1SZCA

Structural basis for nicotinamide cleavage and adp-ribose transfer by nad+-dependent sir2 histone/protein deacetylases
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
296
structure length
291
Chain Sequence
b'MASMSVSTASTEMSVRKIAAHMKSNPNAKVIFMVGAGISTSCGIPDFRSPGTGLYHNLARLKLPYPEAVFDVDFFQSDPLPFYTLAKELYPGNFRPSKFHYLLKLFQDKDVLKRVYTQNIDTLERQAGVKDDLIIEAHGSFAHCHCIGCGKVYPPQVFKSKLAEHPIKDFVKCDVCGELVKPAIVFFGEDLPDSFSETWLNDSEWLREKITTQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVGDFKANKRPTDLIVHQYSDEFAEQLVEELGWQEDFEKILTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent deacetylase HST2
molecule tags Gene regulation
source organism Saccharomyces cerevisiae
publication title Structural basis for nicotinamide cleavage and ADP-ribose transfer by NAD(+)-dependent Sir2 histone/protein deacetylases.
pubmed doi rcsb
total genus 96
structure length 291
sequence length 296
ec nomenclature ec 3.5.1.-:
pdb deposition date 2004-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 1szcA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1szcA01
1O97D 4JU8A 1YI0A 5EJ4A 1Q17A 2EZUA 1M2GA 4GPEA 2VBGA 3D4BA 4BVGA 2H2GA 2IHUA 4JUCA 3U31A 2H4FA 5EJ9A 4BN5A 3GLSA 1HZZC 2AG0A 3OE1A 3K35A 2VBIA 4UTXA 4KXQA 4BVHA 4C78A 4K9KA 4BVBA 4F4UA 4UTNA 5MGNA 1U28C 1PVDA 4MPPA 4G1CA 3ZGOA 4TWIA 4RMGA 4UU7A 4MZXA 5K2OA 4Y6LA 3HWWA 3ZG6A 2FSVC 4D5EA 3GLRA 2QQFA 1M2HA 2UZ1A 5EJMA 1YI1A 4QQ8A 5EJ6A 2UZ1B 2NXWA 5FYQA 1YHYA 4IF6A 4GG1A 4F56A 1SZCA 1PTJC 3CLRD 3ZGVA 4UUBA 1UPAA 2BRUC 2EZTA 5EJ5A 1Q14A 1NM5C 1EFVA 1ZPDA 2JI9A 1SZDA 3U3DA 1M2NA 5EJ7A 1BFDA 3EYAA 4JT9A 1UPBA 1XLTC 2C31A 4GM4A 4GP9A 3EY9A 4COKA 1YHZA 3FZNA 4I5IA 1U2GC 4Q9DA 2OORC 2IHTA 3CLSD 3RIGA 5BWLA 4UUAA 4UTRA 4UU8A 1EFPA 1M2JA 1OZFA 3EA4A 3IAEA 4MQ5A 5MFZA 1YBHA 1YTLA 4MPRA 4Y6QA 2JI6A 2Q5OA 5AHKA 3FSJX 4K9NA 1JSCA 4BV2A 1UPCA 3JWPA 1E3TA 1V5FA 1Q1AA 1YNOA 5MFPA 2OD7A 5D7NA 5BWNA 2A1TR 2OO5C 1Z8NA 4UTVA 5DGDA 4JUFA 5DEIA 1O96B 4Y6OA 3JR3A 4QPZA 4IG9A 2VBFA 2HJHA 4K9MA 4BN4A 2WVGA 4K9PA 4QELA 5MF6A 3D7KA 1PNQA 2Q27A 1POXA 3CLUD 4K9OA 1ICIA 2PGOA 2EZ4A 4V1CB 4FZ3A 1V5EA 4GM1A 4K9LA 4BVFA 4RJKA 3PKIA 3CLTD 1T9CA 1PI3A 1QPBA 2EZ9A 4O8ZA 2Q28A 4V1CA 3FLMA 1V5GA 4RJIA 4GM0A 2H4HA 2H2HA 4JSRA 2PGNA 4JUAA 1Q6ZA 5IMSA 4J1TC 1D4OA 4IAOA 4V1CI 4ZP1A 1YC2A 4KPUA 5DGTA 1M2KA 1OZGA 1S7GA 2Q29A 1S5PA 2FRDC 5K6TA 2NYRA 5EJAA 4X3OA 4C7BA 3HWX1 4L3OA 1PO7A 1U2DC 4RMIA 4HDAA 2FR8C 1J8FA 3RIYA 4TWJA 2H59A 4L2IA 4FEEA 2H2FA 2VJYA 2X7JA 2PANA 1Y9DA 1PNOA 3PKJA 3D81A 4D5GA 1POWA 2JIBA 2VK1A 3IAFA 3GLTA 4BUZA 2A1UA 2JLCA 3PDHA 2DJIA 2Q5LA 2V3WA 3CF4G 1DJLA 4FEGA 3GLUA 2VK4A 4JD5A 5FEMA 5K6RA 4JT8A 2JLAA 2B4YA 2H2IA 4FVTA 2Q5JA 2IHVA 3E9YA 1MA3A 1PT9A 1T9BA 1YC5A 4BV3A 1T9AA 2Q5QA 2W93A 3F6BX 2JI7A 2FN3A 4RJJA 4UTZA 4ZZIA 5K3SA 2EZ8A 5EJ8A 4BVEA 3LQ1A 2H4JA 4RMJA 4JUDX 1T9DA 4HD8A 1PYDA 4MPJA 2JI8A 2WVAA 2AG1A 1OZHA 4K9QA 2VK8A 4RMHA 1U31A 2H2DA 1N0HA 4X3PA 1MCZA 2FWNA 3F6EX 4J16C 2OD2A 4R8MA 1OVMA 2WVHA 4JUBA 4KGDA 2QQGA 5BWOA 2OD9A 4JU9A
chains in the Genus database with same CATH superfamily
2R8OA 2H1OA 3EE6A 4B4WA 1LBIA 2OKGA 2XDAA 3ZWYA 3E23A 4PSCA 1Y5RA 1BKDR 4U39A 4CG2A 1CKEA 2JAXA 1BVYF 5EJ9A 2IDMA 2Z2IA 3PXXA 4K9NA 5LYYA 5AK6A 1N0VC 4KXQA 3O2JA 3IJEB 4QQRA 3E8XA 4HAIA 1DBQA 3CA8A 3L4JA 4QUEA 1OFVA 1SKYE 2PUBA 5A9SA 3L3BA 4L6CA 3HM9A 1SHTX 3AHDA 2XMZA 1NTRA 3DR3A 1K0FA 5C8ZA 1I3MA 1QANA 5KSZA 3ZGZA 2VDRB 4JYMA 3KZMA 4B3MB 3T15A 3VTZA 5FBKA 5KSPA 2O8NA 4XAQA 1M76A 4OHPA 4EMSA 1V9SA 821PA 2R6FA 3IEXA 2P7IA 2BDTA 5DCUA 2JCYA 3ZWMA 1CQJB 4EY8A 4AZTA 5JD3A 3ZHXA 4DC1A 3T9BA 3ULKA 3GJXC 1W59A 3LWNA 4U7WA 1VL5A 2R5WA 3EXG1 1VMAA 1DS6A 1YBHA 2P9QA 1WPXA 3ODGA 3FZQA 4ZODA 2J3EA 5E7IA 3MJSA 1EFLA 3WV4A 4Q16A 3VMFA 4HDNB 3RABA 3SHWA 4AZ3B 1ECLA 3TLKA 5DTRA 2AOTB 4GWKA 2AR7A 3EFEA 2FUEA 1CDDA 3ZWNA 1DEAA 4JYCA 1CR1A 4EOGA 3SM3A 1FMTA 1TRKA 3WWYA 4MI6A 3ZDXB 3A6PC 4ENTA 4K5QA 1UT6A 5AICA 3PL5A 1RM5A 3T1OA 5D51S 1QDLB 1D0IA 2ZTLA 3AJAA 1FY2A 4FWTA 1T3HA 4DMGA 3DULA 5AW5A 1NW5A 1V16A 1ABFA 3BDVA 1DP4A 2FPLA 1Q7BA 1YOBA 2WUFA 1T9CA 3ZX4A 1FDWA 2DLNA 4Y8VA 1Y42X 2V7QD 1J8DA 4W8OA 1N6NA 5F9MA 5G41A 5BY2A 5JZVA 2ID7A 2IS2A 4GNRA 1O97C 2H9IA 3I1FA 3WL7A 1V2HE 3NGMA 4BP1A 3G8AA 1O5IA 3HXOA 2JNWA 2PUAA 3ZYCA 4LDJA 3EX7C 3PNOA 3NTUA 3IAM1 1U1EA 3A2LA 3REQA 5GIOE 4F72A 1BW9B 4A6PA 4RLQA 2OTCA 1CC1S 1U2DC 3LUFA 4HDSA 2AGVA 2JLRA 2FZ5A 4AAYA 1P0CA 3MMXA 9ABPA 1AK2A 2MU1A 5KVSA 2BPOA 1MXHA 1USGA 3G8DA 3N76A 4KMRA 3RBVA 5BUSA 2FU5C 1HZJA 1U94A 2IYSA 2WHQA 2J0UB 2ZYWX 1G8SA 1AQLA 1RWVA 2WI8A 1AJEA 1O5OA 4GSKA 3TAHA 1P19A 1KY3A 2MSLA 1JWAB 4UCWA 4ENWA 2IY7A 1EVZA 2IXFA 2O2SA 2G1KA 1NSTA 2HBQA 1XHEA 3M70A 3SP1A 1Z63A 3AIKA 1NGSA 1EP3B 1HEIA 4M0FA 4B3XA 4BGVA 3HJBA 4HD8A 1LI5A 3GXBA 4POAA 4R1TA 1C1XB 3W0LB 3LF1A 1ZICA 3EJWA 3M9LA 1YZQA 3JYHA 5AO9A 5C8YB 2Y1WA 4RESA 8ATCA 2HU5A 3LGXA 1RAEA 4MINA 3RTAA 1U6KA 2QB5A 3ZXUB 1MEEA 5LB4A 2VDOB 2ZRAA 2N42A 2W2PA 2Z5LA 4RETA 2DWCA 5ELLA 2VQEB 3EVCA 5KU1A 2W2VA 3L8DA 1K3TA 5TE9A 4TMZA 3W2TA 2PLRA 4W9RA 4ZWNA 3L1IA 2OZVA 3Q8LA 1FW8A 1E6UA 3M3PA 3OM0A 4M1SA 