1SZNA

The structure of alpha-galactosidase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
417
structure length
417
Chain Sequence
IVMPDGVTGKVPSLGWNSWNAYHCDIDESKFLSAAELIVSSGLLDAGYNYVNIDDCWSMKDGRVDGHIAPNATRFPDGIDGLAKKVHALGLKLGIYSTAGTATCAGYPASLGYEDVDAADFADWGVDYLKYDNCNVPSDWQDEYVACNPDFVKTGPNGTCTTALDPTLAPPGYDWSTSKSAERFGAMRNALAKQSHEIVLSMCIWGQADVFSWGNSTGISWRMSDDISPNWGSVTRILNLNSFKLNSVDFWGHNDADMLEVGNGNLTAAETRTHFALWAAMKSPLLIGTDLAQLSQNNINLLKNKHLLAFNQDSVYGQPATPYKWGINPDWTFNVTYPAEFWAGPSSKGHLVLMVNTLDITATKEAKWNEIPGLSAGHYEVRDVWSDKDLGCLSSYKAAVAAHDTAVILVGKKCQRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-galactosidase
publication title Crystal structure of alpha-galactosidase from Trichoderma reesei and its complex with galactose: implications for catalytic mechanism.
pubmed doi rcsb
molecule tags Hydrolase
total genus 139
structure length 417
sequence length 417
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2004-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17801 Melibiase_C Alpha galactosidase C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1sznA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1sznA01
3TCEA 1P0KA 1U5JA 3M6YA 4Y9AA 1PS9A 1H1YA 4XUGA 2CU0A 3CZEA 2RKXA 1ZJIA 5I3HA 3IVUA 2ZCGA 4O17A 1OK6A 2QCGA 3IVTA 4N6EA 1CXEA 2WSYA 2QEZA 1OFPA 1N7KA 4LVAA 2Y7FA 2J9YA 3VM7A 1DL3A 1A50A 2XN2A 1VFMA 3I7RA 4PC8A 2NUXA 2WPGA 3VCRA 2BSLA 2ZTJA 1XSJA 5G2IA 3A23A 1VCFA 3CTTA 1KA9F 2A4AA 1UD2A 4M6QA 3CM4A 1EB3A 3P80A 1V3JA 1JRBA 4UQ9A 6ALDA 1I8JA 1KGWA 4WXZA 1HVXA 1UD6A 2WNZA 1ICSA 2O7SA 1O5KA 4Z0SA 2VT0A 2NWRA 2HS6A 1GG0A 4TMBA 4AEEA 3H54A 1CYGA 4AB4A 1PS3A 3O15A 3TA6A 1ZAJA 1WO2A 4AH7A 1TJRA 2DJLA 2YW3A 2I1OA 1JCXA 2EF9A 1MSSA 4IMFA 3BVTA 3LTYA 4UMAA 2P10A 4OJYA 2GQ9A 2CZEA 3HGJA 1QW8A 4Z1DA 2XN0A 4QAIA 1F74A 4DEFA 1LZOA 3LCWA 1I2RA 4TVUA 4LPCA 1R30A 3C56A 3NQGA 4JD4A 5EMUA 4UR8A 2V8ZA 5K7JA 2D3LA 2QCEA 2P0OA 4IXXA 4LY8A 3LRMA 3WDIA 3TDFA 3TTSA 3S6DA 3SZ8A 3RNDA 2A7PA 5TIMA 2GJPA 3MHGA 2H3DA 3ELFA 1Y7VA 4J3UA 3DI1A 5K4XA 2V3DA 3BCFA 3TAKA 5A8GA 4HPJA 2E5CA 1JUKA 3VSTA 2ZRZA 3M7WA 4PH6A 1ZAIA 3DGRA 1WA3A 3GNDA 3LHYA 4UTWC 1QX1A 2TRSA 3ANYA 3G0UA 3BVWA 4QJ1A 2E0PA 1YYAA 3W87A 3OLIA 5E0FA 3KWXA 1YDNA 5I3JA 3MI6A 1GVFA 3GBDA 1JL8A 3LHTA 2VXNA 3W7HA 4PEKA 3P74A 3W22A 3NZ1A 1KW1A 3IEBA 4RKAA 4UNKA 4AXKA 3WJXA 2FGZA 1BTMA 3W7DA 3NM3A 1HX0A 1LP6A 2ZX6A 3CLWA 2NXHA 3ABSA 4RXFA 3W72A 2E5BA 4GI9A 3PBWA 2DH2A 2CWNA 3I7QA 3UPBA 2PRLA 5LNVA 1FWRA 2CLEA 4BFAA 4H2CA 3IIZA 2G3MA 4JIQA 3UXDA 3W9ZA 4ML9A 5C54A 3C61A 4FNRA 1C8QA 1UASA 1G67A 3FA5A 4LWWA 3WDHA 4DF0A 4ALDA 3PB2A 5K9DA 4LXFA 4B9YA 4JTGA 3W7KA 3QMRA 3O16A 1EP3A 1HL2A 1OT2A 1M7PA 1K3UA 3GXTA 3THAA 5F7UA 3Q37A 1F6KA 1AG1O 2RDWA 3ZFHA 4NNCA 1MFUA 4UTWA 3G8RA 3P7YA 1H62A 5IBXC 4AYSA 5E6YA 3WY3A 1VJIA 2H90A 3NL5A 2JK2A 4JL1A 3ZQ9A 3G0SA 3P5YA 4AWTA 4CNPA 5HQEA 3L5MA 3W76A 1V5XA 1QDSA 3CZGA 3GDTA 1VAHA 2A21A 4JL2A 3QMSA 4LUJA 2JKAA 1EUNA 1J0HA 5FF0A 2J88A 3A21A 3FYOA 3Q94A 5DO8A 3EXRA 2QCMA 2BY3A 3N3MA 1J0KA 1UBSA 3BAXA 4HNUA 3M9YA 2NX3A 1HWWA 1XSKA 4CKQA 1QMLA 2E1DA 3HB9A 5EBUA 3P5ZA 1W56A 4K39A 1SMDA 3QW4B 5D2WA 1DQXA 3HJEA 5A2BA 1PEZA 3NDOA 5LGZA 2Y89A 1VZWA 5DXYA 3LTSA 3TMLA 2TAAA 3VE7A 4UTMA 2ISVA 4N9EA 5DCDA 3ZT6A 2H8ZA 4JICA 2QCHA 5F2IA 3BG5A 4Y90A 5AC6A 3LHVA 3W7CA 4ZL1A 1TCMA 1KM1A 3WMSA 3D4ZA 3RIKA 4JTIA 1PL9A 3UWWA 4FB7A 4ZQCA 1VLWA 3NO5A 5IBXA 1IV8A 1S5VA 3L4YA 1H60A 3EX2A 4NNBA 1XH0A 3GXDA 3ATZA 3QYQA 1RD5A 1TPB1 3DFOA 5F1VA 3HJZA 4MZ1A 4EF8A 4MVAA 2CFFA 1FX6A 3WNNA 1OYBA 4NZFA 1PV8A 3L21A 2VEPA 3IGSA 3S1XA 1KWGA 2A5HA 3NQMA 1KBKA 1I4NA 3UG4A 3FEMA 5E9AA 3W7IA 2W0UA 2A2IA 3E0IA 5AHLA 5A6LA 1KFJA 1LRQA 1BVNP 3LDVA 3QMTA 3W7JA 5AOUA 2V3EA 2EKCA 3O63A 4HT3A 1U30A 3RU6A 2EQDA 1R34A 5KITA 3EWZA 3IIVA 3IV3A 3PUDA 1CGTA 4ICNA 2WVUA 5D02A 1QWNA 2DP3A 3W7GA 2Q8LA 3BAYA 1QO5A 2X30A 3QJAA 4LC8A 2EPHA 3DAQA 3Q2DA 2ZE0A 2QMJA 1ME8A 2V2HA 2VFDA 4Y96A 3OLDA 4FNTA 2TMDA 1RP9A 4BA0A 4QIUA 1CX9A 2E68A 4JTEA 4K38A 4M19A 3VGDA 5DFAA 4TX9A 2BY1A 4JYEA 1W9XA 3II1A 1QR7A 4M6VA 4LVGA 2HTMA 4K6AA 4S2CA 3PVFA 1Z42A 4UFKA 1Q45A 1SW0A 4JIPA 4NXKA 2OSWA 4KKXA 1XBXA 3ZOAA 2DZVA 