XPGH 1XF1A 1LWRA 3IFPB 4CMHB 4LRNL 2EYTB 5E8NB 5JQHC 4X4XA 1RZGA 4PJXF 4RA0C 4UQ3B 1R3LA 1MY7A 5FFLA 4KUZH 3UTPD 3BEVA 3MOAL 4U1LA 5DA0B 5GS1C 3X3GH 1R3KB 1T1XB 4LLYA 2DOCA 4YXKH 4HKJA 3H0TA 1R6VA 3MMEB 4MNQA 1CD9B 1PZ5B 1HH6B 3L7FB 4PJ5D 3STLB 2V5SA 1OT2A 2EH8L 5GGQH 2DQJL 5H2BA 1RUML 4GXUM 1VADB 4O9HL 1OAUH 3KLSA 2OLDA 1E28B 5D9SA 1AE6H 1OTTD 3MRFB 1P1ZB 4MAYC 1S78D 2V5TA 3RGVB 5EULV 1LO3L 4PR5B 1S9XA 4PB0H 1OCWL 1Z6JT 3U0WH 2Q7YB 4OB5L 1OTUD 3T0XA 4HH9B 3RKDC 1W2KT 3LS4H 2XPGB 4NQEE 4WW2F 5C1MB 3NCJL 3FOMA 4Y4KD 4XAKD 3W9DB 4E42B 4JPVL 1QLFB 5HDLA 5I16B 2J5LC 2W91A 4HLZH 2CO6B 4KHXH 1JPGB 3SDXE 1JPTH 4I77H 3RAJL 4NM4H 3NPZB 4JFPA 5IMOB 1NCUA 4D0CA 3VI4F 4OF3A 2D31A 4PJ9D 1WFUA 5JXAL 4U6VH 1IEAA 3MRMA 1OP5K 3PWVB 4XBPB 4RZCB 3CFEB 4NCC2 1WCBA 2BVOA 4UAOC 3GSXA 2PXYA 4YFLI 5C8JA 1U6AL 1DBML 3VG0H 1H3TA 3B9AA 2ZUSA 5BRZA 1BVKA 1LE9A 1UB6A 3F7PC 3GIZL 4HG4J 3F7VB 2H41A 2YWYA 1ZT7A 3KPOB 1KEML 3F6LA 5MEPB 4RSVA 2Z8RA 1N59A 1JGUH 5IVXE 2IMMA 4KRLB 2H32H 3ZE0E 4X5WA 2IWGA 1KBGH 2XN9D 2Z35B 3VMPA 4JRYE 4E5XB 4QHNB 4C56E 2Q86A 1UZ6E 2DTML 3OPZH 3LH2H 4M6AA 2EDWA 2OTUB 3BP6B 4OLVL 1GGCH 1FIGH 2IADA 4N0UA 5ALCH 5EFIA 3HMXL 1IQDB 3GSOA 2VXTH 1E4XL 4F58L 2NY1B 5EZJA 3GMMB 1MCHA 3K1DA 5I73C 4XRCA 4HX1B 1NMBH 1SJHA 2E6PA 4YEEA 3VE0B 5DS8B 4NP4L 1FYTB 5JA9A 4WGWB 4DUVA 3CDFA 3REVB 1T4KA 4DFHA 1GIGH 3MV9E 4P2QD 5ILTL 2NR6C 2LV4A 2XNAB 3GMNB 5IJVB 1FNLA 1FVCA 1R3JB 3QHFH 1WLHA 4PJAF 3ULUF 5DJZB 5J8OA 1S9YB 4HF5L 4NQCA 4YE4L 5GS0D 2PCPA 3PJSB 4K7PL 1D5IH 1CFQB 3SGJC 1VFAB 3UP1A 4G6KL 3U7AA 4HWEL 4TN9A 2GIYA 4K8RL 1HQRA 3MCLL 3WIHH 5F88B 5K9JL 2R2BA 1I8IB 2VISB 3GMOB 1OP5H 2VC2L 3IFNL 3X12B 1CIUA 3N06B 3EOTL 1L7TL 3QNYA 1OPGL 1BD2E 4MAUL 3VGEA 2W38A 2Y06H 4FG6D 4J1UA 1OP3K 4Z7OE 1NBYA 1FAIH 3CVIH 3MV8B 1A9EB 1OQXA 3WUWA 1NEZA 4JO1L 4P4KD 3KPLA 4P48A 4IIQC 3NGBB 3BN9C 4AM0B 4JFDA 1X5ZA 1LNUB 5KVGL 3O45A 1LEKB 5E8PB 5GGRY 2EE9A 1D9KC 3QEHA 1AO7E 1EHLL 1ZVHA 4NFBA 4JLRA 3DV6B 