3W06A 5JZ9A 3P94A 3AHJA 2WP0A 5LP6A 3MJDA 3SIWA 1SVIA 4LE2A 1K7FB 2VJBA 4BNDA 2C0PA 3LMKA 4UBLA 2CUKA 4TM8A 4TMWA 3RCBA 2WV7A 4ZT6A 3VR6D 1WHSB 4NMHA 2XUPA 3EF0A 4CLXA 1J0BA 1NATA 2K2WA 1JDPA 1S8FA 2I4NA 2MYNA 3EYAA 3HP1A 3O83A 3O9MA 4G2TA 4IZIA 5TEWA 3T4UA 4UVIA 5G2OA 4ENPA 1AQYA 1QF9A 1V6CA 3DE7X 3P9NA 3PDIA 3E9ZA 1MX3A 2HRBA 2HBYA 1WF3A 2IPNA 2WLSA 4AMZA 3IAEA 4BFLA 5J2UB 3JQ9A 2BCJQ 4Q7LA 3K0SA 2J9GA 3HPRA 3L7DA 3RSOA 2XQFA 2P3QA 1AD2A 1JAZA 5HUHA 2PJDA 4JIMA 5BWNA 1M7GA 1GA1A 3DMFA 5C7IO 3ZDCA 2WTXA 4FLFA 1PYGA 2R3SA 4OP2A 1ZMBA 1A9PA 4KQCA 2QAGC 3PNPA 5FNVB 3AUKA 3RS3A 4DA7A 1TKRA 4X00A 1ISFA 1GCUA 3EMVA 4YCLA 2REQA 1L4GA 3G2KA 5FP0A 1X15A 2ZXFA 3KLPX 4YRAA 4FZ3A 1XZAA 3U1TA 1JG2A 3Q8XB 5KVCA 1L7EA 1JFRA 2XE6A 1DMRA 2PX5A 3IODA 5JZOA 2GEJA 2OLEA 3VR5H 3L92A 1LQUA 3I01M 2MWMA 2WYUA 2QTZA 4M6WA 4UNSA 5B4TA 5KREA 3WK4A 3DKIA 3L0CA 1CK4A 1TD1A 3FSGD 3U0BA 4YT2A 2ZRDA 4X20B 3DAHA 4RTMA 1Q0SA 2QMOA 1HBJA 1XJWA 3OD5A 5JASA 4CKBA 4X95A 1XU9A 1LSUA 1R9GA 2W71A 3GFFA 2VS1A 3KFVA 4H6PA 5HDBB 4HFRA 2JIBA 2WUEA 3HN6A 3MT0A 4K6FA 2I22A 4YYZA 1MEJA 4PNEA 2ZCJA 5TT1A 1G5QA 1CJSA 1CIPA 3KJHA 3H9UA 5B2ZA 3V1TC 3R7WB 1U2PA 5CDYA 2AMLA 3FVWA 2QL6A 4EA8A 2HSGA 4TRMA 2OEPA 2NU6A 4ZVOA 4PZEA 4B76A 3ZS9A 1PLJA 4MUJA 4RTKA 2BR4A 4RWEA 3O1LA 2YX1A 4GOLD 5IKOA 5BXQC 4IPTA 1TVCA 1U98A 4AJLA 2X8LA 1KI7A 2F59A 2Y4OA 3EEIA 4LOIA 1W4RA 1SPBS 4Q3OA 3F46A 4N4AA 4NBUA 4RORA 4P4TA 2G09A 4R69A 4TKUB 2FGKA 3DSRA 3CEJA 4B44A 4XZ3A 4EGAA 4F3YA 1TEZA 4XCXA 1U0RA 2CLHB 4N7BA 5EKUA 4AF6A 4IDBA 4PSUA 4W8GA 3Q0EA 5JHGB 1LNSA 1IBRA 4OREX 2EDCA 4G4JA 4Y0NA 5L3ZA 2ATIA 1KYXA 1YO6A 4DABA 2YFYA 1VHLA 2QL7A 4FMCB 1CUZA 1KF0A 4DNXA 2IBTA 4NYMR 1BWSA 1H4QA 4KMSA 4B85A 2WJGA 2WJPA 4QXPA 1GQSA 2Q3JA 1GJRA 2XTJA 3WHLA 1ONNA 4BNMA 5HVNA 1XPRA 1V8OA 1IFXA 3USES 4TKUA 2UZ1A 4ZVNA 1XRJA 3HY3A 4A16A 1B2LA 4KYIB 2AN5A 5I4CA 2ZXEA 1SHJA 2HXSA 4RKRA 1N57A 4XVUA 1U7OA 5IXYA 3PD7A 1BTOA 1PN3A 3P9IA 3GWZA 2Z8XA 1RJWA 3U9SA 4JT9A 4ZMBA 1QYCA 4EGFA 3M5WA 1NMXA 2G83A 5IVDA 4YJHA 4M83A 3KT0A 1ADCA 2MMCA 5AVQA 4F2HA 5DTJA 4ARIA 3RIGA 2HIAA 2GUGA 3LFUA 1S9HA 3CRRA 3EWSA 4S2UA 3TIIA 5FF9A 3WQBA 4E70A 2P0EA 4WOCA 4A1FA 2VUSA 3NGXA 5AHKA 3G1TA 4R8RA 4DG8A 4NZNA 5J3JA 1TTTA 1QO0A 3T4EA 1N6HA 3BIJA 3COYA 3P9CA 1G9TA 2GTPA 3PUXA 5I47A 3W3AA 2HHHB 3D7MA 2H63A 4NV0A 3KQHA 3O4IA 1MO3A 3GHYA 1V3VA 2BC9A 3EAQA 5ICMA 3Q8MA 4BN4A 1N2JA 2C3MA 2BGGA 1DXHA 4MO2A 3V1KA 1NLUA 1RYBA 4JXKA 4MP8A 4HH3C 3AEXA 1G3QA 1PLKA 3QX7A 4G1UC 1YQTA 3QA9A 3GEEA 3THXA 5CLQA 3BUSA 1CUGA 1ONPA 3LPLA 4U2EA 1KJ8A 1LVGA 3TLCA 1PJTA 2IA5A 1NXXA 5AVTA 2ZWMA 1IIRA 1H2HA 1Y4SA 1E79A 2E85A 1L9KA 4V1CI 2AUTA 2JFXA 3C3PA 2C03A 3IQXA 1ZM4A 3N8KA 3FHCB 4Y2UA 5AHRA 5DDIP 1EPUA 2ID4A 3G8BA 4JHXA 5CMLA 5FNVA 1RXVA 1SXJC 5LWHA 4IIJB 3I5XA 2O57A 2GPTA 2ZWVA 5K3OA 2RB4A 1EWYA 1HOXA 1UPTA 3AETB 4R3UC 3WLPA 3PFIA 4RZ2A 2VJYA 4Z1MA 4DM3A 4D99A 2A58A 1ZIYA 2V98A 3HP7A 5FTWA 4NCNA 2ILVA 3D59A 4BUZA 1K7CA 1W4ZA 1FNDA 1VG0B 4KH0A 5D00A 1R37A 3TW6A 3H11B 3L04A 4C6HA 1GL6A 1F5NA 4CF3A 1OPXA 4PSKA 2FWRA 5LBTA 2OGUA 3SNKA 1D4FA 5DBEX 4HB3A 4YIKA 3FR8A 1JPNA 1W35A 2HFKA 4GP7A 1JF8A 4MV3A 1KQFA 1XWFA 2YC4C 2XB6A 3FCYA 5CVCA 2VSYA 1E6KA 1N5JA 4C4TA 3C8DA 2WAYA 1LJLA 1KIMA 1F6BA 1DL5A 2QHXA 2X5KO 3KB6A 4OQYA 4TMYA 5FL7A 1KKUA 2R86A 4JBWA 4QLBA 1EEHA 3PGXA 4WKOA 4KLRA 1OI2A 3LQRA 3RBZA 2IHKA 4KGDA 1Q3KA 1CVRA 3S40A 4CLOA 1BMFA 3DWEX 3K96A 6PFKA 3O26A 2C4TA 4IDFA 4N65A 2BLNA 2JRCA 4TL7A 3FOZA 1FU4A 4QOSA 1IDOA 2H2WA 1YGPA 3EDQA 3UGQA 4JB3A 4XJVA 1U6IA 2F3RA 2QTFA 3I4FA 1Q1ZA 1PJ8A 4TKVB 1E66A 3QYJA 4NE2A 4WGGA 2NU9B 4ZIRB 3Q15C 1G1AA 3DMTC 5F35A 2GFHA 3EQZA 3T1HB 3DDHA 3PGA1 5SYNA 3ZD7A 2RHHA 1NBMD 4PINA 1H8HA 2RGBA 3RV3A 2JFQA 4AICA 1ZSVA 4MV0A 2BRUC 3CZ5A 1N1MA 9LDTA 3GFBA 3QEAZ 5CYFA 1C9KA 1OWNA 2C2WA 2WPNA 4Q15A 5DGIA 1RHRA 3EDCA 4WY5A 2WKPA 1RTKA 3O0DA 4BZXA 1TA0A 4ANFA 4M8IA 4PW0A 2IYLD 3X2SA 1NJ6A 1N25A 2P2NA 4UFOA 3ZXSA 3U7JA 2PAAA 1D1TA 1A8HA 1G9XA 1RWPA 3HSKA 4EKIA 1DQYA 3EH2A 1BFKA 5EWJA 2CXTA 1EEXB 2OA0A 1E9SA 1RHJA 1V45E 2OD7A 2YZNA 1L1FA 3REQB 1UF9A 1J5XA 5FI3A 2CYAA 3JZMA 3IA2A 3P45A 5T4HA 5D6OA 5ECDA 5A0VA 2YIJA 3EMKA 1Y3DE 2FEXA 4BJ3A 3LLUA 1VZ3A 1U4SA 4MYUA 3PZRA 4ZALA 1K08A 1FSGA 3EVGA 4OMDA 3WMFA 3LQQA 3BK1A 2WHPA 1Z16A 2Q5EA 5H4GA 2W6ZA 3S1AA 1PT6A 1TM5E 2HT6A 5EIOA 4YRKA 3QKTA 4A2QA 2YJGA 2BHSA 3EIHA 3NM4A 3UJ9A 3WTBA 1LC3A 3ETLA 4DR3B 3WRVA 3HB5X 1Y1KE 1SFRA 2PMBA 3S99A 2XT6A 1EE1A 3TCNA 1P3JA 4UAGA 3IJPA 3TLEA 2NYRA 3BFJA 4GECA 2HCBA 1V4NA 3AM3A 5ALQA 5AI9A 3KUUA 4JYAB 4FXOA 4J0KA 3IVAA 1P5JA 1QRRA 4MR9B 4BQRA 1KH3A 1FYVA 1CT9A 2WF6A 3A10A 1A97A 3O93A 2G8LA 1C7FA 1C9NA 1N6LA 3NHMA 4GEGA 4YCSA 5JTUA 4QG3A 4KNVA 5DP1A 3EW7A 2OXTA 4F04A 1JQBA 3EPJA 3JTMA 5D2CA 1CD5A 3D1JA 3GLUA 1FDRA 2IIBA 1KO8A 2V5VA 2AFHA 1MV5A 1V0JA 2E2WA 3IR6A 3D4PA 2I87A 3D5EA 3PWKA 4JLNA 4RPKA 5EPEA 3VR5D 3U3MA 2AOXA 3MK31 4IRMA 5HA5A 3DBRB 3BRCA 2ZSAA 3I6IA 3NALA 3ZE9A 1QQ7A 1UAYA 4ZJYA 3E53A 3G9XA 3PFKA 1EAYA 1GKIA 3U7FB 4HYYA 3LBNA 1MABB 1TMYA 2FSVA 2V7EA 3AB8A 1JLRA 4JZYA 2ILTA 3EEBA 1NL3A 3DCNA 3EASA 3IKLA 3NJ8A 1X9IA 1ZP6A 3C98A 