1SYQA

Human vinculin head domain vh1, residues 1-258, in complex with human talin's vinculin binding site 1, residues 607-636
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
259
structure length
259
Chain Sequence
HMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords vinculin isoform VCL
publication title Structural basis for amplifying vinculin activation by talin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 109
structure length 259
sequence length 259
ec nomenclature
pdb deposition date 2004-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1syqA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1syqA01
2B0HA 3T6GB 2L7AA 4K1OA 4E18A 2IBFA 5L0FA 1DOWA 1U6HA 1ZVZA 1RKEA 1XWJA 1U89A 2X0CA 4ONSA 1RKEB 1DOVA 3H2VA 1SYQA 1ZW2A 1L7CA 3S90A 4DJ9A 5L0IA 3RF3A 1TR2A 1T01A 1QKRA 4EHPA 2LQGA 5L0CA 1ZW3A 1YDIA 4P9TA 3TJ5A 5L0DA 3H2UA 3ZDLA 1H6GA 3VF0A 5L0GA 2GWWA 5L0HA 4PR9A 3TJ6A 2HSQA 3MYIA 4W8PA 5L0JA 4IGGA 1ST6A 4E17A 2GDCA 1RKCA 5FZTA
chains in the Genus database with same CATH superfamily
2QTVA 3C8GB 3IQ6A 4AL1A 3U2MA 1ZYRF 4E18A 2IBFA 3DM5A 4OINF 4R32A 2EPLX 1YVIA 1MMGA 2H7VC 3LNMB 3NYLA 3TQOA 4AL0A 3HNLA 2KJGA 1E2XA 3AQBA 2FAPB 1J8MF 3ABKC 1JRAA 3OA1A 4MW8A 1QZXA 4YT8A 3LEOA 3GANA 4KI2A 3RQGA 4CS7A 4CS8C 3UMIA 3QVZA 1V74B 2KYHA 4XEVA 3R7CA 5DS6A 4K7BA 3DAGA 1HMDA 1M56C 4XPXA 4XLPF 3UNGC 5L0GA 3NKDA 5BQIA 1L3PA 4PR9A 4BPMA 3B9QA 1JOGA 3B29A 1BBHA 3N0TA 5A69A 5DS5A 2ZPAA 1J8YF 3NKEA 3QVYA 4LDKA 1RJ9A 1ZHTA 3JSZA 5FCLA 3T6GB 2LIGA 2OJQA 2PFDA 2VC9A 4EWCA 5B1BC 4KNVA 3POVA 3DKAA 3NYMA 1TWAA 3FAJA 4IRUA 3B0PA 3QW1A 4J7YA 1YYXA 3G50A 3C18A 2J7PA 4CJOA 3EFOB 1NSGB 2W4MA 3M15A 3VRCA 4AE4B 4CIHA 5L0IA 4NQFA 3X1OA 2YWAA 2XLEA 5EK0A 1CPRA 1Q0KA 1Z6AA 3DXJF 1VYKA 4OD4A 4E0HA 3L34A 5B3IA 5L0DA 2CDQA 1G5ZA 1M2VA 2QUPA 4MNDA 4U5EE 3M1CB 1VTMP 2OEXA 1HE9A 2YZSA 2XLDA 2DGJA 2R05A 5AGFA 1ORSC 2L81A 4CBEA 2H8AA 2HSQA 3EHMA 4ULWA 4XPWA 5F28E 5L0JA 4MVZA 3LNRA 4F4BA 1WGWA 3C8ZA 3C7JA 3TULA 3RIPA 4JCHA 1HW2A 1Q0FA 1NFNA 3HNJA 3ASOC 1Z23A 2R7QA 3EH2A 5COMA 1E85A 2KC3A 4C3DA 2XRHA 5KYUA 4MVOA 4NTFA 1NZEA 4WABA 1EKYA 3EZHA 3SZRA 1O3UA 1OKKA 2R7OA 1TFOB 2IOQA 1LVKA 4CSAC 4LERA 3V5XA 1TFKB 2NUPA 2A68F 2V26A 1YDIA 3GEHA 5D91A 1YYJA 5HSWA 2X51A 2GFHA 5CI8A 2XL8A 4C3BA 5L0HA 1C17M 1FMVA 3DI5A 4YN0B 2WZLA 3SXYA 4H54A 1FTSA 2W4BA 3SXKA 4JTCB 2QNLA 4EIYA 4YK5A 2Y3HA 1MNEA 1A41A 5F5HA 3AGTA 3ZTZA 1W2WA 2L7AA 2H7OA 5JVEA 3K33A 2EILC 2B0JA 1LS4A 3EGXA 1LPEA 3EG9A 2WZFA 1D1BA 2UUHA 4G0HA 1RKEB 4NTAA 2YQYA 2ETSA 3GODA 2Q9AA 1FR0A 4IARA 4G7OF 