3PWAA 2A85A 1G9HA 3LCXA 2C8NA 4AVFA 2YJQA 1BEUA 2E4TA 3FKRA 5CSRA 4O53A 2OYMA 3M5XA 2V5LA 2E8YA 2ZDRA 3NEVA 3NXFA 5AYYA 3W75A 3LI0A 2FTPA 5KZDA 4PFMA 3BCDA 2J24A 3W23A 3O6CA 2P1FA 3I65A 4WSKA 2TYSA 1SO5A 2X2JA 5HUPA 3DX1A 4J3VA 2OYLA 3EJPA 3UERA 1GTEA 3E96A 5I3KA 3TX9A 2EAEA 1TQWA 1TRDA 1MVYA 4RV8A 3W1AA 5BRQA 2Z6JA 2F7FA 3KEHA 4BI7A 2YA0A 5L6UA 3F1QA 1CXHA 2XVGA 3HGRA 1K7XA 4A2RA 1O94A 5CXPA 3GZ3A 3AO0A 3ZS4A 4GUJA 4UXDA 2FIQA 5G2WA 4AYGA 3L5LA 4Z1BA 5FEZA 3L2IA 1D3HA 5G2HA 1G4SA 1DTUA 2ABAA 4XQ6A 1NM9A 1W3TA 5E1QA 2NV1A 4RCXA 2VEMA 3DDFA 2V9DA 1XDMA 2WNNA 3WELA 1YXCA 2Y63A 3LOTA 4JCLA 3QC3A 4HIBA 3G1AA 1WZAA 1IIGA 4MYXA 2B0MA 3KL5A 3AJ7A 4W9TA 3BMVA 1HXKA 1ME7A 1RP8A 3PR2A 3RLUA 3WNLA 1JCNA 1G4PA 4WY0A 3OEXA 3EWWA 2F7RA 2PWFA 2FJKA 3GAKA 4FO4A 4NJKA 2Q3OA 2NXIA 1FWWA 1IZJA 5ABTA 1TB3A 2C0AA 2CLKA 5A6MA 4N6FA 3WJZA 2WSQA 1UJPA 4XKYB 2FFCA 3D0CA 5DLCA 2QUVA 3LB0A 1H5YA 3NR0A 3D52A 2NXGA 4JYFA 1H61A 3DX0A 4X22A 3BLEA 3CIWA 3NPWA 1VFOA 1TQVA 4Q33A 2VENA 4IX0A 2FE0A 1H7PA 1GYNA 3BUDA 1UOKA 4H4IA 5HWJA 3W83A 5AN7A 2OW7A 4CN4A 1WV2A 1WZMA 3NQDA 2J25A 2YDAA 3KRSA 3MYOA 3ZO9A 2A0NA 3G3MA 3OIXA 5I3GA 3STGA 4ZMGA 4JXCA 1EA9C 5EKYA 4U33A 3O1NA 5J5RA 4KMQA 3BUIA 7TIMA 4PODA 1UD4A 3V1PA 3NPVA 3W07A 3G8EA 3FFSA 1W3IA 1YDOA 3NM1A 2JKEA 2YPIA 3TSMA 1TSIA 5TBOA 3C8FA 1FWSA 3KL3A 2PWEA 3GR8A 1QPRA 1H3GA 4J7RA 5FF7A 3TC7A 1BPLB 1JCMP 5HWNA 1SO4A 4GUHA 3UG3A 1TMQA 1R2TA 4LC6A 4I9AA 3BVJA 4FNPA 3EWBX 3L68A 3FJ6A 3QEZA 4O1AA 4XKYA 1GVOA 1TQXA 4MOZA 1FXPA 2CLIA 2NV2A 5HINA 4JS3A 1TV7A 4JY8A 1B57A 3W84A 1ICPA 3DFSA 4LRSA 3SJ3A 4CNOA 1Z48A 3UWVA 1FCBA 4IJBA 2ZA1A 5D30A 8CGTA 5CLWA 1FBAA 4YMZA 4LS0A 3W3OA 3WDJA 1XKYA 2Y85A 2ZICA 1XXXA 3HPXA 1OX4B 2F7PA 1EEPA 1JQXA 2TPSA 3DENA 3TAOA 2V82A 3VX1A 2ZZ4A 1F7BA 1RQBA 3PC0A 3DFPA 2YSWA 3FYPA 4WD0A 5LSMA 4GNJA 5HULA 3UY8A 2ZX8A 3G3DA 2PRHA 2VFGA 1QWGA 3HZ3A 1G7VA 1UA3A 1I2NA 1WBHA 4JTLA 2BY2A 1L6YA 3EDFA 1MZHA 1H7NA 2ZZ3A 1LOLA 1PZ3A 1BSIA 1KXTA 1XD1A 3UG5A 2VNCA 4EVZA 4FLQA 2I14A 4CCEA 3A47A 1RR2A 4LV9A 3M5ZA 2ZTKA 4ZQRA 1I75A 4NX0A 2ALDA 4O54A 3MBDA 1QI4A 1JUBA 4O11A 3TH6A 1G69A 1X1ZA 1XDLA 4CNNA 3TXZA 1E3ZA 2YW4A 2WVSA 2R91A 2A7RA 2X2GA 3CWOX 1WP6A 3L9CA 2LLEA 1SMAA 5AHFA 3PG8A 4NQ1A 2IGTA 1J0IA 2FHFA 1ZS2A 2A6LA 4CVWA 3BO9A 4NJHA 5AC7A 4JYDA 1KXQA 5D03A 1OX4A 1E40A 3TSDA 3DH7A 2X1SA 4A29A 3UWUA 1DHPA 3IJ9A 4JY9A 3UD6A 3VX0A 5KEZA 3MP5A 4N9BA 1TPWA 1WYIA 4MY1A 1TQJA 5DBUA 1XCXA 1MEIA 4G1KA 3ZSSA 3CZLA 4M7TA 4O52A 2ZXDA 4PSPA 3M07A 3QSRA 4JR5A 3HGSA 5U7SA 3BGGA 4A3UA 4JTTA 5D04C 4DBDA 3W2KA 1VYRA 4O4VA 2GJRA 4WF7A 1YLVA 1LOQA 3KVJA 4IMGA 2UV8G 5C6MA 3NZRA 1XC4A 4CQ8A 4O28A 1CXLA 3WJYA 5I3IA 3LXCA 3FIGA 2NSXA 3HOJA 1EO5A 1K03A 3DU0A 3P60A 1DBTA 4JTSA 3C2OA 3LBCA 4Q4KA 4Z08A 3NQEA 4C1KA 3KAOA 3OLEA 3FOKA 3W71A 1LWHA 1KLZA 3BSHA 4FX8A 5BOOA 2D0FA 5LNRA 1IXNA 3G0XA 3W2NA 3MWAA 2FQIA 5BMWA 1QNVA 2FPVA 1EP1A 1SZGA 4TU1A 3NYZA 2VOMA 2OCZA 3ZSTA 3LHUA 2ZZ7A 1QHPA 2ZWYA 1OGSA 3CV5A 1R75A 3UWZA 3KE0A 2V0TA 3BW2A 4HPXA 4NX5A 1QO2A 1D3GA 1WDWA 4UCGA 2C13A 4UTTC 1WZLA 2WCGA 1EP2A 4N4QA 2FDSA 4NNAA 4JN6A 4WXYA 4UQBA 3C52A 3ATYA 4GI6A 2ZYFA 1FCQA 3W7EA 4EF9A 3OVQA 2E6AA 4AWSA 4C1LA 3SIZA 3P84A 3BW4A 3W88A 2ALWA 2CXGA 1WXJA 3KRZA 4IOTA 4UTIA 3GXNA 2YYTA 3QFEA 4FEZA 3PY2A 4TIMA 4ONVA 3W7PA 3B04A 2ZZ2A 1VC4A 1LLZA 3M47A 4JCMA 3HF3A 3SI9A 3PS7A 3NNTA 1XUZA 2ZXBA 1TPC1 2BHUA 3KL0A 3WNKA 1JD7A 3FLUA 2PE4A 5I3FA 2CHNA 4JFWA 1LCOA 1WBJA 4O1CA 3OBKA 4J3TA 5A2CA 4J3SA 1S5WA 2OMAA 4FX6M 3AJXA 1SZEA 1IIHA 3G22A 1TYGA 2DJXA 1KTNA 3R5EA 3CTLA 1IF2A 2XVLA 3SY5A 1ONRA 4EOUA 3EWXA 3MO7A 2BXVA 4MUZA 4CN6A 1MEHA 1D7FA 1GVIA 3QM3A 4O1DA 1VPXA 1EO7A 1GYLA 5AHIA 3B4UA 2D2OA 3O06A 3IIXA 3O8AA 3LTPA 1VYSX 1TPDA 1G7UA 3FW6A 3INPA 3E9AA 1ZCOA 1H7RA 3TSBA 2R14A 3W2MA 2D0GA 4GXMA 3EX6A 4IQLA 3STEA 1UH2A 2QCCA 5AHNA 3L67A 5F4WA 1X7FA 1JQVA 4UTTA 4OIFA 3LRLA 1CW2A 3P8JA 3GAYA 4AMWA 3QPYA 2EABA 3A24A 4JX6A 1K8XA 2C15A 1OFDA 3TE9A 3VMNA 1SUXA 3DKLA 4U3CA 1EX5A 5CZ0A 4NUWA 3PAJA 3CLMA 1V7YA 5I0DA 2XWEA 5FESA 2FPTA 1WPCA 3GTNA 3F03K 1YPFA 1UD8A 4NJJA 1NSJA 4DF1A 3ZT7A 1HFBA 1E51A 5G5IA 1CGWA 1EIXA 3BAKA 4MY8A 3O6DA 4GKLA 2G95A 1JXKA 1J5TA 