1II9A 3C3XA 2FWNA 2QL5A 3VPGA 4JOQA 1EM8A 2IIVA 2Y92A 1QNLA 2BKUA 2PFKA 4O0LA 1TXGA 1VP3A 4BGEA 1TD9A 5L8VA 4AN0A 3JQ8B 4PHCA 1R2QA 3OZSA 1LXCA 2QAIA 4AB1A 1DVRA 1QORA 4MVJE 2PXXA 2BM8A 4QUJA 3ER8A 5EMLA 1BOOA 3M1LA 1G19A 4JEMA 2VBIA 3EXHB 3L77A 3QGMA 4G56A 1YR1A 1KE1A 1JR3A 1E1CB 4MZXA 1T8SA 1SUCA 3QELB 5KJ1A 3U3JA 2AQ8A 1R27A 1XTRA 4URYR 5EJIA 4XKJA 1E5LA 3B13B 3SSAA 1KEKA 2VR1A 1V11A 1L5ZA 2FXIA 3UQZA 1ZNZA 1ESMA 3GO4A 5KYWB 3CRVA 3KTAA 2BTEA 3W5AA 4RDCA 5FJJA 5DU2A 1LLCA 4IZ6A 4MCAA 1APBA 5BQOA 4E51A 1LNZA 2LW7A 4O1IA 5HUQA 4TTPA 3DWFA 1NR1A 2IY9A 2VAXA 2ZUVA 2H00A 4XCQA 1D4AA 4DDMA 3U7QB 4OI0A 3DP7A 2Q2QA 1RP1A 2OM2A 3EIWA 2JAWA 1JIVA 3D6MA 4FILA 3FDZA 1ZK1A 4ND7A 3W1EA 4KQIA 4L5AA 3VSEA 4DJ5X 4CQMB 4BCDA 3B5JA 2PV7A 2FF5A 4E1AA 1DAIA 2C1EA 4EFDA 4MR8B 1UK8A 3DEJA 3V7FA 3KQKA 3H1AA 1WOYA 3LV8A 4L6AA 3SFTA 2WKWA 3HFJA 4OOFA 4AWBA 3TKLA 1VPTA 2C3UA 2ZBRA 4JVLA 1EQ2A 4S1NA 3GUHA 4QA9A 1ZK4A 2FPIB 3STWA 2IXGA 4IQFA 1GPYA 5AMXA 2O8FB 2XKAA 3EGXB 4GRDA 4EG1A 3DYIA 3QE3A 2QTVA 4HAVA 1PI3A 4N8EA 4QU5A 3PK0A 1UFKA 5CA1F 4PBRA 2D0DA 3U5ZB 1UPXA 4MRMA 1JKJA 5K3EA 1ZJJA 5JDIA 1JJVA 3DHNA 1T5TA 2XVYA 3KSZO 1FYDA 2G0NA 2GBIA 4FGJA 4FQ7A 4R0NA 4YJFB 4PGHA 3KEQA 2Y2VA 3KR2A 1S1MA 1JVBA 1PF7E 3QKWA 4XB6B 4F91B 3GUVA 3LD9A 1I33A 1YV9A 3F5QA 5TPWA 2CJWA 1BHSA 2O7VA 1Z6XA 5FNVF 4OHUA 4YV2A 1WSDA 4ZCRA 4ZOQI 3G8CA 3IBTA 4G0VA 1T2FA 2YHIA 4Z9BA 1AIPA 3ICEA 3WQHA 5COBA 3ZJ5A 1YUMA 4JL6A 2V3WA 1NRJB 3EEYA 1RXSA 1AMUA 3NC1C 4TT8A 1I4TD 1NN1A 2FSUA 2Q4EA 4JI0B 4N9WA 4OX9B 1N75A 2B4YA 1CUFA 1QRAA 4RMNA 2VPIA 4C5CA 2CFSA 4U6QA 4KK3A 3ONVA 2ZRMA 3NDJA 4KQEA 4NK5A 3S4YA 4P2BA 5H59A 1Y6RA 1TK3A 1BX0A 1MT3A 2X13A 1I4OA 3F1KA 2ZK7A 1ZAYA 1TAUA 1NW8A 1SBTA 2CLFB 3FMFA 3H8SA 4YT4A 3WLLA 3FRHA 5CLJA 1JSRA 1J9GA 1QOPB 5FA5A 4UNQA 5F1YA 2XZPA 1NYLA 4RHTA 1MAHA 4HUJA 3PXCX 3U26A 5JRDS 2YL2A 2HWUA 5JNSA 1FC0A 1YB5A 3C1AA 2COEA 4BGDA 1NXOA 4TXNA 3KSAC 4OMUA 1M34B 3A6KA 3H2SA 4KITB 2G25A 3K9NA 4OY3A 4MVWA 1IQUA 4RF5A 3V80A 3V4VB 2GA8A 3TLYA 3ZV3A 2VAPA 2DLCX 1HZZC 2NTJA 1PS9A 3KOOA 4BFXA 3OEYA 3I62A 4TWIA 1EUQA 5DISB 4MW7A 3HWWA 4RIIA 4P4NA 4MHSA 2BJWA 1DZ3A 1VLVA 2EWWA 1IUOA 4HNUA 2GJ4A 3I6QA 3C14C 4W6ZA 3RUIA 1NG9A 2VSQA 3PQ8A 3UBMA 5B55A 1Q7GA 2NP6A 1NM5C 1P75A 3PJGA 4QNRA 4UUOA 2EOAA 5D3QA 1U7XA 1Y7LA 3OLCX 4RFSA 2YUTA 3L8HA 5GONF 1OROA 2D3TA 4CEJB 3MJ4A 3RVRA 2CFCA 1EFKA 1X2BA 4JASB 4MEBA 4QXOA 4CGYA 4QUKA 1EHYA 5B6PA 3H04A 1XSEA 2C2XA 3SR0A 2RKBA 2RCNA 1EK5A 1GKKA 3JVUA 3JYQA 3PQDA 1L3BA 4O4JB 1RPNA 1XX6A 4MKFA 2RGCA 4NAUA 4UASA 3I61A 2E4UA 1K2VN 3C7AA 4OHVA 1NVBA 3S2EA 3ELWA 3TVTA 4CF7A 3WGJA 5HRUA 4HVTA 3VC7A 2PUGA 4JN6B 3I58A 3MS4A 1IJEA 4RXTA 3RRJA 2JAPA 1R50A 3VJKA 1TQ6A 2WWGA 1YR6A 1A8QA 2II6A 4YRJA 3BCSA 4K9PA 4PPNA 3M6FA 1XCOA 1I9GA 2FZEA 3I9JA 1XD2A 1OLSA 1M2OB 3FIJA 1BQEA 3H5NA 1T91A 2A94A 2RONA 1R16A 2WR8A 4A8JA 4CCWA 3O9ZA 4R9UC 3D2BA 3TXYA 1ZR4A 3PC2A 4GKBA 4MUMA 2XQJA 2EX0A 2OG1A 4WADA 3FWNA 1JB9A 4V0OA 1N6RA 3CH7A 1TUGA 1R8XA 3GWGA 1DFHA 1KPGA 4NZYA 1EU1A 2W6PA 4Q4DA 3KVNA 5FBRB 1RP7A 1TLTA 1CY2A 3CCBA 4NOMA 1TQ4A 3CNLA 3LIIA 3DT8A 3IR7A 2EEZA 4OI4A 5A4IS 1G8MA 1B6GA 3CX7A 3DPIA 4DNPA 2OC4A 4EF4A 3PGVA 1KDZA 3V4RA 1UBGA 1QFXA 1A7KA 3C2QA 4JYPA 4WZAE 2MINB 4CODB 2YVLA 4B31A 2I8AA 3Q3EA 2FQYA 3AJEA 3PXEA 5FOWA 2G0TA 4JI3B 2RH5A 3P27A 4DMUB 4QFDA 2BBOA 3E3MA 4YACA 3DVSX 1JVSA 3UIEA 4DIKA 1TEHA 4PQGA 1MB3A 3JZDA 5DI3A 1M2FA 1P4GA 2AC4A 2GPJA 2JA1A 3PWZA 2ZZKA 3LVRE 1TF2A 3OLWA 4KXWA 4NS4A 4YB8A 4C0JA 4QFCA 1BE1A 4PX3A 4KQFA 1NX6A 2INGX 4P32A 2QJWA 4D9MA 3M3HA 1D6MA 2EBUA 2I8LA 4D46A 1AXRA 1K7XB 1RI1A 4ND2A 4WE3A 1F5SA 1LVHA 3ZY2A 4YRCA 3UAVA 1A4RA 3HU3A 3O3OB 4G5SA 1GUBA 2ZQ5A 2JAHA 3DL0A 3L8ZA 5IKEA 3IDSA 4NXMB 1UBKS 2IS6A 2JJ2A 1I0ZA 4QG7A 4JGBA 2ECFA 7AT1A 4QARA 4HN4B 5WRFA 2IOHA 1SR8A 2Z6UA 1XO1A 4LI3X 1X92A 1E79D 1HDGO 2B0JA 1D8AA 3NVDA 2CFTA 4OI2A 5CH3A 2ZDHA 4OU5A 1CS0B 1E99A 1R8SA 3GFPA 2JCSA 2X0KA 3L4BC 5I7OA 3OFSA 4XPIA 2AN3A 3KD3A 3G88A 5JROA 1DC6A 1PUJA 4UTNA 2O0KA 2PGLA 3R6DA 4XR9A 5JCOA 1MQSA 3W90A 4G86A 2ZUDA 4JXXA 1ODJA 3OPXA 3MS7A 3LH5A 3RVOA 1DUIA 4CM4A 3UXMA 2NXWA 3VR1A 4UEOA 3UV7A 2F8LA 2X40A 4LTMA 1EVIA 1QSGA 1ECJA 2QQ5A 2P41A 3CIOA 3I53A 1OXXK 4LMAA 5ALHA 1ULAA 4U6NA 2XTAA 1VE1A 1HK7A 5JXGA 2IH4A 3G6WA 3ECAA 1V8BA 1IMJA 2AXPA 1ZMTA 3LX6A 4IG4A 3LBYA 4Z51A 5B1EA 1VB5A 1Z37A 3HMKA 3HR4A 5JQGB 1RC0A 2P6OA 2GF2A 1MIHA 4TLDA 4DB4A 4ZZ0A 2A9KA 1RYNA 2FN4A 5G4KB 4QHTA 1RXWA 2WIBA 3PWTA 2B35A 2XVXA 2BHNA 4E33A 4MRVA 2H1LA 3ORSA 3IXLA 4Q1AA 1T8YA 1THGA 4G0ZA 1KS2A 2OY0A 3QKRB 1FVXA 3IMFA 1ZI8A 4Q00A 3LKZA 4O2BF 2ZTUA 4BKPA 1C7JA 1IJKA 3KXIA 4WFQA 1QG2A 3TYXA 4YRDA 1NUPA 2JH9A 3DZJA 2ZI3A 2IYVA 2AF4C 2QR3A 1W2GA 5ESWA 5MHTA 3NORA 4ZXPA 3UWKA 3GG9A 3B1FA 1L5RA 2VHWA 5AOCA 3TQCA 1TFRA 3NAGA 1NNLA 4MYHA 1YFZA 4KREA 1ESEA 2IYAA 1EFRA 1U2ZA 3M9WA 3QE9Y 1NVAA 4OYLA 2RAPA 2V74B 3AWIA 1W5SA 4XQ9A 1YOVA 1KE2A 3T3DA 1E98A 4ZV9A 4XIIA 3KLOA 1XGKA 3VA7A 3V2GA 4WBNF 1C7QA 3DBOB 4QDZA 1S0UA 2W4MA 4KQWA 3TK1A 5KX5A 2YCLA 4Y6RA 3V97A 5IT0A 2OO5A 1QH8B 3ZHCA 4GR4A 4HRAA 1H0HA 1T5IA 4DCPA 2E0IA 7ADHA 2D8AA 3RDPA 