1BR2A 3U8PA 1QSPA 4OIOF 4U5GA 3L8IA 2IXOA 2HJ3A 2WL8A 2A6EF 3EZIA 4YT4A 1K04A 2J7PD 4EBBA 2I8BA 2P61A 1T6QA 4XWJA 5E33A 3S84A 3WG7C 2HMQA 3Q7LA 4DXWA 3UMKA 4HFKB 5JLIA 3A9CA 4YT5A 2HSBA 2R7WA 1I5NA 4CDYA 3RVZA 4GQHA 5AC4A 3NYJA 3K1HA 4PJLA 4U5HA 1Z5ZA 1V4AA 4K1OA 3UR3C 4LDQA 2R7VA 1CPQA 3DWWA 1SR2A 1M2OA 1XWJA 1U89A 4E0IA 2R7RA 3MX3A 3ZQYA 5JS5A 2HUJA 1FFTC 1GQAA 3OEOA 1I4ZA 2Y39A 3ASNC 5K0IA 3F47A 2FFHA 3N24A 3HNKA 4WGZA 2M4EA 3WHNA 4DJ9A 3GM3A 3LESA 4O6YA 3U8VA 3SYNA 1HE1A 4A4AA 3ZIBA 4ZLCA 5EHHA 3RQFA 1KTMA 1NLXA 4KNWA 2NUTB 5E2QA 2EIJC 1OW8A 3MYFA 3IQ5A 4JJFA 3CEXA 2YL3A 5DVWA 4KC9A 3GWNA 4W8PA 3RKOF 3LUTB 3KMIA 4PK4A 3SP1A 4IGGA 4Q4ZF 3N2ZB 1ST6A 3DJNB 5T3WA 3FVYA 4YL1A 1Y6DA 1IZMA 2C03A 3F46A 4FX5A 5E3AA 3T9OA 3AG4C 2LP4A 4MTOA 4U5DE 4XEFA 2HS5A 4M63A 3IHUA 3AOUA 4DRHB 4YT2A 3IPMO 4CDAA 1IW7F 2VCBA 2XLVA 3L0IA 3ECSA 4J32B 4MQ9F 2EPOA 3S90A 1N1CA 2NSGA 3RF3A 1YAUO 1MNDA 3CAXA 2Q7RA 4OD5A 3EHNA 5JP7A 3KYJA 4P9TA 3ATPA 4CDVA 2UUIA 2BL2A 1T9KA 5HV9A 4AX2A 4EUKB 3PMRA 1OXKA 2LFFA 1LM3B 2AWCA 1NU7D 4MVSA 2GA0A 1SZIA 4N4WA 4C3EA 3K1IC 3L1MA 3LLKA 5FZTA 5B1AC 1PD0A 3S0XA 1LI5A 3LS1A 3DE8A 1OW7A 1VMAA 2KGOA 4NY3A 4I3MA 2D5RB 2EIKC 3U3FA 2DYSC 3U5SA 3ZSUA 3EPVA 2R02A 3EFOA 2L6FA 5KYXA 3RW0A 4MVQA 3AG1C 1FMWA 4DRJB 2DB4A 2G3VA 4HE8D 3T6JA 1E84A 4PJJA 4Z9IA 3J06A 1ORJA 2YLIA 4Z9HA 3FOPA 1JMWA 1KNYA 5T1DB 3W8IA 5EGYA 2CCYA 2I15A 4J30B 256BA 2VCCA 3C63A 3B71A 5D92A 3U9JA 4EBJA 3FAPB 1NG1A 1WN0A 2Y3GA 1H9GA 4I1OB 3PHF2 1YJGA 2OOCA 1T6IA 3T6BA 3UGPA 1UG7A 3Q6MA 2JPUA 3JT1A 2YLDA 1WOLA 3UGOA 1Z3IX 4G7ZF 2EPMX 1AUEA 2EINC 3DZAA 1RJ9B 3C8GD 3L8JA 2IM8A 3SXMA 4B6IA 4BJ5A 1G8XA 1HW1A 3HKKA 3K7DA 2X0CA 1RXQA 3K66A 3A11A 3JSEO 3NMIA 4JEBA 4Z9JA 1ZW2A 1A7EA 2EPNA 2H7BA 2P1AA 2XLMA 3AG3C 1L7CA 4JE9A 3JCUQ 4OIPF 1K40A 2CNWD 4WGYA 2J9WA 4ULVA 3U2LA 3GORA 1C02A 3JYYA 3ABLC 4MTGA 1ZHZA 4BEMJ 4DBQA 1OCZC 3TK0A 2LCHA 1JPJA 3QTHA 1M57C 1NBBA 1Q0MA 3KL4A 3RYLA 1V54C 3TJ6A 2FGYA 1YZAA 5A6KA 3C62A 1PV3A 2GAQA 2AWYA 4IWBA 1WTYA 4N06A 3KKBA 2PP4A 1QQ3A 3S27A 4CX9A 1E86A 3AJMA 1FAPB 4O6MA 3W8HA 4OIQF 1NU9C 3US6A 4D4XA 1FNTc 1YA9A 4ANJA 1APCA 3DAFA 5A6AA 4QDLA 1DOVA 3NMKA 2YLGA 2YRFA 1YZCA 2PX3A 3RFYA 4EKWA 3NRHA 3DJUB 5KYUB 2OG2A 3SEOA 4LLCA 4JIOA 2YKZA 5L0CA 5JT4A 2HJMA 2OKUA 3W2WA 4MTFA 3DD7A 2XM0A 1RMVA 4DRIB 3ZWIA 1ZZPA 5KYYA 3MYIA 1AEPA 4BJ5C 3EGDA 3RQEA 2LD6A 3LEVA 3RH3A 2KK1A 4JKVA 2XXAA 2MHRA 1CGNA 2Y3BA 1VYIA 4I44A 2OJED 2XLOA 2ASRA 1O5HA 1T6UA 1S7ZA 2WVOA 2KNHA 4MVUA 1Z7Qc 1CGOA 3OWTA 1Q0DA 1SYQA 3EGXB 4NCQA 3EG9B 2R7UA 3BRJA 3CQZA 1B68A 1D1CA 2ZXPA 