2QAFA 3W1LA 5BW6A 1OABA 4CCCA 3W6YA 4HKPA 2PWGA 4E38A 3STFA 3BGJA 1AL7A 4X3ZA 1XUUA 4PCTA 4DELA 4TMCA 4KWUA 3N73A 4OBTA 3TK7A 1YXYA 1K7EA 2JBMA 3HPSA 4DBEA 3CWNA 5FEPA 1W5MA 1JUEA 1K02A 3KHJA 3GIYA 4BWLC 2BXZA 4KFOA 1JDDA 2QF7A 3TJXA 2CZFA 3GR7A 4GQQA 4U31A 2CZDA 2I9EA 4DO5A 4R53A 1CGUA 3QSTA 1QPKA 4CQAA 5LZLA 3TUUA 1CXFA 1RPXA 2IQTA 4J27A 2X16A 3ZWTA 3LLDA 1KXVA 2OSYA 3KVMA 1VJSA 3B0PA 1QOPA 3FJLA 2G3NA 1UA7A 4U4MA 5HWMA 4UC5A 3TJLA 3TQ0A 3KRUA 1H50A 2EADA 4YWIA 1XH1A 1A53A 2FLIA 1PHQA 3MI2A 3G1VA 3W1QA 1VRDA 3CC1A 5AYXA 4E0CA 4A2SA 2F7OA 4NJGA 1SFJA 3S5NA 1BF2A 1F76A 3K8LA 4Q32A 3BLBA 3VI2A 4O19A 1GG1A 4RZ5A 1YTDA 2E5DA 3RFAA 1BAGA 1HTIA 1XM3A 5CSSA 1KGUA 4QM1A 2BTMA 3WN6A 2WV8A 3VSVA 2WJZA 1QAPA 1QPOA 3G1FA 1KCKA 3GYEA 3T7VA 4FNQA 3UCQA 4OT7A 1THFD 4BWLA 3JS3A 4J3WA 5D38A 4FNUA 1PIIA 4QAWA 1F6PA 1CXIA 1R47A 2QJHA 4UZSA 4FXRA 3CHVA 2BHYA 4LRTA 2CLOA 1SW7A 4OGZA 1W0MA 2X1TA 5EL1A 2FH6A 5DCBA 4MAZA 4JFVA 3ZT5A 2VR5A 4GUFA 1X6UA 3M1ZA 3W1XA 3QH2A 1KM0A 2GVJA 4M6PA 1QI3A 4QNWA 3WFAA 3DDGA 3T40A 2BX7A 1EWEA 2E09A 2WSKA 4YL2A 1VFUA 5T26A 3WY2A 1ZALA 1YADA 1JRCA 1KBIA 1L6WA 3EJUA 4QITA 3BAIA 1MW0A 4QSHA 1O5XA 2ZXQA 1P4CA 4ZQPA 1QOQA 1ODUA 2F2HA 4ZVJA 2ZRYA 4LW7A 1TV8A 1NAL1 3UWQA 2VFHA 1SO6A 4MJZA 1CI1A 3CB8A 4BI6A 1H51A 4K7YA 1IXOA 1QPNA 4UQCA 4GINA 4AEOA 4X0NA 3H55A 2PWHA 3HBLA 1WE5A 2NWSA 4UNLA 3GXIA 3SECA 1WX0A 4N4PA 2G5WA 4CQ9A 2QCFA 1M53A 1EUAA 1ZNNA 2WNQA 1HL9A 2X1RA 1CLVA 2ZXAA 1QPQA 4P61A 4FF7A 4IPIA 4JGDA 1GVSA 3VGEA 3USBA 2Y62A 3QQ0A 3N34A 3QPZA 4WSJA 3LGEA 1W5PA 2WPBA 2HMCA 1LTDA 3D4YA 3WNMA 3M5VA 2C1HA 1U2YA 3WNPA 2Y88A 5CKSA 5CZTA 4KWWA 4WQ6A 3MP4A 1F5ZA 3M0ZA 5HNRA 3T78A 1JCYA 3VGHA 3PSVA 2FHCA 3JRKA 3P61A 2NUWA 1BVZA 1NFBA 1RZMA 3DBPA 3RF9A 3TOPA 3SSJA 3LV5A 3BW3A 2YA1A 5DCEA 3NQFA 2DZPA 3NPXA 3AMKA 1JXJA 3W7QA 4WY0B 4Y8FA 3W37A 2E9BA 1ZJBA 4R33A 2QJIA 3LCIA 1HL8A 1SU5A 5BNKA 1JR1A 2ATSA 3MHFA 4MY9A 1OFEA 3MMTA 5CLTA 1B3OA 1PCWA 3T4CA 2F7QA 1H7OA 1MXSA 3TONA 2VC6A 3BUQA 4HP5A 1NEYA 1NF0A 1Z44A 1DVJA 1TTIA 5FF4A 2A7NA 1OFQA 3W7LA 5I23A 1H7WA 2E77A 2WNWA 1M7OA 4UTKA 4RR4A 4DPQA 5AC8A 3HPZA 4Z0JA 5H2ZA 3K1DA 3ZR5A 4JX5A 2E6DA 3R12A 1SPQA 1KFEA 4MJMA 1TCDA 4WOZA 3W74A 3L4WA 4YCPA 3H53A 2NT1A 4IX2A 4XTDA 1AVAA 3MJYA 2Y61A 3E49A 3EDKA 1I2PA 2B7OA 3NQ7A 3S0CA 3W2JA 1OG0A 5HJLA 3M43A 2V30A 1GQNA 4GI8A 4M5PA 3K8MA 4AHQA 3L65A 3CZKA 2ATMA 4AHPA 4UTHA 4B9ZA 3CIXA 5D2TA 3EJQA 4JTFA 2AQWA 5J5DA 1LROA 4JTUA 3TQVA 1K8YA 3DXIA 1ALDA 1B9BA 3G1XA 2QLYA 1HNYA 1UCWA 3THQA 2YA2A 4BR1A 4WUIA 3SGUA 3EX4A 4H8UA 1OF6A 3LHZA 3WY4A 1GJPA 4UTUA 3PG9A 4X2RA 4YLWA 1YPIA 2C16A 3SGZA 4S2BA 2VRQA 5C2XA 1HO1A 1PIFA 3G18A 3CEUA 1PCKA 3ZR4A 3P82A 4CCDA 2OX1A 2QCNA 1PAMA 1QCWA 4I7UA 4IMCA 5FEXA 4UNIA 3LBMA 3LCHA 3N19B 1A47A 4KWVA 1RPKA 4ORIA 1XCFA 4OHQA 3NQ8A 4XTIA 3A6OA 3TFCA 1G5AA 1OVDA 1EHAA 1B4KA 3AMLA 5C55A 4K8EA 3KLKA 3BG3A 4GWEA 2XIBA 5LNUA 4FHAA 1XSIA 1KM2A 4CN1A 1C9DA 4GIAA 3FS2A 3E02A 3R8RA 1M6JA 4IXHA 3F4WA 3TR2A 5E93A 1UH3A 4AF0B 1SR9A 3NGJA 1DORA 4QQ3A 1LLWA 3BMWA 3B06A 4NI3A 3M16A 3NAVA 3C2EA 3FKKA 2QUTA 2ZX9A 4NJIA 1T0OA 3GXPA 1Q6OA 1T8XA 3L4XA 5EA9A 1OX6A 3VNZA 2YZRA 4FIQA 1HTYA 3U6WA 2YCEA 5CPOA 1OK4A 3YPIA 1KFCA 1F73A 3EWYA 2GJNA 4NVTA 3VGGA 2GQ8A 1SSDA 1ZAHA 3K30A 5FF3A 3P81A 1KM4A 3NL6A 4UFIA 3W1RA 3W86A 4H8VA 1VS1A 5DY3A 2ZBTA 3BG9A 2D0HA 1AW2A 4BF9A 5IM51 3LX9A 4YCOA 3P8IA 3LLFA 4FX7A 1L2UA 4Y6GA 2D73A 3A9IA 1TQSA 4GUGA 4RZ4A 3C2FA 1GPWA 2WVVB 1W5OA 3BK0A 5CZSA 2EEXA 5MHBA 3B0UX 1V3KA 4GQRA 1MFVA 2YOCA 3NQVA 3PUOA 4TO8A 4OKDA 1DKWA 4AF0A 3OG3A 5CGQA 4QNEA 3VNDA 1TPFA 2XIIA 3LXBA 5I5RA 4JEQA 4RZ6A 1JCJA 4RJEA 2QCDB 2BY0A 2OZ0A 2Z6IA 3P62A 2PURA 4H3DA 4HOWA 4YXGA 3UZJA 1LDCA 1SO3A 5HR6A 3L0GA 4Z1AA 3NQ6A 3S5YA 1I2QA 1M7XA 2GVLA 4LVFA 4K8HA 3NVTA 3UZ5A 4XWUA 2DU2A 3GKFA 5G1YA 1P0NA 1G94A 3M5YA 2DZWA 4GRSA 3W73A 4N9DA 1CGYA 4JDYA 4UR7A 3BAWA 1UD5A 2OT0A 1N8FA 1JJKA 4CLMA 1NOFA 3L0KA 4X9SA 3LPOA 4WJEA 1TV5A 4HNTA 5H91A 4RX0A 4HOZA 3GDKA 3ABRA 4X9YA 5D05A 7CGTA 1FQ0A 2F1BA 1DEDA 4OQVA 2FHBA 3MI3A 3W85A 1UUMA 8TIMA 1JGIA 1JF6A 1AW5A 2E8ZA 3SFKA 3SR7A 1ZFJA 1DHKA 1DV7A 2V3FA 1YDVA 2ZUWA 2WVVA 1SFLA 3G1DA 1OYAA 1AMKA 5BRBA 