2JVIA 1GADO 2QN3A 2QAGA 3MMPA 1IONA 1GPKA 3O90A 5IWCA 1UJNA 1J20A 4I5EA 1EQUA 2ZBVA 5CK5A 3RAPR 2FSGA 4P3PA 2Z5GA 4JLWA 1GT91 1MC1A 2JJ2D 1JHUA 1M8GA 2PIAA 2X6QA 3KYCB 3QUSA 5FWXB 2AKAB 1J8VA 2G06A 1WDMA 2G9ZA 5KTOA 1NBIA 3O8CA 1ZCBA 1AZTA 1QZ3A 2X0FA 1IBCA 3FGNA 3G85A 1Y3IA 4PC6A 4WECA 1O03A 4BXOB 2AEMA 4UTZA 1DKNA 1G17A 3FRJA 4IH9A 4PLZA 3WWZA 1IHDA 3HEMA 2O23A 1YJXA 4RD2A 2BHTA 3CW2A 4BLQA 2YN0A 4YPFA 1DUVG 4YPOA 3F7NA 3U44B 3P19A 1JQKA 5J40A 2J3MA 3OSUA 2W90A 2GNOA 3LWBA 5HK9A 2ZUSA 4Q1DA 2YJNA 1VJDA 5FWAA 1BGXT 3NGLA 1WB6A 2ZRBA 3GOQA 3LQKA 1LSJA 4M8LA 3ZWWA 5JYBA 3WLEA 1XMOB 1AUQA 1I2BA 4NJOA 2VG8A 3U2QA 3IP9A 4QBFA 3CLVA 2XRZA 1NV9A 2FPWA 5L6MB 2H7XA 2I3BA 4Y7DA 3D8SA 1UQUA 4DC9A 4JLJA 1E2NA 1FFWA 3SJUA 4RD6A 2PRIA 2IXDA 1JA0A 3CUWA 1NBHA 5EXDA 3LP8A 3DVAA 3ROPA 2H7YA 2XUDA 3PUWA 4BKOA 2H51A 2X9LA 4NYIR 5ITZA 2PLNA 2OV1A 4DE5A 4QODA 2V7WA 2XWJI 3E2MA 4FOOA 3N8IA 1RZRA 3A37A 1QDUA 4U4AA 5CLHA 3V8BA 3INYA 1FFBA 2V9CA 3DBLB 3C8UA 1GG8A 1XTBA 4KIWA 4C3UA 4D9IA 4KSYA 2RB5A 2YY5A 3ACCA 4DA6A 5I01A 3GNQA 1YZNA 4HNQA 1ZONA 3WNDA 1YHZA 4Y1RB 1RHKA 4RA6B 1OZFA 5HM6A 1KAOA 3LC0A 3AERB 4MDEA 4DNQA 1Y6FA 3GEIA 3GRUA 3GV0A 5B4UA 2BI8A 3L9XA 4NY1A 4URXR 2Q5HA 2HU8A 1PNTA 5JYEA 1Z25A 2O2EA 5AKJA 3RLIA 3VVCA 2ZUWA 2HMAA 3MTDA 5KEIA 2X1VA 4ND4A 2M6KA 4PX2A 5I9NA 2I66A 2IPOA 2R65A 2MOKA 3KPJA 1HR0B 4D6XA 1RRGA 2G1JA 1CY8A 1XMIA 4MUGA 2YBEA 3MN1A 3KG2A 5DI3B 5A71A 4I55F 1OLUA 2Q6OA 2C96A 1W96A 2Q3LA 2RDMA 3C1UA 4PG7A 3TOXA 3TTYA 2FUKA 1KK1A 1XQXA 1NG1A 2FTKE 3AYZB 4K9SA 3ZDDA 1IAQA 4IXDA 1PL8A 5FPPA 1U5CA 5AUPB 4RANA 2MINA 3PQFA 3ZJYA 3MT8A 1RQLA 2WMNB 1E9VA 4L9AA 3RSZA 4MPRA 3SCZA 4B6GA 2PUEA 4XASA 4WOJA 1P4HA 3LUKA 3KLBA 2D5LA 2IYEA 4YP1A 2J09A 1D6NA 2CNBA 1CR0A 4ONEA 2OZEA 2YWJA 1UANA 1EVQA 1JHMA 1M1YB 3AR5A 3HJCA 2LD4A 4G8DA 3WL4A 1FLVA 3ZW7A 3QVVA 3CBQA 2PANA 4I1VA 4R2IA 2E18A 3B9RA 4Q4JA 3HM2A 2P8SA 3LJKA 4AMUA 1XPUA 4FS3A 5FV4A 4IGKA 4RJLA 2D0PB 1CB0A 5A7GA 1US8A 1X7ZB 5K0BA 5BN3A 4ZQGA 1Z4PX 2B20A 4XVCA 1FF9A 3ZCSA 1B8UA 1WCV1 1XTJA 2YW2A 3D3WA 4P93A 4F2GA 4OGKA 5G3YA 3K6SA 2NT4A 4FHGA 1GGKA 5HKKA 4X7BA 5HZKA 5LNK6 3L06A 3TB6A 4QTYA 5HTKA 1CTQA 1CVIA 4DQVA 1C2YA 4B2IA 1M72A 4X1IB 2GN0A 4LJ4A 4Q3CA 3BDAA 5H02A 2OZLB 3REGA 5CA0F 1SOWA 1VE6A 3OZEA 5KQMA 4HI0E 4EFKA 1N5LA 1OU0A 1Z39A 3HKEA 5I51A 2JGFA 1PP4A 3S29A 1ADFA 2VZ0A 2H4FA 1TVKA 4F93B 5CM2Z 2LCQA 4C43A 3W34A 2E5FA 2QMZA 4MV9A 2YVKA 3K70C 1UWCA 4ZT3A 5KYXB 1ZXXA 1VLHA 2GERA 3ESRA 4ENVA 1RFGE 3GPLA 5LDHA 3C87A 2OL4A 4TRJA 5CPBA 1BD3A 1T5OA 4DLNA 1CQIA 1J33A 1TO1E 4KLCA 4MDYA 3KHKA 2FRVA 1JRLA 3LPMA 1CB7A 3SSMA 3BL8A 5M3BA 2CDCA 2DR0A 1TE2A 2JBWA 1ZPDA 3C6QA 3A4VA 4BGIA 5F7XA 4A73A 3CCFA 1SUEA 1BH6A 1WXQA 5CDSA 2CL6X 1XVAA 3D3WB 4MIEA 3QI7A 4WN9B 3RAJA 3IP6A 3EPLA 1YIAA 4ZGGA 3LRXA 1QWSA 4GP9A 4N0DA 3VVBA 1UZMA 5E6RA 1M34A 3IQEA 2PX6A 2QRJA 4YUVA 4AY5A 2O9JA 4GMGA 3TO5A 1N6IA 1AB5A 1VE5A 1YQDA 3E61A 1WBDA 2AEEA 2IITA 5HIAA 3OKAA 4Q4JB 3GQVA 1MTZA 1BN7A 1NW3A 1Z15A 4LJSA 3AP2A 7YASA 1GNVA 1F38A 5KB3A 3QPDA 3T8YA 1MO6A 1WUTA 4LYYA 5IBPA 3WWEA 4JFRA 3FTDA 3I42A 3ISTA 4N1AA 3BMOA 2WD7A 3RPEA 3TEMA 1XZDA 3TZQA 4EM6A 1WMAA 3VHQA 4BO6A 1RZRD 2WZBA 1J2TA 3BXZA 3D0QA 4BAGA 4NXNB 4CHGA 1H4VB 4KFRA 1NVFA 1R4ZA 1WDKA 3PFHA 2VN8A 4V0MA 5E7MA 2VT3A 4XI9A 4CEHA 3EVFA 1SU6A 5DM4A 4B71A 5LQAA 4BQNA 1FU8A 1DNPA 2D3WA 3M89A 1KXJA 1QHEA 2G67A 3N2NA 4HADA 1JP7A 2P1DA 2PT9A 1XZ8A 1J7JA 2CCKA 1I6MA 4A6XA 1G20B 5FOVA 4D3SA 4E21A 4CLRA 5LZ2A 3UWOA 5C1OA 1WL8A 1UXGA 3FOCA 4G41A 3O8LA 2CJWB 1GXSA 4NKRA 1UM8A 2QGFA 4J8PA 2R1VA 2YXEA 1HL3A 3K16A 2X2OA 1R88A 4YJFA 4ZCPA 4QYMA 3WYNA 1NQVA 4ZEVA 4M60A 4Y2QA 1HLGA 2NQ2C 3GRCA 4MRMB 2VF2A 3Q3VA 3VKHA 4G5XA 3SN6A 3UVEA 3E35A 3L6OO 3MTGA 3GFVA 4YT5A 1GRVA 4DEYA 4ZOLF 3CFYA 5KTKA 2NTVA 3ASZA 4LBZA 4Y2HA 4Y1RA 4G4IA 2JFUA 4C3OB 3R5JA 4E4RA 3GBPA 5FADA 5EE9A 3DVLA 3V48A 3D4IA 3C5HA 5AHOA 5ALDA 1JPUA 1DAHA 1Q15A 1XA0A 3G5AA 1M8JA 3DPSA 2GRAA 5E4YA 3KQNA 2Q8PA 1JFVA 1U0SY 1ZL0A 2AN1A 2E4XA 3HGQA 3I9LA 1KBZA 3LHIA 4FPXA 4LJ5A 7GPBA 4NCXA 2B94A 2J5XA 4D0NA 1CEXA 1MGOA 3PD0A 2WA1A 3DVAB 4RVSA 2R1UA 1XMQB 2VSNA 1AO0A 3UT5B 2PMWB 2NQTA 4QEKA 5T64A 3DBIA 5BXYA 2UYCA 1WG8A 4EF6A 1W2WB 5HX7A 5IX8A 1HDCA 1ESZA 1TZBA 3M4YA 4B82A 4EG8A 3E7FA 1ZK3A 4YI3A 2V1XA 2JF0A 4WBSA 5AKLA 4D8VA 2ADOA 2DU8A 1R3DA 1Y33E 2IZOA 3PRYA 4HQKA 1WR8A 4QICA 2AG0A 4ME6A 4XM0A 1P81A 5DX0A 3V7WA 1Q91A 2QVLA 1ICEA 4FCCA 5CNKA 2QS9A 4TMVA 3SKXA 3IVXA 3LA8A 1YZLA 4BIIA 4MV8A 3KR0A 4D74A 1WLYA 2DFPA 2G8NA 3RVQA 1SZCA 3EOZA 1GYPA 2VUIB 3CEMA 4YBZA 3ECCA 1L5LA 4ETMA 5I45A 3K8OE 3G5TA 2HDOA 2KQUA 4TLCA 1LRLA 2UZAA 5DTMA 4UM5A 1KBOA 3B1YA 3FAKA 2EFEB 3P4XA 1JDZA 5EP4A 4JJ7A 5J63A 4BMNA 2CL7X 2DSNA 1KOJA 1LS1A 1FMJA 2FG6C 3E9EA 3GIDA 5KQRA 5DLQC 3C5CA 2CNWD 4MTLA 5ENVA 4EY7A 4R1NA 5BV1A 1TYZA 4W5HA 4HWTA 4UEQA 2XT9A 1E9AA 1XR3A 4MMXB 5LZ9A 2JVJA 3CN9A 3CUSA 3LP5A 4FQ5A 1KJYA 2DKFA 2Z1DA 4NBRA 4MVJD 3VDQA 2Z6VA 2G5CA 2LZ0A 4O4HA 2SKEA 3FSJX 2V6IA 4WX2B 4I2NA 5BSRA 1MU0A 2R6R1 4D8TA 4Y9RA 2WJZB 1NI5A 5THKA 1DRVA 1MABA 4WN3A 6NULA 4H6VA 1KY4A 2RKWA 2F62A 2OGTA 3B89A 3OZAA 3PE6A 