2DL2A 3WV0A 5AZ2L 4CVUA 1GPOL 3EDFA 3S5LA 3V52L 1S7SB 1J1OH 1IKNA 3ARED 4KJYB 4XXDA 1HSBA 3W0WE 3RWJB 4AZ8A 5IHLB 1ZHBA 5FUCC 1HI6B 3NA9H 4XH2B 5IV2B 4ELMA 3ARDA 5FM4A 5D7KE 2H1PH 5HVWA 1N7ML 2EE2A 4PJ5B 4P2OA 2OZ4H 1AHWC 1VA9A 1B2WL 2NY7L 3KPRD 4FQ2L 1QBLH 4PGZA 2WINA 3S4SG 4Z0XB 4Y2DA 2A6KB 2J4WL 2W0FA 5GJTH 4V1DD 3HI1A 4YDVA 3VXUE 4PGDB 4N90E 3JXAA 3NFSH 3BX7C 3RX7A 2OSLB 3RUGE 3WFEH 2W9LA 1ZWIB 3QJHA 2ITCA 5HJ3A 5D5MF 5AG8A 5AZEL 3R06A 4FQXB 3RWHA 4OD1L 4ZO6A 5IB2A 2E6JA 2XTJD 4HAGA 3L3OB 1D6VH 4P9HC 1FO0A 3G9VA 4JRYD 3HE6C 5D2LB 4C56D 1MHCB 4Y4KB 3UJJL 3EO9H 1NGPL 5JW4Q 1V3KA 1QFWI 5HHNB 5IHBA 4NZTL 4XPAL 4OLZL 1UGNA 1ITBB 5CAYB 3A6OA 2X41A 1TMCB 1HZHL 4PJ9B 4TPRL 4XVUC 4LCWB 2GT9A 4QHMA 3S35H 1AGEA 4OZFG 1K6QH 4RMUA 5F6IC 2AVGA 2FRGP 2HLFD 3CSPA 3E3QE 5D6DA 3SKUD 4HUUB 1KLUA 3BKYL 4HFUL 3L5WB 3BYYA 3ZKMD 2ED7A 1CGVA 1H8OA 2R2HB 3MV9D 3HUJB 2VLLB 4XPHH 4Z7NE 3C6SB 5EWIL 3LMJH 4U1KA 5JO5A 2PN5A 3BVNA 3QB7C 4FFYL 2XKNA 4PJFF 4ELKB 2XN9B 1QEWA 5FEBA 4JGUA 4YXHL 1KJ3H 4L3EA 2QQNL 1CDYA 4IOFC 3I84A 3VWKD 5JW4R 4JDTH 2AJYL 3WO4B 1T1ZB 4OZIA 4EI6A 1GCFA 2HRLA 1IJ9A 5I15H 3MLWL 4JFHE 3V4PH 3W2DL 3UXFA 2ZNXA 3BSZL 5DQJB 4ORZC 4S2SB 1C7SA 4LRIC 3T0VA 3VGDA 1NLBL 1Q1JH 3HRPA 1EHXA 2OL3B 3VWJA 4NPYA 1BD2D 1ZVSB 4IDJL 1T83A 1FZJB 4JFEE 4YBLB 4HWBA 2DYPB 1TITA 3VW3H 2HTKC 3QQ4B 2X4NA 3ELAT 3G5VB 4P2QB 1ZKAA 1HQ4A 5F3BA 5DTFA 5C92A 2HN7B 4YHOL 4XWOD 3TM6A 4ZODA 1CE1H 1CD0A 2NXZC 4UDTA 3V6ZA 1KIUA 5EH1A 4JY6B 1WBZB 5K9OB 1QKZL 1WVZA 1BJ1H 2ICCA 3HZMB 3KYKL 3NABL 3ROOB 3W0WD 3VFRB 4P3CH 3I2CH 3BGAA 1ACZA 3MREA 1BIIA 4M5YH 3OKEB 1F3JB 4DN3H 1AGCB 4RAHA 4HZLB 5I71C 1VB9A 1IAII 1DFBH 3MGAA 4OCXH 3VXUD 4N90D 1C8PA 3F7YA 3TGXA 3P4MB 4P4KB 3IDNA 3MYJA 1YNLH 4TUOA 4AEHL 2DIJA 3HNTL 1HCVA 3DRTA 3D39E 4NQSA 1KJ2H 3KYOB 4HIEA 3VFSA 3O8XD 5BOZG 2RGSA 5J06A 3GKZA 3PGCB 3AREB 4RMWA 1S7XB 5E6YA 3ES6B 3O9WC 4XBGB 1RZKH 4J12A 3ABZA 2R1YB 5DMIL 1EDQA 1KCSH 1U3HA 2BSRA 3E6HA 2CD0A 4FZ8H