1RV8A 1CDGA 2ZUUA 2E6FA 2WO5A 2Z2UA 4HNVA 4KFNA 2RH9A 2AGKA 1H1ZA 1UKSA 4UFJA 2QCDA 3EB2A 3IIOA 3CEPA 1PHWA 2C7FA 4IWWA 3MYPA 1KM5A 4K7VA 3WNOA 1ME9A 3KFTA 2VRKA 2ISWA 5K9CA 1QW9A 4AWUA 4IUOA 5GVJA 1S3HA 2Q3RA 3TFXA 3A5FA 3EDDA 2Y70A 1IXPA 1X1OA 4HN4A 3LCLA 3DZ1A 3F4NA 2QDHA 1JIBA 1KFBA 3N9SA 3GKAA 3R2GA 1TQUA 1ZJAA 5TQLA 1D3CA 2CLHA 1Q3NA 1GWJA 1TO3A 4UZUA 3S9YA 5D2XA 4LOCA 1XCWA 3BLPX 3C0JA 2Y5EA 3UXAA 3PM6A 3NG3A 1ZENA 2Y7DA 4HA1A 4O10A 5EY5A 3DHDA 2VKZG 1OX5A 4B5NA 1VR6A 3O05A 1UKQA 3O6YX 2YX0A 3OLGA 4UFLA 4O14A 1CGXA 3PSWA 3TW7A 1R2RA 4AW7A 2RFGA 1V3LA 2H6RA 2C14A 1AW1A 4R7JA 3NA8A 3CPUA 5FI8A 1Q4NX 4JTKA 1GZGA 4AIOA 2Q8ZA 3BVVA 1GVRA 4DQWA 1LWJA 5KSWA 3RMJA 3PBUA 4BI5A 1SZNA 1XGZA 4PCFA 1KWKA 7TAAA 1KBJA 1TPUA 2JKPA 4N9CA 3ABQA 3VMPA 3TC6A 3C4UA 2CLMA 4WY0F 5D09A 3GDLA 3S42A 3L4TA 1JI1A 1OB0A 3QGVA 4MLJA 5A2AA 3QZEA 2W79A 1P6WA 2F18A 5FEWA 1TPEA 3VKJA 2YFNA 3WK0A 3U8GA 4W93A 3L2LA 1OJXA 1HUVA 3K8KA 2XVKA 2C3ZA 1W31A 5KTLA 4UQDA 3W7NA 2R8WA 2CLLA 4XB3A 3MUXA 2BXYA 4FNSA 3CZSA 2J27A 4OV9A 2BWGA 3TTYA 2VELA 3NPUA 2ZZ5A 5F2LA 3B05A 4O0KA 2QJGA 4WLCA 4OU1A 4IMEA 4UQEA 5LNWA 5EPDA 4JX4A 2XN1A 2WQPA 4DXVA 1KBBA 4OWGA 2ZUVA 1T96A 5E6ZA 3HQ1A 3TU9A 4HNNA 1LYXA 2YIHA 3STCA 2XWDA 2DIJA 1UUOA 1X8FA 3JR2A 5SWUA 3QW3A 4PEEA 4JTJA 3SW6A 4GJ1A 3N14A 1TJPA 1H7XA 5E70A 5L9FA 5AYZA 4PSRA 3NL2A 2DZUA 4LT9A 4A22A 4UIOA 4ATWA 5KINA 2A6NA 5LHEA 3E12A 1FCVA 2H8XA 3HO8A 1HG3A 1JI2A 3LRKA 1ZY9A 3W1UA 1VIWA 2FB2A 3HMJG 4UTJA 3PULA 3EDJA 1JD9A 1DOSA 3CPRA 3VFLA 3NOEA 1SZFA 5U4NA 1P1XA 1OFRA 4MB1A 3DX4A 2ZRUA 4UTLA 1G6CA 4NU7A 1YTKA 3N2XA 4U28A 2PC4A 2Y24A 5DBTA 3BAJA 1PE1A 2X1UA 1Q6QA 4H8HA 2NX9A 4J9JA 4GO8A 1OFOA 2YKKA 4O12A 1T99A 1JG9A 2ABBA 5K4ZA 2C19A 4FLSA 1JF5A 9CGTA 1E43A 4HSOA 4L4MA 2AAAA 4LNYA 3BVUA 2JGQA 1XH2A 5DY2A 5KZEA 1GTHA 2VEIA 4NZJA 1C8VA 1WZKA 4U2ZA 3LERA 3S8HA 5AB3A 4JFSA 2GVYA 4JDBA 1KM3A 2YR1A 3L4ZA 4JFUA 4KFPA 1KCLA 1FUYA 2RDTA 3P67A 3WK1A 2EHHA 2PCQA 1GVQA 4FIRA 2R94A 3HG2A 4AIEA 4I7WA 4O15A 4H7VA 3R13A 3KLLA 3EJRA 2JGYA 2Z0IA 3KVKA 2C6QA 2GUYA 3Q58A 4R34A 3EJTA 2BLEA 3QQ1A 3DHUA 1E3XA 1VLIA 3BUBA 3GNNA 2H3BA 4WX2A 3N2MA 4UCFA 1W8SA 4WZHA 5D33A 1KTCA 1MXGA 1W1ZA 4AEFA 1KFLA 4J3XA 1J2WA 3O07A 1B2YA 4ADSA 4DPPA 1H63A 3FAWA 1W5QA 1K8ZA 2GVGA 3LCFA 4XZ9A 3PF3A 5LHFA 3GDRA 2PRMA 2XFWA 2OSXA 1OYCA 2ZQ0A 3HGOA 1VYPX 5F4SA 1OF8A 2YXGA 4HOXA 1PJ9A 3BLIA 2AMGA 2F84A 4GBUA 2ZUSA 5EMYA 2QPUA 1Y0EA 3M41A 3TV8A 1LRTA 3EX1A 2NT0A 4MKNA 3EX3A 1PZ2A 3TIMA 1AMYA 1IGSA 3WK2A 5HMSA 2C18A 2WANA 4MYAA 2NZLA 1CXKA 1QI5A 3S5ZA 3I68A 4S1FA 3EDEA 3UEQA 3GDMA 3L4UA 2F61A 4LS1A 3W70A 2ZRXA 1JFHA 4GC4A 1PPIA 3OHIA 3I6RA 2QMKA 2V5BA 3BH4A 4RXGA 4O57A 4UFMA 4WOQA 1KGXA 3GLCA 4GO9A 3DFQA 1B0IA 5D2VA 2ZA3A 3DKJA 2QKFA 1L0PA 1S46A 1DJQA 1GJWA 2CLFA 3ECQA 3CU2A 4MLRA 1Q6LA 3GB6A 3DI0A 4IGHA 5CGMA 3W1PA 3KX6A 1VQTA 5AHEA 5K3VA 3BARA 2CZ5A 1G4TA 4FMVA 3CZNA 2WSPA 1XD0A 1BWLA 1U83A 1GCYA 3VU2A 2EGZA 4AAJA 3B8DA 1QWUA 2TSYA 1JULA 2AAMA 1WOBA 3GXFA 3IK2A 1JCLA 1VHCA 1FDYA 1LOSA 3WY1A 5DELA 3EXSA 3ZR6A 1LM1A 5F4XA 2QUUA 5C5YA 3ABOA 1LBFA 2EACA 4MIMA 1HO4A 4ZZ9A 2WKGA 5D37A 1TMHA 2VFFA 4AMAA 3L66A 4OE7A 1BG9A 2Y7GA 1TPH1 2ZUTA 1XBZA 1XBVA 1NF7A 4PL1A 1BLIA 2EO7A 4PCSA 3BVXA 2BZNA 3A5VA 2QCLA 4GFSA 4RLIA 3HG4A 5KZMA 2ISSA 1R33A 2DH3A 3WFZA 2ZWZA 3LPPA 3S2CA 2RDUA 3NQCA 3VMOA 1CIUA 2DZXA 5DN1A 5HR7A 3HG5A 1OHLA 1OSEA 3UWYA 4O50A 2HSAA 4ZQNA 4MZYA 3IIPA 5BMXA 2ZZ1A 3T55A 4K36A 3PBYA 4M56A 1O4UA 3EKLA 3UY7A 3B0VC 3C6CA 1MXDA 4P2VA 3DC0A 2A1YA 4N2YA 4HPHA 3UPWA 1V3MA 3LXAA 2OT1A 4LU0A 2Y7EA 1A5AA 1CGVA 5G4WA 2WKLA 2PWDA 4UQAA 6TIMA 4NT0A 2OW6A 3TNOA 1TQTA 4E2OA 1N55A 3IGXA 5CG7A 2YFOA 3GVGA 3EKZA 4LQ1A 3D50A 1VGAA 1KTBA 4UOZA 3HIJA 1W5NA 1IZKA 2WVTA 4M7SA 5E0KA 2B7PA 3DFNA 1M5WA 2QR6A 3UQNA 1KV5A 1TPVA 2GJLA 4ADTA 4RK8A 3GXMA 5I24A 3DX3A 1G4EA 2V2DA 3A4AA 2KZHA 4E2DA 2FB3A 3NL3A 1AK5A 3CQ0A 3MHUA 3TKFA 1TIMA 1UKTA 6TAAA 2GOUA 4ZQMA 3IJ7A 3WJSA 1TTPA 2VUYA 2CW6A 1S5TA 1LBMA 3MW7A 3VM5A 3BUPA 3WEMA 3PBVA 4CGTA 1MEWA 5A5WA 4UMBA 2DIEA 4AMXA 3M44A 4M8UA 2Z1KA 1BKSA 3RLVA 1DJNA 4NXSA 1AQHA 4LS2A 1A5CA 1OFBA 3L0NA 4OV4A 3LCGA 1MW1A 1KLYA 1A5SA 1HT6A 1LBLA 2DORA 