4G5GA 4TS3A 3RUHA 1E9RA 1QAMA 1QU3A 4WUTA 2ZW9A 1GFIA 1CP3A 4UQLA 5HCNA 1L8LA 3PHJA 1JEYB 2PUDA 3B2NA 1W6UA 1ZGZA 3AM1A 1TTQB 4LZJA 1PFWA 3CISA 2O8BA 1EI9A 5E2BA 3L6UA 1MIOA 2JK1A 4L16A 2H4HA 2FSIA 4OHMA 3VDRA 1D03A 1D2RA 2P8JA 3WSVA 3OJWA 4UKDA 4AVYA 3T3PB 5FPHA 3QITA 4OL0A 1YC2A 1GPH1 3KXLA 2SICE 2CD7A 5ALNA 5F77A 2BEJA 2IZZA 3HR8A 2HRQA 2JARA 3FKJA 5AJYA 1MQ9A 2I5PO 3RIEA 4ZYTA 2CLKB 2ATXA 1GR0A 4ZYXA 1NPDA 2GNAA 2RAVA 3RIYA 4RFVA 4KI0A 1V26A 4QDTA 3RSHA 2CLSA 3IULA 2QVBA 4L7VA 2GPNA 2R6HA 1I6WA 3H1FA 3IXQA 4U7HA 2CNKA 4YO7A 5AXCA 5FLKA 3RS0A 1KI2A 5CLIA 4YP0A 4P82A 5K0SA 1J0CA 5KYYB 3OT4A 1AS0A 4HUTA 3L93A 3THWA 3UW1A 4I9HA 1HFEL 1VGVA 4GIBA 4DYHA 1DC3A 5BT8A 3SNHA 3ER9A 4KL8S 4S1TA 5JWRA 3TZKA 4ARVA 1W5AA 2UV8A 5JJIA 2WDZA 1G20E 4D9FA 2I2XB 3IDOA 5CG1A 4HEA6 4FMDB 2GK3A 5KVAA 1KOFA 3LUBA 5EJEA 3TMYA 3ZDAA 3GVXA 1FOEB 1TRHA 2FZKA 1I0LA 2MYTA 1M83A 2VDKB 1CU1A 2DKOA 3B1ZA 1VYHA 1WKVA 1X1RA 3C3EA 4NHOA 1T4CB 3UHOA 1TLLA 1XTKA 1EDOA 4HB0A 4MQMA 3HCBA 1DBSA 3D8TA 3RC9A 3P9SA 3AEQA 4J9VA 3IPXA 4FCVA 5CA0A 1E1LA 2PX8A 3EOBI 2C77A 2IKSA 2ZITA 3OM9A 5D84A 5JNVA 4QM6A 2IP4A 3JATB 5J2TF 2Q2WA 3QX3A 4INZA 3K5HA 1OW3B 4H0NA 1L1RA 4S2EA 2XCSB 3H8VA 2IUUA 4NDNE 1F4LA 3QUAA 3WRYA 1VSBA 4P7GA 3WBJA 1EWVA 2J3IA 2W6CX 2SECE 1KJ9A 1W76A 4KZKA 4RVCA 2GF0A 4E31A 5JY6A 5KKNB 4GG1A 4JYBA 3TM5A 1PKXA 4D41A 2OUIA 4DUGD 2OFWA 4FWIB 1P45A 2Q3FA 1D0VA 4FFBB 1Q0PA 4TSFA 5U1PA 4ZIRA 4EL5A 2QN8A 4LN1A 3STHA 1OSNA 2MR6A 3EBLA 3ZLVA 2G07A 3BWYA 3ETEA 3FPFA 3LBHA 2P3OA 4RVNA 5DN6D 3DLTA 4WVLA 3QFTA 5IKPA 4DXDA 2GBCA 3R5FA 5EE3A 1F0YA 3T7CA 3VDXA 3PCTA 2PWAA 3MLBA 3H6HA 4C0QC 5EYPA 5E4JA 3JPYA 5EIAA 4ZZ1A 1PZEA 2R84A 3W9SA 3P0FA 1KZ6A 4ALIA 4MJLA 3S2FA 4BVLA 3IKTA 5L7WA 4P08A 1EGHA 2Y1GA 3BD6A 2NUTA 5I4BA 3FYHA 4RVFA 2QBYB 1A2QA 1G6HA 2AR0A 1N92A 1ZDMA 1O89A 2HRCA 3DUWA 2JKZA 3O95A 2PUCA 1LI4A 2EX1A 1B8OA 4DUYB 2D1QA 5L9AA 4O33A 1ID8A 5DYWA 4H6WA 3UKOA 3E22B 2LCFA 3HLYA 1RCTE 1CCWA 3H11A 3RRZA 4E5MA 4QJ3A 2ZJFA 5K6AA 2DHRA 2X9GA 2A1UB 4HZUB 3ZHBA 2EXXA 1EB9A 1N5OX 2OUKA 4LRWA 4WJKB 1VLJA 2XF2A 4K6HA 1QV7A 2JAUA 3RTDA 1KZ4A 3KR9A 1M2OA 2GAOA 2EL9A 1CRLA 4DLKA 3TW8B 4HAZA 5LMUB 1H42A 4OUDB 5IUNC 4KC0A 4A0RA 3WYAA 5K9ZA 2O20A 1A9TA 1I5EA 2IWRA 3WJ2A 3LQFA 1JEYA 3SZ3A 4AZVA 3TD9A 3GA7A 3TLGB 1G63A 1RI5A 1YZ3A 2IV2X 3WNQA 3QFCA 1ZX1A 1D8TA 2XIJA 1Z3IX 2GB4A 4Z53A 2Q5LA 4O4JA 2O54A 3QBVA 4KYVA 1IC6A 5T5QA 4X62B 1HNWB 3R9XA 1IHPA 3VKUA 2X22A 1N2CA 3FFAA 3THXB 3O4VA 1E4YA 2XADA 4FN4A 1HQYE 5FR1A 3QLUA 4BV3A 1K63A 2G70A 4UBOA 1MJHA 2OLKA 3R9KA 3BMQB 1Y9ZA 4YDQA 5KHLB 2WU3A 4EWLA 1KDRA 1V25A 4MRPA 3UMFA 1N3IA 1HSZA 4DV5B 4RM3A 3NTQA 4ZEXA 3NBQA 1H22A 2IZ0A 5KJ6A 2OD2A 4G01B 4HDOB 3TMKA 3FF1A 2OD9A 1F2UA 2UUPA 3IGFA 4YUZA 4D25A 9MHTA 3TRHA 1U1CA 3D3QA 3AB7A 4B4UA 4EPYA 1MOPA 1L6IA 2BGLA 4FDLA 1WDTA 3CX3A 2CXOA 4YVFA 421PA 2DH5A 2HXYA 2R7NA 3L0YA 4EUKA 1QR2A 1Z6AA 3H3XA 4LKRA 1Q22A 1UBRS 1H8EA 5F2KA 1W0CA 1Q1NA 1DQPA 2L17A 4HV4A 1Z2EA 1ELOA 4R9RA 4XX0A 2XDQB 1BS9A 2WWVD 3W4IA 2J7PD 3RVDA 1XZPA 1PSDA 1L7VC 2PUHA 2G9UA 3K53A 2P4QA 4RGVA 3I0ZA 2WKRA 3HJHA 4UUBA 2EZTA 2WG2A 1Z6GA 2YMPA 3LCRA 3UMMA 1MAVA 4IM7A 3A06A 3UAWA 1FX0A 2ZULA 3QE4A 1GCAA 4DC0A 2RH8A 4MI9A 1NOJA 1PL6A 3BQMB 3GLQA 3T6KA 5I8WA 2O5RA 2ZSBA 3V4ZA 4OLHA 4GE3A 1YTLA 2HWKA 1IEQA 1P1RA 2BMAA 2FMIA 3M8KA 1GZ6A 4GYJA 5GMOA 3MWKA 4TTIA 3ZBTA 5BPHA 4OJKA 2X15A 3AG6A 4AWXA 3CMMA 2R6AA 3TSWA 2HSZA 2P40A 5TPWB 3KPUA 1ZC4A 2O3QA 3ZNPA 4AJJA 2IU3A 1TU3A 2B37A 4XD2A 4DLYA 2WQ7A 4S35A 3ZEIA 3FBWA 3T5GA 1Z26A 3FVTA 1ZGHA 1SCJA 2A9RA 4YQZA 3AY3A 2WSLA 2IU0A 1GGFA 4JYZA 2W98A 1FL9A 2VHQA 3EC1A 5H7XA 1ORDA 3R7WA 1DV1A 2BMJA 2G5GX 3THSA 1Q2XA 5BQXA 4B3GA 3G1WA 3E9QA 4IVQA 5G0VA 1KVUA 1S96A 3CX8A 1LPNA 3D2LA 3SYTA 1ZGCA 3U40A 4PCUA 4WA7A 4BS9A 3MOGA 2C59A 4HP8A 4LXXA 3I8SA 4EB8A 3OZWA 2JW5A 4UCQA 5CH5A 2WE7A 2NGRA 4JA0A 1XJQA 3MT7A 1QU2A 1RIFA 3JRXA 4BVAA 2Z56A 5A3VA 4F8EA 3BMNA 2GLXA 4HDAA 4PAMA 4XFKA 4TWJA 1FFXA 3OBBA 4F1KA 5DTQA 4AJOA 5BSWA 4M6WB 1IUPA 1J90A 2V55B 2ZJOA 1J2EA 1QCZA 2QD3A 2WT4A 3HA5A 3HNPA 2Q5CA 4OM7A 4DLSA 1R6BX 5FPKA 2FE4A 1I94B 2RAFA 3PDHA 3CF4G 1MAAA 4RPLA 5KU7A 5I9BA 4D97A 3GUYA 3HCAA 3DMHA 3IB3A 1G59A 5KNDH 2ZJYA 4TKLA 1EK6A 2A0FA 2AG8A 1I6KA 2OCBA 3GEDA 1XZQA 4YR7A 2NXCA 3FBGA 3H4IA 2W2KB 2XSZA 4MKZA 3WRYC 4AN1A 4EO4A 3GRYA 5KYWA 3PEFA 2OMEA 1V11B 4C4OA 2QORA 2YCBA 3TBFA 1MHPA 1WU8A 1E7WA 1SQ5A 1FIUA 1CUAA 3AK4A 5B3JA 1ZUD1 3ESBA 2HA5A 4MQFA 4EPTA 5L40A 1T2DA 4G1VA 1JFSA 2JFYA 2PNFA 3W5SA 4L27A 4MVJF 2GN6A 2C2BA 3ROMA 1NQWA 3CUKA 3JD3A 4H17A 2QTWB 2YS6A 1DJMA 4DVGA 5JFOA 4HCJA 3ID6C 4DIFA 5AW1A 3IH5A 1Y8AA 4GQAA 4V3BA 5JMPA 1N1DA 4ZV7A 1XZKA 4HXEB 3G0HA 1FXSA 1RQ2A 1P61B 5B58C 3DOIA 3DTVA 3BIWA 1E92A 5G0UA 4ITUA 3W9UA 1EM8B 3ZCUA 4RD3A 3LYLA 4K03A 5IDQA 1LV7A 1Y8RB 2N1MA 1RNLA 2HEIA 4BNDB 3EVDA 3KJQA 5DEOA 1U9JA 3OX3A 2KSQA 3UC5A 1NKTA 1W8IA 2GM3A 4F4DA 2IBSA 4R2JA 1Q14A 3EVEA 4X60A 1KOGA 1Y3CE 3WO1A 1AQUA 1MPXA 1NZFA 3JCZA 3UGJA 2A5GA 1QFJA 1EWTA 2CBGA 4IDDA 1WWKA 2WWXA 1JIUA 5KZMB 4PC3A 4D4JA 3NVKI 3BH0A 5EMHA 1A72A 2VHJA 2QUBA 4CUKA 3FJ1A 2QI9C 3CR8A 4IMIB 4EEXA 