2D4UA 3I4UA 3QMKA 5KYWA 1YA7O 1TR2A 1XZPA 4A2NB 4JEAA 1VK5A 2QLAA 1ZW3A 3TD7A 1BDJB 1ZU4A 3X2QC 1R4TA 3ZQVA 4PFPA 3VAYA 1LS1A 1H6GA 2NG1A 3VF0A 2GWWA 4CS8A 4DVYP 4LDRA 1BR1A 4O79A 2EIMC 1QLEC 2JX0A 3H65A 4JCZA 3GEEA 1Z63A 5L3VA 4N6CA 5DQTA 2XM4A 3C8GA 4BEJA 2F22A 4IJJA 1FFHA 3HLZA 2IXMA 2XLWA 1UFBA 4IAOA 4XTKA 1OR2A 2QY9A 3G4XA 1JAFA 3DE9A 3GM2A 3M4CA 3U0CA 3MBGA 2CNWA 4JRZA 4L6RA 5BQHA 2J0WA 3ZC4A 4ZLDA 2ZD9A 3LLIA 4JTAB 1LKXA 2RD9A 3KH2A 2W9YA 4YL3A 3U9MA 4LACB 4PJMA 4UDVA 4XPYA 1LE4A 2XLHA 4H4KC 2WB7A 3V5ZA 1C03A 2IYLD 1QKRA 2J8WA 4CS9A 4O7GA 4FESA 1VLTA 4U9DA 2G3KA 2A6HF 3S28A 3AG2C 2VB6A 1BZ4A 4RD9A 3TJ5A 2HMZA 3IQTA 4RDAA 4K0DA 1F1MA 3O55A 1Q0GA 1WASA 2CW0F 4PACA 2O9XA 4JW1A 4JJGA 1OCRC 1ORYA 4FAPB 3TOMA 2A1DD 2G62A 3M4BA 2GDCA 2IXNA 4BJ1A 1O87A 3JRTA 3FMSA 2B0HA 2CGEA 4KBLA 4MW3A 2EPKX 5BQGA 2ICWG 3V7OA 2L6GA 2RSEB 2XSEA 1PD1A 5CIVA 5JRAA 1EA8A 1TWHA 4ER9A 3LJBA 4DVZA 3DMDA 2TMVP 3VYWA 4P6IC 4W8KA 2AU5A 4AE4A 2XS1A 1CGME 3M79A 2XL6A 5A6BD 1QVXA 2R7SA 4QI2A 4G78A 2OCCC 4N6HA 1T01A 3LAYA 4C7OA 2A69F 4Q5SF 2J9VA 4P9FA 1EQ1A 1JR8A 2ZXRA 3WODF 2MYSA 1OCOC 3DM9B 4CSAA 1ZU5A 4IB4A 1OCCC 2R7TA 2XL4A 3ZG1A 3FDQA 1LIHA 4U9EA 5IY5C 3JYHA 5DLJA 2YL0A 4DOZA 2LSEA 3JZ0A 1H9TA 1D0XA 4E7ZA 3W4YA 1R5ID 1WATA 3JRMO 4HFFB 4WJ0A 5JSLA 3EQLF 3U3BA 5L0FA 3I5QA 5L3QA 1PCXA 5AC5A 2XS8A 2ZXOA 5DS4A 4CS9C 1MQVA 4GEHA 1TQGA 2PF4E 2PNOA 1V55C 1M6TA 3NMJA 4GYTA 4J7TA 4LLEA 4YJWA 3S9OA 4BJ6A 5KYXB 5BUOA 4MVMA 4G7HF 2R03A 3R2PA 3TOLA 3JTLO 2V3CC 3HTKC 1HY5A 1AVOB 3G4ZA 1H7IA 3KPHA 4YL0A 3H2UA 3HNIA 1YARO 3ZDLA 2Q9CA 3MLGA 4JTDB 1JPNA 3T4RA 4U5BE 3PDMP 3O10A 1M2VB 1XZQA 3CZ6A 1WWPA 3EH1A 4CIPA 2W45A 2KSFA 2LK4A 1TWCA 3FOOA 1D0ZA 1QPUA 4YWQA 2BE5F 2L6HA 3AQCA 4FWVA 1D0YA 1DOWA 1U6HA 1RCPA 2J46A 1RKEA 4PJNA 1ZHYA 3ITFA 4IAQA 3AGUA 3H2VA 2Q3TA 2HKVA 5DQZA 3RVYA 2R7XA 4JZAA 1D1AA 3E70C 4XLNF 4EHPA 2HZ8A 3GM1A 3LS0A 2Q9BA 1VLSA 1S05A 2BC5A 4AK9A 1K05A 2QE9A 3ABMC 1U0BB 2C04A 3MFNA 2NSFA 4MS2A 2DYRC 3IEEA 4RBNA 2R9RB 4E7SA 5KYNA 2NUPB 3PCVA 1GGQA 4HEAJ 5E3CA 1MMDA 2AP3A 5GPGB 1ZHXA 2Q4FA 1KU2A 2P6VA 2CYDA 2J9BA 3E9VA 4E17A 3FHDA 5CI9A 1OR3A 3HJCA 4D4NA 4BG0A 4X0RA 2MWQA 1G4US 2WVNA 1ZVZA 5A6BA 4NC3A 3B0VC 4XQ1A 2KQ9A 2OQMA 4BJ6C 1OXBA 2A0BA 2P0NA 5F5FA 5T3TA 4DBRA 2A0UA 2HV7A 1Y4CA 1VOMA 1OQCA 3SXZA 2YL1A 4NTBA 1LE2A 4QI0A 4PFOA 5JUAA 3W2VA 1EI7A 3UMHA 4I1MA 2LQGA 2WVQA 2NUTA 2PX0A 3NDBB 2AVKA 2J9UA 4U5CE 1SF8A 1VB5A 2YVKA 3NG1A 2DI3A 2J45A 2J0XA 2P7VA 4JURI 2Q00A 3SNHA 1BR4A 3Q7GA 1GM5A 1TKNA 5COFA 2WZGA 1G4WR 1TWGA 1MMAA 1T5OA 2Y69C 4JC7A 1GS9A 3KYIA 2OU6A 