3TQKA 4J28A 1VCGA 1VCVA 2GPTA 5LKYA 1AQMA 1KV8A 5G1TA 2FYVA 4UOQA 1MO0A 2E6YA 2Y4SA 3GK0A 3IVSA 1I2OA 1FDJA 3EXTA 4PTNA 2ZRVA 3OVRA 1FCUA 3G1HA 1SW3A 3KXQA 4ZQOA 5LGXA 2DZTA 2B7NA 1VB9A 2VFEA 3BV4A 3VE9A 3LV6A 4Z1CA 1CPUA 3VNYA 5DXXA 1P5BA 1SQ7A 1MWOA 1Z41A 2J9XA 3WK3A 4D2JA 1JDAA 2B7QA 4A21A 1EA0A 1O7DC 3VO0A 5EYWA 1UB3A 4O4WA 1I45A 1YXDA 1OT1A 1J4EA 3S5OA 2WKJA 4ADUA 5CZJA 2GQAA 2O7QA 3RILA 3EWUA 1TTJA 1MW3A 3B03A 2G96A 3NQ2A 5HPOA 3TROA 1ML1A 2QAPA 4PL2A 5HDRA 1EH9A 4O0ZA 1KM6A 3G1SA 3DFTA 1RQHA 2ZX5A 4O1BA 4MFEA 2ZZ6A 3UNDA 4TR9A 1W54A 1RQEA 1IXQA 1EWDA 3G24A 2WC7A 5F1UA 1R2SA 3EJSA 3BLFA 5CPNA 1GEQA 1KXHA 4LVBA 4EWND 3BPWA 3OA3A 3T44A 2HS8A 2DZSA 4L4LA 1VHNA 5BRPA 4BK9A 3AXIA 1XI3A 4FLRA 1O60A 5AHMA 1GT8A 5D2YA 4O8RA 3LHWA 4LUIA 5AFDA 1LRNA 4H6KA 3DX2A 1F05A 4FXSA 1D9EA 3DHFA 3OVPA 1NVMA 3IRDA 1VH7A 2YYUA 1K7FA 2J9ZA 2RHGA 1L6SA 1FWTA 4BZYA 4LVDA 2ZX7A 1U33A 4XBSA 1J0JA 1MW2A 1G1YA 2NX1A 1RVGA 2WSRA 3CT7A 1PIGA 2QPSA 1JDCA 2WCSA 3GX9A 3S1VA 2EJ1A 1EPXA 3W7OA 4ORMA 4POCA 4MPQA 1F2JA 5K2ZA 4EIVA 1JVNA 3S1UA 3WJWA 3BSGA 1B4EA 2X2HA 4K37A 3L2MA 5F2MA 1QFEA 5G4EA 1FY6A 1PVNA 3W1TA 4FLOA 3NQAA 4JTHA 1XV8A 3IJ8A 1WQ5A 1L9WA 2VEKA 3L5AA 3MP3A 4UFHA 1C29A 3EEGA 1XBYA 4QISA 3C3NA 2ZIDA 2NLIA 4LTSA 3VSUA 2D3NA 4UMCA 2Z1BA 3RK8A 5FF2A 1TRIA 3MBFA 3IGUA 1JAEA 3BLKA 2V81A 5TD4A 1UD3A 2OYKA 2W6RA 1LORA 1XFBA 3ZWSA 1A5BA 3FAXA 3LM7A 2QDGA 4E2BA 2OJPA 3BC9A 1O95A 1QHOA 1TTQA 4I7VA 3W1NA 4XBKA 2J6XA 1YTEA 3W1MA 4UUIA 5D32A 1Z32X 3C2VA 3W38A 3R89A 4DO4A 1GJUA 2B4GA 3VGBA 2GUUA 1AL8A 2VFIA 4IMDA 3N9RA 4O18A 3CGTA 5CGTA 4IPJA 2X2IA 5F2GA 2ZFAA 1UH4A 3QF0A 4MFDA 3QRHA 2BHZA 3A22A 1WOAA 3U2OA 3W2UA 5LNSA 2G97A 4MZ8A 5CPMA 3VGFA 4HHPA 5K9XA 5KMYA 5HXMA 3HG3A 3LI1A 1OFAA 4U2YA 2ZRWA 1FXQA 1GOXA 1W3NA 1DQWA 1ZHAA 1Q6RA 1ICQA 2FH8A 4GE8A 4JFTA 3UYCA 4LV4A 4PA8A 3V75A 4HSNA 4DF2A 5CPLA 1BWKA 2QV4A 1KB3A 3WEOA 3TW6A 3GBEA 5HUOA 1WAUA 2ZA2A 3C2RA 3PB0A 4JNMA 1KFKA 2EAWA 2V2CA 1TREA 1ADOA 3DHPA 4AHOA 2FPYA 1FDZA 3I7SA 1FWNA 3G1YA 3KVLA 3PUEA 3TXVA 2CPUA 1XL9A 3W2LA 3AXHA 3TMQA 2NUYA 3KOFA 3S1WA 6CGTA 3W7MA 3L4VA 1R46A 2Y6ZA 3W7RA 1SSGA 4O13A 2WOQA 4GUIA 2YGYA 4O16A 1W37A 3WENA 3D51A 2F1AA 2Y2WA 4DO6A 4N02A
chains in the Genus database with same CATH superfamily
2MNUA 2V9QA 4Y9AA 5DYOA 2WXFA 3S98A 1KPVA 2BMKB 2J9YA 2H32B 3MJ9H 2CSPA 4N85A 5A8NA 3AIUA 2HPMA 3URBA 1CJYA 3L3IA 3CM4A 2NQJA 1ICSA 3XISA 1JJUA 1P84J 2GI0A 4HT1L 3TA6A 4OLWL 3TESA 4AM0Q 1LM8V 3QORD 4IMFA 2WLIB 3IDYC 4LLDA 4BKNA 1TYJA 4OUUB 3BKJL 1FKXA 4LY8A 2J88L 2FGBA 4R97C 3QZWG 4K7PX 4BV1A 5E1AB 4AIZB 3HPJB 4N9GA 4CSTA 2MOGA 3UZYA 3Q3GA 3M7WA 1ZTXE 3AQDA 3WTUA 2WOYA 5DMLA 2ADJB 3P73A 3ZTEA 3G0UA 2DV0A 3TH4T 1CTMA 2VXNA 2CJUL 3WFHA 3NZ1A 4QP0A 3AY2A 3ZE2E 1FWRA 3F7RA 1NWOA 1G1KA 5F7YC 4DERA 4E41E 2WTRA 4JIQA 3O6FB 4X6BA 3UXDA 5IVXE 1I9JL 4PRDB 5HHXL 1M7PA 1K3UA 2G4JA 3PGFL 4E9TA 4PRHD 5AW0B 1BM3L 1JFQH 5MEOB 1XLIA 4OFKA 2H47C 3KYAA 1GA2A 4I0PC 4NCC2 3G0SA 1QVOA 5FX3A 4YBQC 3ULUC 5C0JA 4KRMB 3MRHB 2J88A 1YJDC 4BM7A 3T8QA 4L4OA 3DX8B 2V5TA 3RKDD 3FH8A 3RRQA 3HJEA 5D1XE 3RUGE 3ARSA 4AYID 3HQOA 4IIZA 2XDFA 4CEUC 5AC6A 2RAGA 2IAMA 1TLMA 3WMSA 2OLAA 1WBZA 3CXFA 1UZ6E 3RZCD 2UVEA 3DFOA 3CV1A 4GXVH 3UTSA 3OV6A 2H9GB 4XUYA 1VGKB 4P5TB 3BISA 1SXBA 3WIAA 3D30A 1L5GB 2W0UA 2A2IA 3L23A 4YVVA 4WWNA 2EKCA 3GTVA 4I3RH 1CK0L 1U30A 1UQYA 2ZAIA 2AK4D 3QJAA 3O7UA 2Y8UA 5FAGA 8XIAA 3WEBA 2TMDA 4K7FA 1JZGA 3NCMA 3H22A 4R83A 1S7UA 4PTTB 3NACH 1QR7A 2FWUA 4K6AA 3MUHL 1E6JL 3T09A 2VZUA 3W29A 3AWOA 2GJ6B 2V9UA 1XBXA 5H35B 3VKCA 1S78D 1KCBA 5DJ8B 4QPEA 5LCVA 2J24A 3LDBC 2TYSA 5I02A 2X2JA 2CM5A 3TX9A 1P0DA 3IB4A 2C7UA 4I9WE 1FFNA 3C0SA 1AQ0A 5IDZA 4H1LG 4FI8A 3SRDA 3VCNA 2XY1A 4HMDA 5GRUH 4Y19B 2G9HA 3LZFH 3L2IA 3RDJA 1PKNA 1G4SA 1YRKA 3DURA 5K5YA 3FQ2A 3LZOA 3AJ7A 4Y4FD 2XN9E 1RP8A 1JCNA 1GR7A 5A6TC 4MDIA 1XF1A 3SY8A 5KS9B 2PTTB 2Q3OA 1E9OB 3WQEA 3EMZA 4HIHB 3TZVD 4PV1C 5DLCA 4DK3A 4G5ZL 4ABUA 1NGWB 1L0QA 2PWVA 3L9RB 5CKAA 3ARTA 3A12A 1OCZB 1H4PA 4C6MA 4AZUA 3BP6A 1WZMA 5CP3H 3WKQA 3GFUA 3QDGD 4OFQA 4ZMGA 3SURA 4JXCA 5EKYA 1N6QH 1U8LA 4QLRA 3BUIA 4GUPA 4FF9A 3TQPA 4KTYA 4MJ5B 5TBOA 2PWEA 2P8LA 3GR8A 