4XDYA 6YASA 1NF2A 1A8SA 1N77A 3IVGA 2QNBA 1Q1QA 2ANBA 1EXMA 2ZVDA 3IAUA 4M9UA 3BJIC 1PFGA 1ZI6A 3OP4A 4GSLA 1NF9A 5DEIA 5TGTA 2XKKA 4R16A 5FBLB 2QXYA 3VH1A 2ZBPA 3QMVA 4EVSA 5CAEA 3S5UA 5A0FA 4LY9A 1E0JA 1EWQA 1XXHE 5DW0A 2WJ4A 3A26A 1QZTA 4YAUA 1CUEA 4I3GA 4OP1A 1V35A 3PNSA 5AOVA 4REOA 3PFFA 2QMYA 4KRGA 4MYRA 3SYKA 3NHJA 3PZBA 1EHIA 3ZLBA 2J48A 4LJLA 1XCLA 2RHCA 4N01A 4CFZA 3X2EA 4BNGA 4ZO6A 2B1IA 4HNTA 1H94A 3FHTA 1T3LA 3E2IA 1CDOA 3GVPA 3CS3A 4B2YA 2Q29A 1N2ZA 1Z62A 3TBHA 1MB4A 3MJVA 2XUOA 5BW4A 3B8EA 2P2ZA 4CL2A 3PC7A 1VECA 1A0OA 3TCXB 1YT5A 3FTCA 3O3MB 5D3MA 2W58A 3PX3A 4CBVA 2CF5A 4FBGA 1W19A 2FSPA 4C06A 4ZV4A 5EESA 3W6PA 2OOSA 3W7BA 3ZE2B 2FSFA 2HJRA 2C7BA 3TZCA 1MO5A 1ZH6A 5A6SB 1LDBA 1D7AA 1NW4A 3ZIUA 1Y9AA 4ZYLA 2ZBDA 1P2UA 1OQAA 4AKSA 2XOKA 2AUNA 3OE7D 3QF7A 4D92A 3LGSA 1NU6A 4F2WA 4QRHA 4RPHA 4PF1A 2HFJA 4P5EA 1Z7EA 1IBSA 3EHEA 2IUEA 4H3SA 3UAOA 4F12A 4NZPA 1UBNA 1C4KA 5CLLA 4POOA 1O57A 2AF3C 1ECPA 4HEJA 2DXIA 1P1IA 4OLFA 5IZCC 2GZHA 1B26A 2QVGA 5L53A 3FN4A 4JH0A 2OGSA 3D3JA 2AG1A 2CFIA 3EC7A 3SG0A 5C8XA 5JCJD 1TUEA 4RKFA 1HT2E 2JA2A 4UBIA 3DEYX 1S89A 1L7DA 2O2GA 1K27A 2W83A 4PR0A 4R51A 2BBSA 2F9MA 2IHZA 3O5AA 1O94A 3OZFA 4LNUB 1P77A 3P0IA 4YV1A 5ICSA 1C7RA 1JZTA 1PT5A 3VNUA 3HUUA 5JCZA 1GRNA 4EJ0A 2NO7A 4HPXB 1LNQA 1P8JA 3IQGX 5KIAA 4KO1S 3C41J 4U9UA 1YBMA 3LK7A 1E7QA 4JUCA 4TLBA 1DO2A 4E3WA 4P7FA 1WE2A 2ID8A 2LDXA 4M2LA 5T6BA 4UTXA 1YKGA 1F20A 2C83A 1ZHOA 4EHNA 3SHOA 5ALOA 5LLTA 2D4HA 2XPCA 2VDVE 3HGMA 4CT4B 3BSSA 3L7AA 2F6RA 4NMXB 4EHFA 4RK5A 2ATCA 2ON6A 1Y4UA 1GTVA 2VTEA 2HF2A 4W7HA 4WCVA 4ARZB 2B78A 3QQPA 3ANXA 1TYCA 3RO7A 3ZTYA 3PU6A 1LBTA 3TTUA 2RI6A 1WUYA 5HF9A 3ZZUA 5K0JA 2C94A 4HG2A 4L28A 5FUVA 5IAJA 3CUYA 3ISJA 4TQ9A 3HS3A 1M54A 4R68A 1JJBA 4QYTA 4U63A 5E1BA 5IVKA 1H6BA 4EGJA 4MEAA 3EQ6A 4HEHA 4J6FA 4P3YA 3V33A 4Q5IA 5E9QA 2FUCA 3Q8WA 4ZEWA 4TWBA 2AHOA 3WNBA 1YR3A 2FW9A 3E8SA 2Z0MA 3LOUA 4MQFB 4MV1A 3WLOA 5JBNA 2GZSA 2Z5VA 4PYNA 1VSUA 3UMSA 1TO6A 2IS4A 1MAUA 4A2CA 2XTMA 3HCWA 4KN8A 1IWBB 5T3UA 2R6DA 4WERA 3LK6A 4ZU3A 4AD8A 1XMXA 4BWGA 5L4LA 3E3LA 3P52A 2XEXA 3GUUA 4NYIQ 3TN7A 5GIPE 4G4GA 4GFDA 2WZQA 1RXUA 5GP1A 3MB5A 3SAJA 1DWUA 1E3MA 5SZJA 2GCOA 4O8CA 3V6LA 2VRBA 3CC8A 2QXTA 3ITEA 2QN7A 3D6VA 3EXFB 1AK9A 4M87A 4N7RA 4UHHA 3UH1A 4AF8A 2UZIR 2BGIA 4OSOA 4I14A 4EFNA 3ADDA 4M0UA 4UBMA 3F71A 1XU4A 3QJ5A 4EHHA 2DYKA 1BE8A 4PU0A 5A7FA 2AJ8A 5BSTA 4H4CA 5LPNA 4N0QA 1P6QA 5TC4A 2MHCA 2HHCA 5JAMA 1IEVA 3LYAA 1NNUA 5AM5A 4CG3A 2ONYA 3RTEA 4F11A 3NHLA 3ZWBA 2XMGA 1Z0JA 1CZNA 2VQ6A 1NQOA 1GZ3A 3FDJA 1O95A 3MTQA 5FI5A 5A02A 1NVVR 4Q7MB 1L0BA 3G0BA 4QBKA 2O50A 1R0LA 3CSDA 2IYXA 4FOPA 1WSAA 4GLOA 4E0BA 2Z8ZA 4LXGA 3OTQA 4EZBA 3WGZA 2F4NA 1QHHB 1ZWLA 3G9UA 5JJCA 5K2MA 4D0SA 2YFKA 4DSAA 1UK7A 3TTWA 2ANCA 3IUNA 2D5CA 2P5UA 3K1AA 2H7CA 1TVMA 1PSWA 4B43A 1X7YB 2J6IA 2WKQA 1PD1A 4J07A 2CXPA 5FUXA 2IYOA 4TWAA 3KVYA 1T5SA 3FG9A 2NNWB 4F4JA 1G4AE 2XB4A 4M89A 4WDQA 2JG3A 2NNLD 1AGXA 3WVNA 1M5TA 1ZM9A 5TMPA 4DIBA 2DT8A 3SR3A 3OC6A 4DMRA 1RWBA 1IWOA 1AV6A 5EZYF 1RQGA 2WHEA 4V0QA 2UYHA 3L6RA 1K9SA 4JBXA 4B0PA 1CNFA 1PJQA 3HDGA 3KYBA 4WACA 3S1LA 4E1BA 3DDCA 1V8PA 4CE6A 2O0HA 1RBMA 4EO9A 1XNHA 1ZAKA 1A4IA 3HXTA 4JK3A 4L5IA 1AKEA 1MENA 1MC4A 1VFPA 4FHEA 2VO1A 3QFSA 4BNVA 2C2YA 1Y6GA 5SICE 1G8JA 2PSHA 1AKTA 1F2TA 1JU4A 2CL5A 2PVCA 2WTBA 3N5KA 4HQOA 2J9ZB 1WSWA 2BHLA 1LU9A 4LVCA 4XDHA 1I2ZA 4G3XA 1P44A 4CF5A 5EJ6A 5EHXA 1QK3A 3O2QB 3GAAA 2L0XA 5F3DA 3DS8A 4EYOA 4IF6A 1O5TA 1ORIA 3CWCA 3L0BA 2IDKA 1I2DA 1FMLA 4LIPD 4ZEMA 4FGLA 4UQPA 4E5SA 3LTEA 3QKIA 1TNDA 4ER3A 5A5GA 3I04A 2B4AA 2YW9A 2FA9A 3KWFA 4BFUA 4D4IA 2EWVA 2Y8EA 3ZY6A 4LYAA 1CFZA 2H5JA 4AN4A 4C0AC 4PC2A 4R2HA 4DYVA 2P2SA 4IZHA 3SBEA 5JD5A 1I4LD 3JWHA 5JE8A 1K8ZB 4WA8A 3SSOA 4AL4A 3ZCTA 4MGHA 2G7ZA 4TVOA 3DFFA 5GV8A 3RVNA 4X65B 4GI1A 1PJLA 3ZQUA 1XDZA 3BWCA 3WISA 4QNMA 2AV6A 1TKAA 1CJKC 1VKHA 4Q1CA 5AW9A 4OB6A 4CKBB 2NZJA 2VBCA 1LDEA 4KFTA 3HB0A 2CK3D 2VYND 3OE5A 3L01A 3UMVA 3WBBA 2P65A 5DT2A 2QX9A 1P80A 4X20A 1KJNA 3H9BA 4K9MA 3GLHB 1A96A 3O7WA 4NMLA 1R0XA 5LC1A 1C29B 1T1JA 1XDUA 4DJFC 4PLPA 1BS1A 1P2TA 1QPZA 1H2XA 1ZXLA 5HF6A 1BZYA 2UXBB 1N2CB 3DV2A 2QRVB 3V9AA 5K01A 4M22A 2ZSKA 3Q12A 3RBXA 4EY5A 5HTOA 9GPBA 3N75A 1U7TA 5BR7A 2C9ZA 4G37A 5T8KA 1SY7A 4MRNA 3LKVA 2LKCA 2WILA 1QGZA 2WF9A 4FP9A 1M0EA 4AY6A 1FFYA 2PBZA 4MV4A 2PLWA 3KOUA 4TS1A 4MWCA 3IHWA 2WTEA 4EI8A 4NH4A 1OWOA 3I5AA 1SK9A 2F90A 1JHYA 2VPZA 3LXXA 3OLXA 2IUSA 2PEYA 2R2AA 4DG9A 1Z83A 3RNOA 4BB9A 1UWLA 1DOAA 5FRDA 1HEUA 1P18A 1CZHA 2P4HX 2UYOA 4DR2B 1T5HX 4PO3X 1BFUA 1ESCA 4K6OA 3KPWA 4FD2A 4KR7A 4XCVA 3TR0A 5J9FA 2CXSA 2XZOA 2EQBA 3E22A 4G1BA 4JDPA 4K6MA 5FYDA 2OV2A 3T7EA 4OM8A 2QROA 4Z7JA 1PZGA 2DG2A 5IKXA 3TQFA 2CNLA 4XFJA 1SXHA 3HCOA 3QRWA 4NEHB 1Q83A 3W2HA 5JXJA 2NYAA 4N0PA 3DKKA 4N39A 5ALMA 1I9CA 2AYXA 4R98A 1KY5A 4Q0MA 2CE2X 3NU1A 3A1UA 2HPAA 3N7UA 2I67A 3HZRA 3F6RA 2ODPA 3OJXA 4PZZA 5EN4A 2CBXA 4ZDIA 2X0RA 1EXDA 5A5EA 2AMFA 2P3SA 4CKWB 5A5FA 3NETA 3I34X 4PSVA 1OAOC 3PEWA 5A62A 2HLHA 3PUHA 1WPRA 4WAUA 3OLVA 3CRNA 3D8HA 3E1GA 2ZJ6A 3LPNA 1PQUA 3PC8C 1RZUA 3BAFA 4K86A 2J85A 