1RKCA 2JD3A 3VM6A 3WAQA 5KYYB 3GEIA 4O6NA 3EGDB 1HMOA 2R25A 2YL7A 4U5FE 4EBKA 2ZXWC 3BEHA 1LI7A 1I4YA 3K1IA 3S29A 2LFDA 2XXAB 4ONSA 3CSKA 2NPUA 3V5YA 5B3SC 1E83A 2HFIA 3B0UX 2PBEA 2KW3C 4C7OB 3EJNA 3Q6NA 5COGA 2M64A 2OEVA 2L9JA 3GWLA 2Y3DA 1OW6A 2VCAA 2VH3A 2YEVA 3FXHA 4JVSA 5KYWB 1A7DA 1MMNA 1OKKD 3QZCA 4XEKA 1NFOA 4CJGA 5A6JA 1SMYF 2YHSA 3ZVRA 2E87A 2Z15A 4Q7CA 4BJTA 1ZHWA 2VASA 3K6BA 1A7VA 3IQCA 3O6XA 2IXPA 4MVRA 2HV6A 3I5PA 1YLMA 3QW0A 5TJ5E 4OIRF 3ZTMA 3O39A 1A0BA
chains in the Genus database with same CATH topology
2B0HA 3T6GB 2L7AA 4K1OA 4E18A 2IBFA 5L0FA 1DOWA 1U6HA 1ZVZA 1RKEA 1XWJA 1U89A 2X0CA 4ONSA 1RKEB 1DOVA 3H2VA 1SYQA 1ZW2A 1L7CA 3S90A 4DJ9A 5L0IA 3RF3A 1TR2A 1T01A 1QKRA 4EHPA 2LQGA 5L0CA 1ZW3A 1YDIA 4P9TA 3TJ5A 5L0DA 3H2UA 3ZDLA 1H6GA 3VF0A 5L0GA 2GWWA 5L0HA 4PR9A 3TJ6A 2HSQA 3MYIA 4W8PA 5L0JA 4IGGA 1ST6A 4E17A 2GDCA 1RKCA 5FZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B0H A;  3T6G B;  2L7A A;  4K1O A;  4E18 A;  2IBF A;  5L0F A;  1DOW A;  1U6H A;  1ZVZ A;  1RKE A;  1XWJ A;  1U89 A;  2X0C A;  4ONS A;  1RKE B;  1DOV A;  3H2V A;  1SYQ A;  1ZW2 A;  1L7C A;  3S90 A;  4DJ9 A;  5L0I A;  3RF3 A;  1TR2 A;  1T01 A;  1QKR A;  4EHP A;  2LQG A;  5L0C A;  1ZW3 A;  1YDI A;  4P9T A;  3TJ5 A;  5L0D A;  3H2U A;  3ZDL A;  1H6G A;  3VF0 A;  5L0G A;  2GWW A;  5L0H A;  4PR9 A;  3TJ6 A;  2HSQ A;  3MYI A;  4W8P A;  5L0J A;  4IGG A;  1ST6 A;  4E17 A;  2GDC A;  1RKC A;  5FZT A; 
#chains in the Genus database with same CATH topology
 2QTV A;  3C8G B;  3IQ6 A;  4AL1 A;  3U2M A;  1ZYR F;  4E18 A;  2IBF A;  3DM5 A;  4OIN F;  4R32 A;  2EPL X;  1YVI A;  1MMG A;  2H7V C;  3LNM B;  3NYL A;  3TQO A;  4AL0 A;  3HNL A;  2KJG A;  1E2X A;  3AQB A;  2FAP B;  1J8M F;  3ABK C;  1JRA A;  3OA1 A;  4MW8 A;  1QZX A;  4YT8 A;  3LEO A;  3GAN A;  4KI2 A;  3RQG A;  4CS7 A;  4CS8 C;  3UMI A;  3QVZ A;  1V74 B;  2KYH A;  4XEV A;  3R7C A;  5DS6 A;  4K7B A;  3DAG A;  1HMD A;  1M56 C;  4XPX A;  4XLP F;  3UNG C;  5L0G A;  3NKD A;  5BQI A;  1L3P A;  4PR9 A;  4BPM A;  3B9Q A;  1JOG A;  3B29 A;  1BBH A;  3N0T A;  5A69 A;  5DS5 A;  2ZPA A;  1J8Y F;  3NKE A;  3QVY A;  4LDK A;  1RJ9 A;  1ZHT A;  3JSZ A;  5FCL A;  3T6G B;  2LIG A;  2OJQ A;  2PFD A;  2VC9 A;  4EWC A;  5B1B C;  4KNV A;  3POV A;  3DKA A;  3NYM A;  1TWA A;  3FAJ A;  4IRU A;  3B0P A;  3QW1 A;  4J7Y A;  1YYX A;  3G50 A;  3C18 A;  2J7P A;  4CJO A;  3EFO B;  1NSG B;  2W4M A;  3M15 A;  3VRC A;  4AE4 B;  4CIH A;  5L0I A;  4NQF A;  3X1O A;  2YWA A;  2XLE A;  5EK0 A;  1CPR A;  1Q0K A;  1Z6A A;  3DXJ F;  1VYK