1U95B 2YEZB 1VFAB 5IESL 2DD8L 3TPUB 4WKFA 4JFXB 1TQXA 4Z7WB 4R4BB 4JY8A 1CI3M 3IMTA 2R29L 5FGCE 1DIOA 2NZ1A 1M41A 2CCVA 2SEBA 3C5JA 3WQCA 3WDJA 1NCBH 1XXXA 3L16A 3UTTB 1CWVA 2BS71 3AIQA 5I6LA 4Y9BA 1G7IA 5LSMA 4GNJA 1ETB1 2XG4A 1I2NA 2TRHA 4XSMA 1OGTA 3CUIA 5CEZE 4IQDA 3QE5A 5I76A 2DW7A 3F8UB 1QR1B 4F7CB 1BG1A 3VPLA 3RNQA 4AD5A 1Q9OB 4RBPK 1IO4C 3H2FA 5JOPD 1XR8B 4YE0A 4QXTB 3CVIH 1NAML 1TQJA 4WHTA 5DBUA 1MEIA 3QPXH 5AAMC 3ZSSA 3QSRA 4NYLA 2OCJA 1UWEL 1U3HD 4BFBD 3WS3A 4WHCA 1Q0XL 2R29A 3LXCA 3UROR 1QACA 4BRJA 3NQEA 5DZOA 3VJ6A 1EL3A 2OXGB 5DUMH 4I48A 5D1XA 5EG6C 5CCHE 3RUGA 1T4KA 2WB7A 2E7CA 3FQ4A 4D8PA 4XP6H 3A4DA 2AJUL 2HRGA 4EEEA 1RZIB 4PHZA 1Q0EA 4A39A 1KCWA 3ATYA 3EH5B 1Q7QA 1XX1A 3NCWA 4YHIA 1WBYA 2LAGB 4Z7OF 5ID0A 2D7NA 5D7IF 4M7JL 3HF3A 1YLBB 5DS8B 4YK4B 4FADA 4YGAB 5F1IB 4PLJD 5DK3A 5EUOB 4IQHA 2H3NA 5C2CA 4PJIB 3C75A 3NABL 3L3JB 2J75A 2DIAA 3LD8C 4EOUA 4P8UA 1NAMA 1AGFB 3QM3A 2AS5M 2Y2YA 4ZX3A 1VYSX 1FLTX 3TSBA 4J4PA 1FNEB 1NC2B 1JQVA 3NJVA 4U1KB 4EP8C 4OZFH 4AMWA 1KXVC 2H3XC 3OKLA 4EQ2A 3RY5A 3WYZA 1FYHB 3D47A 4DNHA 3D48R 4XXCC 1WPCA 3KPOB 4YJ5A 4LUSB 2QAFA 3R1GL 1OABA 4PS7A 3POHA 3LY6A 3ABMB 1IGTA 4PCTA 4DELA 3N1PC 1BREA 1YXYA 3U36B 3B2DC 1JUEA 5CC7A 1GGCH 3GR7A 3NEOA 2JI2A 1QPKA 3R4RA 2YRBA 1QBMH 4MNQD 3MV7A 1E67A 5IQLA 3VI3F 2Y36L 1KCRH 3BFQG 1UA7A 3QDMA 3O0RH 2F8XC 3V4UH 3NWRA 5LIWX 4E0CA 2XN9A 1T83C 4MJ6B 4J1UB 4DYJA 1BAGA 3K6OA 4XN2A 5CEZL 3G1FA 4JGUA 3MROA 4UQ3A 5F7BA 4ALAL 3PFMA 4KBXA 4FXRA 2HWZL 1MUCA 1WFNA 3ARWA 3FFDA 4QNWA 3OODA 3VI4B 2BX7A 1DIDA 4OF0A 3IPWA 2WJFA 4L18A 2XA3A 1MLCA 3IGHX 2HUHA 2G41A 1DWIM 2CIPA 4JFDD 3HURA 3X3FL 1V8EA 4G8GD 3VQ2C 3FBQA 5JH1A 3CN0A 3LGDA 5GS1C 5DD3L 4FF7A 4IPIA 1GVSA 2IQ9L 3SEPA 1OF0A 5DHDA 1W72L 1AMXA 1QLEL 3QQ3B 3VWKA 3QISA 3PJTA 1JCYA 5AECA 4JQXA 1RZMA 1A5OC 4XNQB 2VLJE 1LF1A 5L8KB 2BWDA 2WMIB 2E9BA 4NFCA 2QJIA 4PCYA 1BF6A 2BP8B 1H0IA 1ET8A 5GSVB 1B3OA 1H6UA 3CQKA 4GKSB 3DX6A 1BQ5A 3EFOB 2XFFA 4K2UL 4Q0XL 5AC8A 1JK9A 3SCMA 1T0MB 2B1OA 2NT1A 4YE4H 5I19L 4L37A 2AQOA 5DFVD 3FSZA 4WWKD 1BECA 3FZUC 2FBJL 4GGBA 5BYWA 3K5SA 3NA4A 4NKIL 3QZ6A 2IKJA 1HIZA 1B4JL 4JE4B 4YQXL 2EDOA 3GIVA 2V8LA 3M0XA 1OP5K 1IJ9A 5MEQA 2C16A 3AABA 1JPSL 4A8IA 1VFTA 3CEUA 1RJRA 3KLAA 3P82A 1EJUC 3AG1B 4AI7A 4M1DL 4Q6KA 4I7UA 1PAMA 4O1EA 3CAQA 1XIWB 1NIUA 4UDUB 3F64A 4A3QA 5BXRA 3A6OA 1M2VA 3W0WB 3RAOA 3FS2A 4HZLA 4ANXA 3TA3C 5E93A 1T1ZB 1TG8A 3AQXA 4ODVL 4CMHB 2AV1A 3CPLA 7ODCA 4ZUTB 3KPSE 2C4XA 4BXVA 5HGBB 1MPAH 2EUZA 3KHDA 1CT5A 1P4BL 4PP2B 1QSED 5FACA 3JV6A 1E8ZA 4EJ1C 4LCQA 3IACA 1XLFA 1LWIA 5FF3A 4OH2A 3WLTA 3FUEA 3SAZA 2QUNA 4X8CA 4JM0A 4Y6GA 1J1XH 3IGAA 4XV0A 1KN2L 4B7LA 4OJAA 3EGDB 1MCOL 2WMHA 5HHNB 5K9JH 1QRKA 4RFOL 2CERA 4HOWA 1V7NL 4XWUA 3S37L 2IGLA 2DQFB 4HDIB 4LASH 4ZAKC 1E6SM 1JJKA 3LPOA 5M17A 5D4HA 2DMGA 3IKKA 5F71A 3B6SA 4FYQA 4Y2LA 5F7LB 3G7TA 3X11A 1AW5A 4FA3A 2Z35A 5JW3L 1JXGA 1R17A 3HW7A 2X10A 3JYCA 2ZF9A 3HS0B 2WO5A 4LCCA 2HJFB 3L5WB 4OJFL 2PDLA 25C8H 5I82A 4MD4B 3EB2A 3IU4H 1Z5LA 1LXMA 1KYUA 3U0TA 4DP5X 4Z7OE 4I1NB 4PVMA 5BV7C 3SDAB 4MCZB 3KYKH 5D7IE 1DXEA 2Y5EA 4MXWL 1FP8A 3GFZA 4HA1A 4ODWB 1P4IH 3R8HA 2WWNA 4HFWB 1Q13A 5IJVB 2KMWA 5ADPH 1Q94A 2CRIA 1CU4L 1OAZL 3RMJA 4HS6B 1SZNA 4LB3A 4L29B 5E9DB 3S3BB 1TJIH 2GAZB 3TC6A 3C4UA 4HUUA 1C90A 1T21A 4XPTL 4NKCA 32C2A 3S3DB 3M0MA 1A5FL 4UDTB 1TPEA 5AVHA 1T41A 3L3DA 2XVKA 3UPRA 4JG0L 1XFCA 4TUUA 2CLLA 2BWGA 1JBJA 1IBFA 1SYSA 4NDMA 2QVTA 4DVBA 3HG1B 1NA8A 3N14A 1YMME 3HS8A 4W4OC 2VLKA 5CMAB 3AIRA 5KINA 3VI3E 2OZ4L 2VLJA 5I73B 4LVOB 3HR5A 3DV4B 3RGVD 2FB2A 3HMJG 1DZ0A 1SZFA 1X5AA 2V8MA 5ENWA 1FCGA 3RZCB 2H1LM 2YWZA 1R0AH 2XFYA 3GBNL 5JQ9A 2ABBA 1CB2A 3VDCA 1F3DJ 2ICWB 5CC6A 35C8L 3FN3A 5KZEA 3LERA 4QXUH 4LAOA 1FO0L 4JDBA 5AD0B 4OB5H 2VGIA 5IGXL 5ABFA 1T0PB 4UM9A 3D18A 4JREB 1VLIA 1QHQA 3AXKA 2UXFA 5TE4L 2HVOA 2KL6A 5F6HJ 1W1ZA 4ZO8A 3EYFB 5JQ6L 3PZ9A 2YPVL 1RZFH 2A83A 4TNVF 2P5WB 1KKRA 2WANA 2OZ4A 3FEQA 6PTDA 5HNUA 4JGNA 1M6UA 1KSRA 1GSMA 2O5YL 3AU6A 4PB9H 2UY5A 3OC5A 4P2RB 3KYMA 3AG4B 3FFCD 3DKJA 2GBUA 3S88L 4IHCA 2OGYA 5B1BB 4IIQB 3VU2A 2VX6A 2OWWA 3ALWA 4PVNA 2FR4A 4Y1TA 4M9PA 1JNJA 2VIRB 2UY3A 4ZPVA 2GG1A 1V79A 2X4UB 