3PFNA 1YRHA 2EKQA 2LV8A 3IILA 3L41A 4L0QA 3RU2A 3H1BA 1YFKA 3X0DA 2Z2JA 3BGOS 4CDRA 1SBCA 3SDZA 4OQXA 2G17A 1XZIA 4J75A 1FJXA 5ERXA 5A1JA 3Q8KA 1DDOA 4PYLA 4LZAA 5BW8A 3D8BA 2X23A 2M32A 3C6MA 4A8PA 5C8YA 1X7XB 4E7OA 1JHXA 5KTPA 4JXJA 3DTYA 4FB5A 1UJ5A 3MFQA 2ESRA 4K2AA 1KNQA 1CRPA 3V2HA 1W25A 2A30A 2PWBA 1A9OA 4IOMA 1DPGA 2QJOA 3SEQA 1DJQA 1CYEA 1DMSA 4BDSA 1ODTC 3R7NA 2M6SA 4W63A 1SUDA 1Z0IA 1SRQA 2XNKA 3NOOA 4JENA 1GAJA 4WOKA 5CA0B 4G2NA 5JJLA 3MGGA 1U2GC 3RREA 2AH5A 4PZUA 4XQEA 4B7ZA 3QJYA 3FMPB 4CJXA 4R31A 1E62A 3QXHA 3GLGA 3WK9A 1IEXA 1P9WA 2OV8A 4KWHA 3K9BA 4XYGA 1FNSA 1AUOA 1GPAA 3RW9A 2BEUA 4NI5A 2P9TA 3T7RA 4BQQA 4EUEA 2O1XA 3NASA 3W3AH 4XGNA 3A6HA 5TJHA 4CUZA 4LF6B 3WK8A 1WCWA 2X5JO 3F96A 4Y1EA 2FX5A 2OHGA 2ONKA 1KERA 2IRWA 1E59A 5JRJA 1F8UA 1R9MA 1J0DA 5K51A 2QRZA 3OZGA 2Q27A 4DVJA 3RAEC 3MAAC 1FCJA 3EYWA 1WUIS 4KWTA 2CXNA 3MYRA 1D2GA 1T26A 2HH9A 3B2QA 4HATA 1V5EA 4L51A 3CO0S 3OZRA 4ZYZA 1W30A 5B1SA 3C3YA 3OM8A 2YFHA 1G5TA 4D26A 1RKUA 2ODNA 2C97A 3LBAA 1EVLA 3JQAD 4TGLA 4FX5A 3REFA 5BNWA 4DCGA 1J9ZA 1TUBA 4I55A 2OHHA 4OJTA 1ZVJA 4WZBE 5LYJF 1DIOB 3OHPA 3R6WA 3ITDA 5LR6A 1ULSA 1A9QA 3N0VA 1NPTO 1K97A 4KGVA 3HH8A 3ZK9A 2NV6A 5F5LA 1CG6A 4Q66C 4GDFA 5C81A 3I2YX 2HJWA 1F4VA 4J4TA 2YZ2A 2J3KA 3EFHA 3QX8A 2G0AA 4UHBA 3IPCA 4UUMA 4UW9A 1ZHHA 3WLTA 4AZ3A 1L1EA 2DAPA 4MV6A 1YK0A 4PV7A 4G23A 1MIOB 3IAFA 4EK9A 3B3JA 1QNFA 4HGNA 5AKKA 3JVVA 5BOVA 3EF3A 3AC0A 3NG1A 5CFPA 1VSTA 3FA2A 1MJGM 3W3ZB 3CV3A 5IZ4A 2XCUA 1KI9A 1C9JA 4QGFA 4TX1A 1JNYA 1U2TA 4IX1A 1AGNA 4WWHA 2JGKA 3WP1B 3K94A 1GPDG 1EP2B 2VZLA 3BXOA 3L1VA 1GP2A 2M1XA 2D1TA 3DL7A 4NABA 2OBMA 1VJ0A 2X42A 3QYPA 2X4LA 3S68A 3W8FA 2ACWA 5DRYA 5BQPA 3RU3A 3BE8A 3DHYA 3ICCA 4JR1A 4KJZA 2O8CB 1XKXA 1IQPA 1Y8RA 5AK0A 2J5BA 4EJSC 4KDRA 3RYCB 1ETUA 2PZLA 5EP2A 1DFIA 3HB7A 5CVJA 4FHZA 4JJ8A 5EZYA 1M2WA 2JBAA 3H42B 4AQDA 5AQEA 4FT2A 2YOFA 3I2KA 2RJ3A 4BZPA 2Y1XA 4M37A 4BO0A 1EVYA 1BXGA 4KXMA 2VF7A 4J4HA 1P5FA 1RC1A 2B1JA 1U0NA 1LBSA 3UZUA 2YZGA 1MW9X 4F6RB 3SR4A 1F9EA 4OHWA 3OPYI 3J7AC 1KKMA 2YHAA 2YY7A 4B8ZA 1S3GA 1VJ1A 2H16A 4YC7A 5TDHA 3IEPA 4PANA 2VYVD 3ZGVA 4OYRA 1GAWA 3FOAA 1SKYB 3G9QA 5BSGA 4AJHA 2MT9A 4PE5B 3JWEA 3GGGA 4NNJA 5GZ6A 1NV8A 2BYTA 3DTNA 4DIOA 3WWDA 3B5IA 1V1MA 3ABRB 5CFMA 2O2DA 2NX2A 2BEWA 2DQYA 2XD9A 5GGYA 1PQYA 3IX7A 1XF9A 3GCZA 5ALSA 1KEEA 4M8NE 1K75A 2C4VA 1HYEA 3E3AA 2XHZA 5JCJA 1N2OA 2O3TA 2MYUA 3S27A 4ID9A 1ANKA 5A7HA 3TSOA 1EVEA 3OAAD 1QFMA 4X64B 3TEFA 1LW6E 1T5BA 2XW6A 1NONA 1U8FO 1YJ5A 3PUVA 3FYUC 3QE2A 4REMA 4F5DA 5MF6A 1CULC 2H9AA 3E8MA 3MINA 2J5QA 4JI5B 4JJKA 3S81A 1B73A 2WYVA 1NF8A 1L4YA 5JO0A 2FI1A 1J39A 1YUNA 1XVTA 3JVEA 4V1CB 5JZMA 3NWPA 1WP9A 4IDQA 4ZAYA 1JDBB 3GDOA 1G2IA 3I2GA 2WINI 1A82A 1ML3A 1QPBA 4PCVA 4Q9LA 2R8BA 3KJIA 1G3UA 2O8VA 5DHRA 1ODCA 3LT5A 5TEVA 4HWGA 4V0KA 2HNAA 4QPJC 3NWBA 2PGNA 3NONA 4X61A 3ME5A 3V7NA 1RJGA 2ZUBA 3WX0A 5DNCA 2UUAB 4H08A 2IEYA 4KPUA 4YRSA 5A05A 1U02A 4XR4A 4AG3A 1SVSA 2FPPA 2PQMA 3EOAI 4L4ZA 2MIIA 2I6GA 4Y2VA 2P2GA 3T0IA 3L82B 4ZCTA 2JFVA 3ER6A 3H84A 4ZYWA 2P9FA 3WNCA 4XB2A 5LWQA 2IE0A 1FDOA 1VKRA 1G5IA 1LS6A 3HRIA 4N47A 2B34A 2OPBA 3LO8A 4NOJA 4UULA 1MEOA 1DRUA 2RFLA 3A9CA 3AESA 2VNKA 5K0FA 1JIXA 2FYTA 1GKUB 4HTFA 4MJ7A 4D6PA 4DQKA 4F6LA 4CEHB 1IN5A 4FYHA 4RX1A 5F5NA 1I8TA 1YD7A 3VHLB 2EFGA 4P8RA 2Q5QA 1FSZA 3M4NA 4OJMX 4FWBA 3ND6A 1PG2A 2R7LA 5CVVA 2J8ZA 1GZ5A 2AOWA 4ZPJA 1PV2A 3TAXA 4DEVA 3PTLA 5EG5A 4PFSA 2XCOA 2O19A 4YFYA 5K0TA 4XH9B 1ODLA 2PPLA 3EFOB 2ZPUA 3AR7A 3WR5A 4XTRA 1YE3A 1VIVA 2XDQA 3EBPA 4V0SA 4JUBA 5KHAA 2PZJA 1L4MA 3RUEA 3W5UA 1K5HA 4DARA 1KYZA 1UZAA 3I28A 5BNIA 1GNRA 3NXKA 4L0CA 3TGLA 4MHTA 1ADGA 1U8UA 4RSMA 1JHPA 1I36A 2FB9A 3FDFA 3GLFE 1I4EB 4IXWA 1NYQA 2VPQA 2P6NA 4GOXA 1J21A 2QW0X 4CV3A 1IM5A 2PDAA 3PGKA 1QO9A 3X1XA 5HIKA 2AZMA 1A04A 1F2UB 1L8QA 4BVHA 4GC5A 4LRSB 5FHQA 3D6UA 5CCEA 3HVHA 1YB6A 4M4SA 1LJ8A 5AWFC 5K0NA 4Q3LA 1UZUA 4A6DA 3GI1A 5I3CA 5I7FA 4D5EA 4CEIA 2K4MA 1XQ6A 2V9ZA 3SJBA 3DG9A 2Y4NA 2E4YA 3FUTA 5TJ9A 3TZEA 4EJMA 3RVJA 3GUZA 4HWRA 5CVUA 2L82A 2P5YA 1II8B 3Q7SA 1S3FA 4IWXA 3OCCA 3NHKA 2BMWA 4GLFA 1TVKB 4R2MA 3BWBA 3U4QA 1YB1A 2HEGA 2XSZD 1SBHA 1UP7A 4BE9A 5CB4B 4RE6A 1K98A 3EVAA 2HRDA 2CHQA 3HKEB 5AOAA 1WMFA 5GGXA 3T1NA 1HSOA 1XEWY 1IY8A 2OSVA 4TYPA 1ZC3A 1QV9A 3KALA 1JAYA 3KKZA 4M7WA 4YCAA 3UAYA 4DCUA 3RSGA 5BMVB 1D2NA 4LY0A 1ZD8A 3WIOA 4XLLA 4I99A 2Q4TA 3Q7QA 5C46F 4PO9A 2X0NA 4N7MA 4DCMA 1UADA 4IIBA 2J46A 1HL7A 4UTPA 4H1TA 2JHFA 2I2WA 1KAGA 5EGNA 1SCIA 4D9KA 3VBEA 3TW8A 1T8UA 3LX4A 3CF2A 1POXA 3VAYA 3HL4A 1PIWA 2C5HA 4BTEA 3F6YA 3T06B 4W5NA 1O95D 1RRFA 3MTEA 4RU1A 1M0TA 4C07A 4HWKA 3E7PA 4IX9A 4HZUA 4K9LA 5CEEA 2VTVA 1SUBA 4H15A 4D56A 3VXKA 3W6ZA 3PGMA 5KNCH 2R4TA 2PKRA 3OJOA 3V4FA 4M1QA 4ERNA 4UFPA 1CIJA 1QH1B 2O2YA 4HDRB 1M1YA 5ED0A 3ZPXA 4B34A 1H2AS 4NX2A 5BNFA 1SA0B 2HQSA 2QTRA 4BNZA 1WY7A 4FFSA 4LWOA 3SIRA 4DSTA 1FBNA 3QE0A 4H4DA 5ALLA 3AL3A 3C4QA 3NM6B 3LPDA 1UC8A 1LTHR 3DGFC 3GZTB 1W9MA 1JILA 3SI7A 5JIBA 3OIDA 3AR6A 2PU5A 1SU8A 2A0UA 5CDHA 1SC9A 1ZISA 1WEHA 3VR2D 2O2JA 3PNLA 1OFTA 4HY3A 3FMGA 3ZZ0A 2XZDA 2NXEA 2NUPB 4O4LA 1MJFA 