A;  4OD4 A;  4E0H A;  3L34 A;  5B3I A;  5L0D A;  2CDQ A;  1G5Z A;  1M2V A;  2QUP A;  4MND A;  4U5E E;  3M1C B;  1VTM P;  2OEX A;  1HE9 A;  2YZS A;  2XLD A;  2DGJ A;  2R05 A;  5AGF A;  1ORS C;  2L81 A;  4CBE A;  2H8A A;  2HSQ A;  3EHM A;  4ULW A;  4XPW A;  5F28 E;  5L0J A;  4MVZ A;  3LNR A;  4F4B A;  1WGW A;  3C8Z A;  3C7J A;  3TUL A;  3RIP A;  4JCH A;  1HW2 A;  1Q0F A;  1NFN A;  3HNJ A;  3ASO C;  1Z23 A;  2R7Q A;  3EH2 A;  5COM A;  1E85 A;  2KC3 A;  4C3D A;  2XRH A;  5KYU A;  4MVO A;  4NTF A;  1NZE A;  4WAB A;  1EKY A;  3EZH A;  3SZR A;  1O3U A;  1OKK A;  2R7O A;  1TFO B;  2IOQ A;  1LVK A;  4CSA C;  4LER A;  3V5X A;  1TFK B;  2NUP A;  2A68 F;  2V26 A;  1YDI A;  3GEH A;  5D91 A;  1YYJ A;  5HSW A;  2X51 A;  2GFH A;  5CI8 A;  2XL8 A;  4C3B A;  5L0H A;  1C17 M;  1FMV A;  3DI5 A;  4YN0 B;  2WZL A;  3SXY A;  4H54 A;  1FTS A;  2W4B A;  3SXK A;  4JTC B;  2QNL A;  4EIY A;  4YK5 A;  2Y3H A;  1MNE A;  1A41 A;  5F5H A;  3AGT A;  3ZTZ A;  1W2W A;  2L7A A;  2H7O A;  5JVE A;  3K33 A;  2EIL C;  2B0J A;  1LS4 A;  3EGX A;  1LPE A;  3EG9 A;  2WZF A;  1D1B A;  2UUH A;  4G0H A;  1RKE B;  4NTA A;  2YQY A;  2ETS A;  3GOD A;  2Q9A A;  1FR0 A;  4IAR A;  4G7O F;  1BR2 A;  3U8P A;  1QSP A;  4OIO F;  4U5G A;  3L8I A;  2IXO A;  2HJ3 A;  2WL8 A;  2A6E F;  3EZI A;  4YT4 A;  1K04 A;  2J7P D;  4EBB A;  2I8B A;  2P61 A;  1T6Q A;  4XWJ A;  5E33 A;  3S84 A;  3WG7 C;  2HMQ A;  3Q7L A;  4DXW A;  3UMK A;  4HFK B;  5JLI A;  3A9C A;  4YT5 A;  2HSB A;  2R7W A;  1I5N A;  4CDY A;  3RVZ A;  4GQH A;  5AC4 A;  3NYJ A;  3K1H A;  4PJL A;  4U5H A;  1Z5Z A;  1V4A A;  4K1O A;  3UR3 C;  4LDQ A;  2R7V A;  1CPQ A;  3DWW A;  1SR2 A;  1M2O A;  1XWJ A;  1U89 A;  4E0I A;  2R7R A;  3MX3 A;  3ZQY A;  5JS5 A;  2HUJ A;  1FFT C;  1GQA A;  3OEO A;  1I4Z A;  2Y39 A;  3ASN C;  5K0I A;  3F47 A;  2FFH A;  3N24 A;  3HNK A;  4WGZ A;  2M4E A;  3WHN A;  4DJ9 A;  3GM3 A;  3LES A;  4O6Y A;  3U8V A;  3SYN A;  1HE1 A;  4A4A A;  3ZIB A;  4ZLC A;  5EHH A;  3RQF A;  1KTM A;  1NLX A;  4KNW A;  2NUT B;  5E2Q A;  2EIJ C;  1OW8 A;  3MYF A;  3IQ5 A;  4JJF A;  3CEX A;  2YL3 A;  5DVW A;  4KC9 A;  3GWN A;  4W8P A;  3RKO F;  3LUT B;  3KMI A;  4PK4 A;  3SP1 A;  4IGG A;  4Q4Z F;  3N2Z B;  1ST6 A;  3DJN B;  5T3W A;  3FVY A;  4YL1 A;  1Y6D A;  1IZM A;  2C03 A;  3F46 A;  4FX5 A;  5E3A A;  3T9O A;  3AG4 C;  2LP4 A;  4MTO A;  4U5D E;  4XEF A;  2HS5 A;  4M63 A;  3IHU A;  3AOU A;  4DRH B;  4YT2 A;  3IPM O;  4CDA A;  1IW7 F;  2VCB A;  2XLV A;  3L0I A;  3ECS A;  4J32 B;  4MQ9 F;  2EPO A;  3S90 A;  1N1C A;  2NSG A;  3RF3 A;  