3FT0A 2VKWA 3WFEH 4AMAA 4OE7A 3VYPA 2Y7GA 2BOBB 2JVUA 4PCSA 2EO7A 5AW2B 5DZAA 2MSPA 3G04A 1GOOA 3BZFB 3T4YA 3PBYA 5G4WA 5EZOL 5EOQL 4YL4A 4L3EB 4HMCA 1E4KC 1BF8A 2Z1SA 4Z3HA 4JG9A 3GVRA 1W5NA 2QADC 3MRGA 1R9YA 4GZ7A 3JVAA 1RQ5A 4Q9BA 5C0EA 4RK8A 5FKAB 1UROA 5LXGH 5TE7H 5F96L 4QRTB 2GOUA 3F7VA 1VPYA 2XSAA 4QTIH 2YL5A 4KKRA 1PZAA 5AW1B 4NRZA 4OR1A 2CBMA 3MXWH 2CC0A 3WJLC 5CNHA 3CFJB 2DQGH 3NIDF 2WYHA 2L7QA 1CDUA 3EOSA 5FLVA 4LOFA 4OJCA 3BV4A 5D7IA 4PJGF 3CSGA 3QUXC 2FDMA 1J6OA 4AIBA 3T1FA 1I7UB 3ZVHB 4AGPA 5I6SA 3S5OA 3GBLA 5IJDC 5M94B 4ADUA 2IBZX 4YHEA 5HY9B 4AK2A 4XMVA 3DESA 2Z31D 4U1HB 2YL8A 4P4RB 2WC7A 1R2SA 1KXHA 4K71C 2NYYC 4NIKB 5AVYB 3LHWA 2WQVA 2MEJB 5DJ6B 3CH8A 1XLCA 2F53E 3MA9H 5AZEH 4LYKA 3S96B 5IMLA 3LM3A 4YHOH 4P49A 2CKRA 5IWLA 4D3CH 4GNKB 2RUSA 5MKGB 4Y88A 1E5ZA 3N42B 4G8EA 1JVNA 5D9SB 1YMMA 1O5RA 2BGSA 1QFEA 2BNJA 2WINB 1C29A 3VI3A 3C3NA 4LTSA 2PFHA 2Z1BA 1KPRB 3IETB 5CM1A 3P3BA 4Q7NA 2J77A 4JZJA 1FWXA 3ZWSA 1GYCA 3LM7A 5FECB 5D71L 4J2MA 3VD7A 5EO9A 1KTKE 2YD9A 5JZ7D 3GJFK 3K71B 3GMRB 1AL8A 3OR7B 4ENEC 5H8MA 2X2IA 2QVMA 2G97A 3LRSB 1UWFA 3HG3A 2QL1A 1Q8MA 5LNGA 1DQWA 4JZOB 1N3NA 1J87A 1NCUA 1T1YB 5D72L 5J8LA 4HEME 3HN3A 2RQ8A 3ARBC 5HI4D 3GBEA 4UT6H 3RP1A 3VOFA 3TXVA 1IGFH 3EGSB 1HKMA 1M7UA 3AMDA 4YMPA 3QJHA 3W7MA 3EZ8A 4YHGA 2H32H 4O16A 4KJQD 2F5BL 1DBAL 3JWOL 5L0QC 3CSFA 1E0XA 1DQTA 5KN5B 2XJLA 1UR3M 1E4MM 1D6VL 2ZONA 3B9OA 2YJLA 4WJ8A 5C7ZA 2Y7FA 5D96C 2OX4A 2OZTA 1MFNA 2D9QB 4PY7A 4XP9L 1JRBA 2GABA 5TAOA 2DZEA 4EI5B 1XGRB 5ICXB 15C8L 5HGDB 5C3TA 3TVMD 1FWIC 4H7ZA 4J3OD 3BO8B 2VDNB 3MU3A 3NPSB 3H85A 1AA1B 5E56A 3PZIA 1SEQL 1MZZA 1FP9A 5FYJD 1NGPH 4OUOA 3LCWA 4U1SA 2P5EA 1OIMA 2DIBA 2V8ZA 3IEAA 3RG6A 3PHQB 5T1LB 3KPLA 2V6AA 1ZVSA 3S6DA 4XN9A 2FNWA 4Y8DC 3HNVH 3DO4A 3DHMA 5EFDA 3AXXA 5H2BA 3VOGA 4UMSA 3W87A 3DJ9A 2OMZA 2GSIB 3VXQB 3RIAK 1JL8A 5E8NA 4FLHA 2PWUA 3WQWA 5EF3A 3GHRA 3RY6C 5I75C 1KBLA 1HX0A 4AVOA 4X83A 2ZSVB 1D7KA 5E94B 2P24A 3WS6C 3TV3L 3CUJA 2K3TA 1EUUA 1MFCL 3ZLQC 2H2PD 3VE0B 3D7PA 1IFHL 5BZDB 1F6KA 2WC3A 4G8IB 5AVQB 5HQEA 4AFYA 3MGOA 2B77A 3E8VA 1G9EA 5GGRA 1E5JA 5FF0A 2G0LA 3VTTA 5I17B 2BY3A 4DN1A 2JELH 3BAXA 2E6PA 3OR6A 3TJIA 1QMLA 4K39A 4DB7A 1IC5H 3QW4B 2AEWA 1HQRB 3SO3B 5ISZE 3THML 2CHOA 5CCGE 5DCDA 3V5KA 4GO6B 1SZRA 2G75B 3U7WL 4IKJA 3QYQA 4B97A 3SE9L 4MVAA 2CFFA 3ZDYB 4Y9PA 4HGXA 5JMRA 1ZDQA 2DMBA 2A5HA 1GHRA 3NQMA 3MRIA 1PZ0A 2WUCL 4NQVB 3O6FD 1XIFA 4APXB 3QFDA 1KRAC 3LDVA 2V3EA 3FT1A 1MYRA 1IBGL 5DQJA 5E8EB 1GGIL 3IIVA 2W88A 4E42A 4P4KC 5JOFB 2ZCHL 2XI9A 3GLDA 2VC2L 1SLUA 4A04A 4KI5D 4M81A 2VFDA 2Z93A 1B0WA 1W9XA 4M6VA 5JIPA 4X60A 3VFUB 3PVFA 2PPGA 3VG0L 5IMOA 2C8NA 1IGIL 3UTZA 4XVSL 3KTXA 1OC6A 3WJJA 3PAYA 3OHXA 3T3MB 3LI0A 1ZIBA 3PFRA 3NIDE 1A4MA 2NY0C 4PJGE 5MENE 3ECWA 1UUSA 3M8OL 2OKOA 4ZS6D 3GZ3A 4JO3H 4UXDA 3GSNA 1EHKB 3SYCA 3ZHNA 5G2HA 4HEMA 3ROOB 3UH8A 5JBDA 5J1TC 5H4YA 2RJGA 4YGVB 4P5TD 4H1LA 1IIGA 4LHUG 3QPQC 3F58L 1ME7A 3RLUA 1G4PA 2XWRA 4FTDA 4NJKA 4PBXA 2A3EA 4NO3B 2Z8SA 3PGDB 3HG0A 5A6MA 4GMTL 1BJ8A 3BPNC 2WWKO 4NUPA 4YDVA 1YE6A 1UA6H 3W11C 1X38A 3Q8BA 4NM8L 4HJ0D 4IX0A 4G9PA 4GMSH 2RJMA 2IDFA 5AN7A 3T1GA 1AXSA 5C8BB 2J25A 3C5ZA 4L8SB 3G3MA 4IKNA 2GJ6D 1F90H 1J8VA 1UXSB 2YPLE 4K7PL 4PODA 1JZFA 3V1PA 3G8EA 4XZHA 3QHMA 2HKHH 1J9QA 1P5UB 1AZNA 3EKGA 2H6OA 3EWBX 4Q8OA 2RACA 2E1WA 4PP1C 4EN3C 4FXGC 1S3KL 2PI6A 5IQ9B 3O3DB 1J9RA 3E0GA 1TV7A 1B57A 4Y19D 4REQA 4BH7B 2Z1WA 4HYVA 8CGTA 1QLFA 4Q9RL 2ZICA 5AOLA 3WHE1 3HPXA 3IYLW 3G3LA 3CN1A 3CWHA 5ALBH 4PJ9B 4FQHB 4ZD3L 1T7YA 1MZHA 1FBIH 2G2PA 4AL8H 2PDNA 3UDWC 3U6RB 3WLOA 4H8WL 3DROA 1FHUA 1H3XA 4DEPC 4NN6C 4AV0A 3BJSA 3LZ5A 4LFYA 4NENA 4WNQB 3II2A 3NIFB 4G7YH 4J5VA 1WP6A 4ZFCA 1EFQA 1V08A 5D8JH 3P1VA 1BYNA 4MMZA 2QZRA 2I25N 4Z7QB 5F7DA 4MQXD 4CDHA 3SDYL 1RK0A 5KJRH 5A8QA 3UXFA 2C4FU 3ARUA 3PG2A 2QS8A 3GHEL 1CR9H 2GC7C 5F7WC 3HPLB 3KVJA 2UV8G 3NAAL 3H7VA 2YOAA 4AGNA 5TQ2L 2VQTA 3ZVVA 3NZGA 5BOOA 2PXYA 2Y23A 3UTTD 4W9LC 5ISZA 1TU2B 4I18A 3AWEA 1MDTA 2IMMA 2FPVA 3FXIC 3ECBA 1ITCA 4C55A 1PY9A 1EP2A 3NCJH 1PWMA 2VERA 4BZ1A 4EF9A 5B39G 3V9EA 3BP4A 3IDXH 2YYTA 4FEZA 3PY2A 4ONVA 5LKNA 2JQAA 2P7TB 4MX7B 5H8DA 4NWTH 4R3SA 1X96A 