1NWCA 1M1YE 3EG5A 5DZSA 3WB9A 1BQ3A 1OIWA 3ZQ6A 4HDCA 1PFYA 1XA4A 1E18A 2MTBA 5CFOA 4ED9A 2NIPA 1BMQA 1MA3A 3TUZC 4U6SA 2ZM5A 2RGYA 4G84A 4IWYA 2AFVA 1M0SA 3B1WA 4FFBA 2AK3A 4CF4A 1GTRA 2F4VB 4Q18A 4TUYB 5DLYA 2VC2B 3NVAA 2JEZA 3X2FA 5C5IA 1AGYA 4BC0A 3ZHYA 4MI1A 1U31A 5B64A 3JQ6A 5LBIA 1TAHA 3K0CC 3RS4A 3A1VA 2DT5A 1L5MA 4EUNA 1P3DA 3JW8A 1MOSA 3QI2A 1QHFA 4B2LA 4D3XA 3STUA 1YVUA 1LA2A 2JGLA 3AERA 3LT1A 3QVXA 1DZIA 4D8YA 1XJCA 3OU2A 4ARBA 1UXHA 4HHEA 4MYDA 3GZNB 1LWNA 2XIQA 1XRRA 3H1TA 2J9YB 4Q7JB 4CF6A 4YO8A 4M7RA 5JSFA 1SQFA 3H8JA 3GEHA 3OE1A 1E6EA 2QEQA 3SQOA 3KQLA 2QE7A 1S8OA 2CHGA 3RYIB 4JLDA 3EUWA 4C20A 4UE3S 1ZNXA 2HA3A 2W2OA 4XWAA 1SVLA 3RYHB 4M1YA 3ICWA 4GI2A 3RRXA 3MHPA 1V43A 2YNMA 3KB8A 2Z2ZA 3HZZA 2I4IA 4MOWA 1CY7A 2V5AA 4QASA 3KQUA 2FSHA 3UAGA 3R5KA 4PO8A 2XYGA 1Q44A 2Y2UA 4RIHA 4HFMA 5BN4A 4MMYB 2CJYA 1FUEA 1QGAA 1AV7A 2QPTA 4FE7A 4PONA 2WV9A 5HK8A 4EECA 3I32A 4EDFA 2UZ0A 1QLHA 3K73O 1UIMA 1Y0BA 5JJ5A 1H4SA 1JR6A 5IK2A 3VFDA 4LNAA 4NAVA 3WAKA 4N48A 4R1MA 3FOEC 1K66A 2ZB7A 1KEUA 3W2EA 3IKJA 3F7MA 2QL9A 3P0HA 3ENQA 4C4RA 2YWGA 4P7JA 2XBUA 1FBTA 3DZ8A 4XM2A 4G0UA 2EEPA 1IULA 3GY0A 2B1GA 4WZBA 3IOEA 3UXYA 3WA6A 1SHKA 4JUFA 5GM2A 4UAVA 3PICA 3VR4A 2OAGA 3HKBB 2HJGA 4X90A 2NACA 2Y05A 3ZU4A 2O8DA 5ALWA 2PGOA 1MORA 1W93A 1EP1B 3MB8A 2R6ZA 3H75A 1XHLA 1GGVA 1KSGA 2VYCA 3KYCA 1G41A 3OQJA 2HA6A 1G2OA 4JKOA 3I9KA 4X41A 3W5JA 1QX3A 2OWDA 1I5RA 1R7RA 1YA6A 1JI0A 3PX2A 3MGAA 3FNRA 1O08A 4O25A 1D1PA 1JQEA 1Y81A 3PQ5A 1NE2A 3LC7O 2ZZNA 5JISA 4EHKA 1QFZA 5AI5A 3JVIA 3SX2A 4W5OA 3M2TA 2VYFA 3BZUA 5EWMA 3OJEA 2OM6A 3OPMA 2XWSA 4XRRA 4Q05A 4E46A 3OEEA 3LVBA 5EJAA 3FNBA 5EPOA 1AY0A 3HLTA 2WD9A 2REXB 4YHBA 4RTJA 2FMTA 4JC4A 3LFHA 1FPQA 3HRKA 3RRFA 3KZNA 1CUIA 2ZETA 3KYJB 1NVMB 3AVVA 3R5SA 3N8HA 3IELA 4CCYA 3IAHA 2X77A 3K5WA 5EXXA 3W6OA 3OQOA 1GAEO 2GHQA 4L75A 1E96A 3SBOA 3TNYA 1QBKC 4KK4A 4KUHA 3K1YA 1DDGA 2GVZC 5D87A 1HQDA 4QU0A 2ZP1A 1LDNA 2VT7A 1BKYA 1K89A 4CU2A 1OI4A 3A2NA 2XCTB 3L9WA 4N41A 1QGDA 4YPVA 3J7TA 2GT1A 2XUQA 5IVPA 4GPBA 1ZJ6A 5HHTA 2F43A 4YMIA 3BSFA 1T3GA 1E8MA 3BCUA 1ZU4A 4WZBB 4O2AF 1Z7YA 3ZOKA 1XAGA 3AHHA 3PFCA 1FYFA 1XT6A 1HYQA 1HT3A 1X2EA 2AQHA 3PQ3A 2Q41A 4NE7A 2IYQA 1BXRA 4TMTA 3AEYA 1N6PA 3FMVA 4HVLA 1AGRA 1GFZA 3A2KA 4NCKA 1GAQA 2APJA 4UE2A 4MMZB 1PR4A 3IOMA 5CA1A 3FKSD 4XW2A 5IC4A 4OQPA 3ADOA 4LYHA 4LHVA 1F0KA 4M21A 4FYXA 2PFSA 2RHRA 3IL2A 5JQGA 3F5MA 3GXOA 2JD2A 2OP1A 2ZSHA 4KI7A 2SBTA 1QLWA 1YQXA 3KEGA 2HWWA 1O58A 1V4BA 2I3GA 4R6WA 4KB5A 4WXEA 3DC2A 2NO9A 2EKZA 4Y6LA 2NN3C 3C4JA 2FEKA 1T35A 4S3MA 4EJ2A 3ELBA 5L95A 2X4GA 1QV6A 1DDIA 3WRXC 2JCXA 4CM4B 4KZPA 3RASA 2RK4A 1SOUA 1DWPA 4YMWA 2QUAA 2RHOA 1B2RA 4L6IA 1NFFA 3NKFA 2B5WA 1CJUC 3QH4A 2POQX 4IDHA 4NIMA 1DHRA 1PNVA 1ZO8A 2QWXA 3BILA 3D8NA 4U0JA 1YMVA 3IUQA 4RUKA 2HI0A 3IVCA 3LXRA 5ADUS 3MD0A 1FUKA 1HDXA 3LOPA 2XMRA 3HQ4O 1XVUA 3E1KA 3FWHA 2QT9A 3DB1A 4WBNB 2RHLA 3B78A 3TI9A 3KB2A 5BRAA 2AD5A 3MRTA 1XTTA 4QGHA 1VCMA 4JLOA 3IKVA 4B2PA 1KO7A 1AO3A 4FYMA 4X5OA 2XYRA 4UM7A 3VR6H 5ERYA 1Q0ZA 4YROA 2A0YA 3MIIA 4G0OA 1WVMA 3E9CA 2YWHA 5DGCA 5AXBA 3R3UA 5DYNA 3JQBC 1PBTA 2C82A 3T52A 5K6AC 1VXOA 4C7VA 1KP9A 4Z4GA 4V0ME 4MW5A 3PXAA 1U7HA 4IGEA 4ESEA 3U0VA 2NUPA 5AVRA 1FQWA 5CURA 3DD5A 3VM6A 3QNUA 3CH6A 2AXQA 4N3NA 3WB2A 2X5XA 5EHNA 1CUXA 3O74A 1KMNA 4QO7A 1VKNA 4ZU1X 4JQZA 1EIZA 4CFYA 3CU5A 1B00A 1UBLS 2ZIXB 3KZXA 3EJ6A 3KEFA 1JEAA 5COQA 1QH1A 2BMFA 2CJPA 4HDRA 4Y7CA 4FIZA 4AJ1A 3CZ9A 3GGPA 4NNPA 3NT4A 4R3NA 1U4OA 1PYOA 2JRLA 4MUFA 4UVDA 2ETVA 3TD2A 3STYA 2O8EB 4YJ3B 2HLDD 3K5IA 5EGSA 3CTMA 5DT9A 5FFFA 5ALXA 4MKXA 3TSYA 3FSEA 5A9RA 3VHXB 3IMEA 4MUYA 1ONBA 4M46A 1R6UA 1WQ1R 2Q8QA 4YUWA 2L2QA 3EODA 1ZOPA 2EJWA 4N9QA 4B35A 4DHWA 4DQLA 5B7QA 1SC6A 1YS4A 4FMPA 4AP5A 3PHBE 1YBAA 4ZO9A 3C3KA 3K70D 1RJFA 5AK3A 2H4JA 1J2UA 1JR3E 2BKXA 2XNDD 1WABA 3ZV4A 4AJNA 3BHJA 2H1RA 4JLBA 4B4KA 3W77A 1CQIB 4FHDA 5JXHA 4AKGA 1KJQA 2FW8A 3I72A 3U4DA 4S04A 1BROA 1GSOA 2BZ1A 5BQFA 3M5CA 1JEQB 1H8HD 1N7IA 2WUVA 3Q5DA 3QWFA 4LQLA 1PD0A 1OC4A 2C2HA 4O08A 4BBJA 5CXUA 1BE0A 3K9CA 2BBWA 3ROKA 3ZLTA 2YTZA 1B8PA 1O6GA 4DLBA 1XKLA 4AZWA 1KTVA 3OPNA 5B2EA 2FP4A 1PJCA 2HR1A 3TOCA 4QBTA 4IH1A 4UXIA 3TSCA 3VR6A 1U7DA 1VIMA 3J81A 4F3TA 4H77A 2X5NA 2NW6A 5JDCA 2XH8A 2ZWAA 3FFBA 4GLJA 1VLMA 3CINA 5BWMA 1II8A 1KWKA 5ELXA 1KGSA 2K5UA 2W8BB 2OZLA 1CJVC 2GRUA 1XLUA 4LOKA 3HE3A 4EPWA 1T9HA 2Q7XA 1XZJA 2WK1A 1QP7A 3I30X 1GL7A 5EJGA 5SYAA 3RT7A 4REQB 4BYMA 1N36B 5CD1A 5SV2A 3R9IA 4RZIA 5MN4A 3KSUA 3KKKA 1K2WA 2JLQA 5JBIA 2Q0XA 1UCFA 3M81A 2XY4A 3UPDA 3SHFA 5EZ6B 3SDSA 1SOMA 4LQDA 4CHTA 1K7YA 5EUBA 1RSZA 2XRMA 2PO5A 2J3HA 1X8LA 2OCKA 3AKEA 3OWXA 3Q7EA 2WSBA 4IGAA 4TXLA 5EIHA 1HF3A 1QGYA 4LA4A 1LTQA 1X74A 2F3PA 3L05A 4PFJA 5IABA 4G81A 1NKVA 1UEJA 3TUIC 3SZGA 2XODA 3AZPA 5TGZA 4BFCA 2H54A 1TZJA 4RZSA 5DWVA 4F5EA 4BX9A 4J2TA 4F3RA 2X8WA 1HDIA 1HT1E 1MJNA 2WIGA 3EFOA 3BB1A 2I33A 4E5YA 2GN1A 3L18A 3EXEA 3TQRA 4DPMA 1VPVA 3NX4A 1SQ0A 1RR6A 2RG1A 1DAEA 4M9SA 5JMTA 2FZCA 2QENA 2ZIXA 5IN4A 1C3JA 1TYDE 4DYDA 3L6DA 1QIKA 2ECPA 4FX2A 2AN9A 1HNZB 4QZVA 3U37A 1N34B 2VP5A 4BGUA 3SQMA 2N9UA 5EAIA