1YAU O;  1MND A;  3CAX A;  2Q7R A;  4OD5 A;  3EHN A;  5JP7 A;  3KYJ A;  4P9T A;  3ATP A;  4CDV A;  2UUI A;  2BL2 A;  1T9K A;  5HV9 A;  4AX2 A;  4EUK B;  3PMR A;  1OXK A;  2LFF A;  1LM3 B;  2AWC A;  1NU7 D;  4MVS A;  2GA0 A;  1SZI A;  4N4W A;  4C3E A;  3K1I C;  3L1M A;  3LLK A;  5FZT A;  5B1A C;  1PD0 A;  3S0X A;  1LI5 A;  3LS1 A;  3DE8 A;  1OW7 A;  1VMA A;  2KGO A;  4NY3 A;  4I3M A;  2D5R B;  2EIK C;  3U3F A;  2DYS C;  3U5S A;  3ZSU A;  3EPV A;  2R02 A;  3EFO A;  2L6F A;  5KYX A;  3RW0 A;  4MVQ A;  3AG1 C;  1FMW A;  4DRJ B;  2DB4 A;  2G3V A;  4HE8 D;  3T6J A;  1E84 A;  4PJJ A;  4Z9I A;  3J06 A;  1ORJ A;  2YLI A;  4Z9H A;  3FOP A;  1JMW A;  1KNY A;  5T1D B;  3W8I A;  5EGY A;  2CCY A;  2I15 A;  4J30 B;  256B A;  2VCC A;  3C63 A;  3B71 A;  5D92 A;  3U9J A;  4EBJ A;  3FAP B;  1NG1 A;  1WN0 A;  2Y3G A;  1H9G A;  4I1O B;  3PHF 2;  1YJG A;  2OOC A;  1T6I A;  3T6B A;  3UGP A;  1UG7 A;  3Q6M A;  2JPU A;  3JT1 A;  2YLD A;  1WOL A;  3UGO A;  1Z3I X;  4G7Z F;  2EPM X;  1AUE A;  2EIN C;  3DZA A;  1RJ9 B;  3C8G D;  3L8J A;  2IM8 A;  3SXM A;  4B6I A;  4BJ5 A;  1G8X A;  1HW1 A;  3HKK A;  3K7D A;  2X0C A;  1RXQ A;  3K66 A;  3A11 A;  3JSE O;  3NMI A;  4JEB A;  4Z9J A;  1ZW2 A;  1A7E A;  2EPN A;  2H7B A;  2P1A A;  2XLM A;  3AG3 C;  1L7C A;  4JE9 A;  3JCU Q;  4OIP F;  1K40 A;  2CNW D;  4WGY A;  2J9W A;  4ULV A;  3U2L A;  3GOR A;  1C02 A;  3JYY A;  3ABL C;  4MTG A;  1ZHZ A;  4BEM J;  4DBQ A;  1OCZ C;  3TK0 A;  2LCH A;  1JPJ A;  3QTH A;  1M57 C;  1NBB A;  1Q0M A;  3KL4 A;  3RYL A;  1V54 C;  3TJ6 A;  2FGY A;  1YZA A;  5A6K A;  3C62 A;  1PV3 A;  2GAQ A;  2AWY A;  4IWB A;  1WTY A;  4N06 A;  3KKB A;  2PP4 A;  1QQ3 A;  3S27 A;  4CX9 A;  1E86 A;  3AJM A;  1FAP B;  4O6M A;  3W8H A;  4OIQ F;  1NU9 C;  3US6 A;  4D4X A;  1FNT c;  1YA9 A;  4ANJ A;  1APC A;  3DAF A;  5A6A A;  4QDL A;  1DOV A;  3NMK A;  2YLG A;  2YRF A;  1YZC A;  2PX3 A;  3RFY A;  4EKW A;  3NRH A;  3DJU B;  5KYU B;  2OG2 A;  3SEO A;  4LLC A;  4JIO A;  2YKZ A;  5L0C A;  5JT4 A;  2HJM A;  2OKU A;  3W2W A;  4MTF A;  3DD7 A;  2XM0 A;  1RMV A;  4DRI B;  3ZWI A;  1ZZP A;  5KYY A;  3MYI A;  1AEP A;  4BJ5 C;  3EGD A;  3RQE A;  2LD6 A;  3LEV A;  3RH3 A;  2KK1 A;  4JKV A;  2XXA A;  2MHR A;  1CGN A;  2Y3B A;  1VYI A;  4I44 A;  2OJE D;  2XLO A;  2ASR A;  1O5H A;  1T6U A;  1S7Z A;  2WVO A;  2KNH A;  4MVU A;  1Z7Q c;  1CGO A;  3OWT A;  1Q0D A;  1SYQ A;  3EGX B;  4NCQ A;  3EG9 B;  2R7U A;  3BRJ A;  3CQZ A;  1B68 A;  1D1C A;  2ZXP A;  2D4U A;  3I4U A;  3QMK A;  5KYW A;  1YA7 O;  1TR2 A;  1XZP A;  4A2N B;  4JEA A;  1VK5 A;  2QLA A;  1ZW3 A;  3TD7 A;  1BDJ B;  1ZU4 A;  3X2Q C;  1R4T A;  3ZQV A;  4PFP A;  3VAY A;  1LS1 A;  1H6G A;  2NG1 A;  3VF0 A;  2GWW A;  4CS8 A;  4DVY P;  4LDR A;  1BR1 A;  4O79 A;  2EIM C;  1QLE C;  2JX0 A;  3H65 A;  4JCZ A;  3GEE A;  1Z63 A;  5L3V A;  4N6C A;  5DQT A;  2XM4 A;  3C8G A;  4BEJ A;  2F22 A;  4IJJ A;  1FFH A;  3HLZ A;  2IXM A;  2XLW A;  1UFB A;  4IAO A;  4XTK A;  1OR2 A;  2QY9 A;  3G4X A;  1JAF A;  3DE9 A;  3GM2 A;  3M4C A;  3U0C A;  3MBG A;  2CNW A;  4JRZ A;  4L6R A;  5BQH A;  2J0W A;  3ZC4 A;  4ZLD A;  2ZD9 A;  3LLI A;  4JTA B;  1LKX A;  2RD9 A;  3KH2 A;  2W9Y A;  4YL3 A;  3U9M A;  4LAC B;  4PJM A;  4UDV A;  4XPY A;  1LE4 A;  2XLH A;  4H4K C;  2WB7 A;  3V5Z A;  1C03 A;  2IYL D;  1QKR A;  2J8W A;  4CS9 A;  4O7G A;  4FES A;  1VLT A;  4U9D A;  2G3K A;  2A6H F;  3S28 A;  3AG2 C;  2VB6 A;  1BZ4 A;  4RD9 A;  3TJ5 A;  2HMZ A;  3IQT A;  4RDA A;  4K0D A;  1F1M A;  3O55 A;  1Q0G A;  1WAS A;  2CW0 F;  4PAC A;  2O9X A;  4JW1 A;  4JJG A;  1OCR C;  1ORY A;  4FAP B;  3TOM A;  2A1D D;  2G62 A;  3M4B A;  2GDC A;  2IXN A;  4BJ1 A;  1O87 A;  3JRT A;  3FMS A;  2B0H A;  2CGE A;  4KBL A;  4MW3 A;  2EPK X;  5BQG A;  2ICW G;  3V7O A;  2L6G A;  2RSE B;  2XSE A;  1PD1 A;  5CIV A;  5JRA A;  1EA8 A;  1TWH A;  4ER9 A;  3LJB A;  4DVZ A;  3DMD A;  2TMV P;  3VYW A;  4P6I C;  4W8K A;  2AU5 A;  4AE4 A;  2XS1 A;  1CGM E;  3M79 A;  2XL6 A;  5A6B D;  1QVX A;  2R7S A;  4QI2 A;  4G78 A;  2OCC C;  4N6H A;  1T01 A;  3LAY A;  4C7O A;  2A69 F;  4Q5S F;  2J9V A;  4P9F A;  1EQ1 A;  1JR8 A;  2ZXR A;  3WOD F;  2MYS A;  1OCO C;  3DM9 B;  4CSA A;  1ZU5 A;  4IB4 A;  1OCC C;  2R7T A;  2XL4 A;  3ZG1 A;  3FDQ A;  1LIH A;  4U9E A;  5IY5 C;  3JYH A;  5DLJ A;  2YL0 A;  4DOZ A;  2LSE A;  3JZ0 A;  1H9T A;  1D0X A;  4E7Z A;  3W4Y A;  1R5I D;  1WAT A;  3JRM O;  4HFF B;  4WJ0 A;  5JSL A;  3EQL F;  3U3B A;  5L0F A;  3I5Q A;  5L3Q A;  1PCX A;  5AC5 A;  2XS8 A;  2ZXO A;  5DS4 A;  4CS9 C;  1MQV A;  4GEH A;  1TQG A;  2PF4 E;  2PNO A;  1V55 C;  1M6T A;  3NMJ A;  4GYT A;  4J7T A;  4LLE A;  4YJW A;  3S9O A;  4BJ6 A;  5KYX B;  5BUO A;  4MVM A;  4G7H F;  2R03 A;  3R2P A;  3TOL A;  3JTL O;  2V3C C;  3HTK C;  1HY5 A;  1AVO B;  3G4Z A;  1H7I A;  3KPH A;  4YL0 A;  3H2U A;  3HNI A;  1YAR O;  3ZDL A;  2Q9C A;  3MLG A;  4JTD B;  1JPN A;  3T4R A;  4U5B E;  3PDM P;  3O10 A;  1M2V B;  1XZQ A;  3CZ6 A;  1WWP A;  3EH1 A;  4CIP A;  2W45 A;  2KSF A;  2LK4 A;  1TWC A;  3FOO A;  1D0Z A;  1QPU A;  4YWQ A;  2BE5 F;  2L6H A;  3AQC A;  4FWV A;  1D0Y A;  1DOW A;  1U6H A;  1RCP A;  2J46 A;  1RKE A;  4PJN A;  1ZHY A;  3ITF A;  4IAQ A;  3AGU A;  3H2V A;  2Q3T A;  2HKV A;  5DQZ A;  3RVY A;  2R7X A;  4JZA A;  1D1A A;  3E70 C;  4XLN F;  4EHP A;  2HZ8 A;  3GM1 A;  3LS0 A;  2Q9B A;  1VLS A;  1S05 A;  2BC5 A;  4AK9 A;  1K05 A;  2QE9 A;  3ABM C;  1U0B B;  2C04 A;  3MFN A;  2NSF A;  4MS2 A;  2DYR C;  3IEE A;  4RBN A;  2R9R B;  4E7S A;  5KYN A;  2NUP B;  3PCV A;  1GGQ A;  4HEA J;  5E3C A;  1MMD A;  2AP3 A;  5GPG B;  1ZHX A;  2Q4F A;  1KU2 A;  2P6V A;  2CYD A;  2J9B A;  3E9V A;  4E17 A;  3FHD A;  5CI9 A;  1OR3 A;  3HJC A;  4D4N A;  4BG0 A;  4X0R A;  2MWQ A;  1G4U S;  2WVN A;  1ZVZ A;  5A6B A;  4NC3 A;  3B0V C;  4XQ1 A;  2KQ9 A;  2OQM A;  4BJ6 C;  1OXB A;  2A0B A;  2P0N A;  5F5F A;  5T3T A;  4DBR A;  2A0U A;  2HV7 A;  1Y4C A;  1VOM A;  1OQC A;  3SXZ A;  2YL1 A;  4NTB A;  1LE2 A;  4QI0 A;  4PFO A;  5JUA A;  3W2V A;  1EI7 A;  3UMH A;  4I1M A;  2LQG A;  2WVQ A;  2NUT A;  2PX0 A;  3NDB B;  2AVK A;  2J9U A;  4U5C E;  1SF8 A;  1VB5 A;  2YVK A;  3NG1 A;  2DI3 A;  2J45 A;  2J0X A;  2P7V A;  4JUR I;  2Q00 A;  3SNH A;  1BR4 A;  3Q7G A;  1GM5 A;  1TKN A;  5COF A;  2WZG A;  1G4W R;  1TWG A;  1MMA A;  1T5O A;  2Y69 C;  4JC7 A;  1GS9 A;  3KYI A;  2OU6 A;  1RKC A;  2JD3 A;  3VM6 A;  3WAQ A;  5KYY B;  3GEI A;  4O6N A;  3EGD B;  1HMO A;  2R25 A;  2YL7 A;  4U5F E;  4EBK A;  2ZXW C;  3BEH A;  1LI7 A;  1I4Y A;  3K1I A;  3S29 A;  2LFD A;  2XXA B;  4ONS A;  3CSK A;  2NPU A;  3V5Y A;  5B3S C;  1E83 A;  2HFI A;  3B0U X;  2PBE A;  2KW3 C;  4C7O B;  3EJN A;  3Q6N A;  5COG A;  2M64 A;  2OEV A;  2L9J A;  3GWL A;  2Y3D A;  1OW6 A;  2VCA A;  2VH3 A;  2YEV A;  3FXH A;  4JVS A;  5KYW B;  1A7D A;  1MMN A;  1OKK D;  3QZC A;  4XEK A;  1NFO A;  4CJG A;  5A6J A;  1SMY F;  2YHS A;  3ZVR A;  2E87 A;  2Z15 A;  4Q7C A;  4BJT A;  1ZHW A;  2VAS A;  3K6B A;  1A7V A;  3IQC A;  3O6X A;  2IXP A;  4MVR A;  2HV6 A;  3I5P A;  1YLM A;  3QW0 A;  5TJ5 E;  4OIR F;  3ZTM A;  3O39 A;  1A0B A; 
#chains in the Genus database with same CATH homology
 2B0H A;  3T6G B;  2L7A A;  4K1O A;  4E18 A;  2IBF A;  5L0F A;  1DOW A;  1U6H A;  1ZVZ A;  1RKE A;  1XWJ A;  1U89 A;  2X0C A;  4ONS A;  1RKE B;  1DOV A;  3H2V A;  1SYQ A;  1ZW2 A;  1L7C A;  3S90 A;  4DJ9 A;  5L0I A;  3RF3 A;  1TR2 A;  1T01 A;  1QKR A;  4EHP A;  2LQG A;  5L0C A;  1ZW3 A;  1YDI A;  4P9T A;  3TJ5 A;  5L0D A;  3H2U A;  3ZDL A;  1H6G A;  3VF0 A;  5L0G A;  2GWW A;  5L0H A;  4PR9 A;  3TJ6 A;  2HSQ A;  3MYI A;  4W8P A;  5L0J A;  4IGG A;  1ST6 A;  4E17 A;  2GDC A;  1RKC A;  5FZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...