2X1QA 3IDYB 4WGHA 1UM6L 2X12A 5IHBA 1AQ8A 5IB1B 2PNDA 4KKNA 1ONRA 4CN6A 3B4UA 1TPDA 1RH9A 5CJBA 4ELMA 3BJLA 2GOKA 5BW7C 1AY1H 5DEZA 1H8NA 2XC8A 2DQXA 5KVMC 3P8JA 4PB3A 2BVQB 4YIQB 1F8IA 4FI6A 4K3DL 4Q9CA 1UZ8A 3AUVA 1DN0A 2C15A 2NY6C 5KBDA 5FESA 4W6WB 4OLXL 3THCA 3RDTB 3PL6A 5E51A 4FFVD 2XVBA 4R85A 2PB1A 4DP9X 4TMCA 4OBTA 4AM0A 1AD0B 1ORQA 3HPSA 4W4QA 5KVEE 3LEXB 5MENA 4HKJB 2VC5A 2NR6A 1E5UI 3PQYE 4AYFB 4PMZA 2AMUA 3TUUA 1CXFA 2NVCA 4Z78B 3F4DA 1EAPB 2F74A 4J27A 3WI9A 4PJ7A 4Z7UB 4GW4A 3PDOA 2IWGA 1ZPLA 3OGCB 2P50A 3THUA 5F3HB 4L0PB 3CYJA 1TUPA 3MI2A 3W1QA 1VRDA 4W70A 2IPGA 5ABHA 4NJGA 3V0VA 4JPIA 1XYFA 3ZN6A 1RULH 3KPPA 2BM3A 3ZE2F 3T4AC 1W1IE 1IEIA 3LEYL 1NC2D 5E2TL 2RMNA 2A9MH 2ICEC 2FH6A 5DCBA 3ZT5A 1H8SA 2KLRA 4M48H 4LIQL 2WQDA 4KNSA 1QAWA 2Q8AH 4O2FB 4FPSA 4KKCC 1N8WA 3EB4A 1ZT1A 2PUQT 3TL5A 1VZGA 5GZOC 3HBLA 4EAYA 5CINL 2A3LA 4GS7C 1ZKAA 1EXUB 3CZFB 2QJJA 5H37H 5CKGA 1LL1A 1RZGA 2BVTA 3Q8AA 2ZUYA 3CJJA 3K5XA 1R38A 1QBAA 1QRNB 1HJUA 2EXTA 4W9IC 4A2MA 2X7LB 3QHZH 3TOPA 1R85A 3RF9A 3SSJA 4HWUA 4OF3A 4OT1L 3ARRA 3LDBB 1L6GA 1T3FB 5DJAB 4H9VA 2ZUQB 1HZLA 4OV6F 2OPCA 2OMNA 1BG4A 3MHFA 4EDXB 1SFSA 5BROA 3L95B 3T4CA 1LILA 3BUQA 4LEXH 1BAFH 4QO1B 1TTIA 1MI5D 4F9PA 5FF4A 5C86A 1EC7A 4RR4A 4DPQA 2Z65C 3KM2A 3P3UA 4F3FB 4JX5A 1NWRA 1KFEA 4WVRA 3R0MA 2BDQA 3RR1A 3QV8A 1I2PA 3AIVA 3CZJA 2V33A 1OEPA 5LHDA 4S1DD 3M43A 3FU8A 1OC5A 4GI8A 3EOAA 3EJQA 2C9VA 3CJPA 2VDGA 2EP6A 2LTQC 3OB0H 1W9VA 5JH2A 1ZS8B 5IB3B 4PE8A 2F58L 1F4XH 4TMPA 4S2BA 5DWUL 5DLMH 2OZ3A 4CCDA 4U4BA 2X89A 3BE1H 4L5FH 3WTVA 1T04A 2W1NA 4MNHA 3ZDWA 4JY6B 3IMBA 3TO4C 4GJJA 4ZMQA 4X8XA 3LNGA 4IXHA 2Q87A 3INUL 2J8UB 3BMWA 4Q52A 1RJPA 3SE3C 5ESVB 3W9DB 1BGGA 2H1XA 2VW7A 3EO9L 2H6PA 3T0VA 4N8CL 3K30A 3TGXA 4OUIA 1AD9B 4AD0A 1KM4A 3NL6A 2IANB 4DNLA 3L7FB 5I1GL 3WZ0E 2PDPA 4H8VA 2BHFA 1ANUA 3DVFA 5HHME 4FX7A 4AYBA 1VFHA 1TQSA 3SDXA 3RWJA 1DANU 4KQ3L 4GXPA 5CJ8A 3GS7A 2K6ZA 3O9WA 3AS0A 3IGFA 1MHHA 3D9AH 2O6EA 2KZBA 4RNIA 2GVLA 4LVFA 5IQ7H 2VRAA 4PV8B 4H00A 5EU3B 5GS0C 1XIWD 1NOFA 3PQYA 2B39A 1MCBA 3CUPB 3ZE1B 3W0WD 5DI8B 1G4RA 3MNDA 1JF6A 5IHZA 5BUAA 2QZQA 1BMWA 3LKOA 1ONWA 2CLZA 3IIOA 4C1NA 2HX7A 1QW9A 1OGPA 3BVDB 4MSWA 3QZBA 4S2SB 4OCLC 4UZUA 2Q3AA 4XRCA 1HYRC 4B5NA 1CFNA 4YSEA 3H2QA 4P05A 4Q8MA 3PZUA 4QHNA 5BVJA 1V3LA 3RPIA 1GZGA 3OKKB 5BMFL 5DQ9B 3FO1B 2XT1B 4ZFMA 1NBZA 2A6JA 3G1RA 4Z6AT 3H6JA 4KEVA 4N2DA 4KJYB 3DUSB 2DQTH 1UM4L 5CD5D 4I9TA 2I69A 1ASQA 5AB9A 3FDKA 1A7RH 1E0UA 4TQHA 4XR8C 4HJ1A 5GNXA 4FQCH 1TVPA 2MOQA 3MN8A 1JV5B 4RMUA 4HV8B 3LB6C 3GDBA 3TU9A 4J2QA 1ETZB 4GJ1A 4CADA 3WLSA 4KS0A 5GSRA 3U7YH 4YEFA 1B31A 2LU5A 2E76C 3RVTD 3UO1H 3SDAD 3ZKNC 2WZTA 4AVKA 1DOSA 2NCEA 2W9EH 5CPTA 4NO0A 4OIAA 4MB1A 4TQIA 1WFJA 1SUHA 3GPEA 4YDLC 2VLLA 5IK3B 2IH1A 3MRPB 4G2DA 1JF5A 4WUKH 3NFNB 4PLKD 1GTNA 2JGQA 2HV5A 2VCOA 4YDIH 5CHNB 4Z76A 3MLUH 1X5JA 3H1ZA 2ZPKL 4GKTA 5E9DD 3ZJ7A 3QEUA 1MEXH 3WN5C 3EJRA 2JGYA 1I8UA 4OBRA 4U1NA 4HUNB 4MD5B 1NGYA 3VFOA 3MPGA 3BDXA 5DO2C 5ID1A 2KZWA 3UGXA 1TKWA 4AEFA 4W9ZA 4C4KT 1HJQA 4YTQA 2FKPA 4KJWD 5B4MD 2HT2D 2ZQ0A 2VN7A 3FU0A 2ASHA 3SYPA 4PJHB 3SOTA 1PJ9A 3HG1D 4PWJA 1PZ2A 2BFVH 1AMYA 4IGBC 1V7ML 1CXKA 4HPGA 3L4UA 3S4SG 2PW1A 2HT3C 3S5SA 4OD2B 4HLZG 3CU2A 2X7WA 4AQ8A 3FMGL 1W8OA 4A2HA 3WHXB 1NDGB 3DRQA 1HGYA 4ZA0A 2V7HA 3CB3A 1DVFB 1AGCA 4LFHG 3QWNA 2AAMA 1EJXC 3M6DA 3LMJH 1YPZF 4MIMA 3KBEA 4NLAA 1KOAA 2Q8BL 4KMTH 1DANT 2WO4A 5CCZA 4NAJA 3OMNB 3MKKA 2WMPB 3SKNA 1UJ3C 1R33A 2RDUA 3OPZH 2EXWC 4B9CA 1WWAX 1YEDB 3V7AG 5EBMB 4DZBB 5BMXA 3TASA 5EU6B 2HMIC 2QT6A 4M56A 2GITB 1O4UA 3B0VC 2VM9A 3GI9L 3DPBA 1MXDA 1V3MA 4LU0A 1GQLA 4MWAC 1XWYA 4DW2H 3OA5A 3CFKA 5GZND 3QAQA 1VGAA 3W2DL 4M4RA 5I8EA 2WVTA 3LSOA 3HMWH 4LO9A 2P5WD 2NY7H 1QUPA 4F91B 3FUMA 3DX3A 2DI8A 3UGRA 2G60L 3TEXA 4P2RD 2FB3A 2RTTA 1H9DA 4DK6A 1AR2A 4ZQMA 4XP4H 4XP1L 3M44A 1U58B 4JPWH 3MV7E 2YZ1A 3RLVA 5LQBH 4HIEB 1OFBA 3FNDA 2OI9B 1FH2A 4XC1H 2YBRB 3QDME 1I2OA 3OM3B 4ZGYA 1FPTL 4PTNA 5CBEA 4S1RH 4FQXA 5AWNL 3B8YA 5DGQA 3V0EA 5E95B 1P5BA 2CUHA 4WFEE 2PD5A 3M0LA 1UB3A 1RSYA 1I45A 5EU4A 4EZKA 5BZWB 4TL4A 1KIUA 4YHYB 3OJ2C 2G96A 3NQ2A 1G9ML 3DRTA 1OAXH 1PJWA 1YECH 1KMGA 1RQHA 1ZHKA 3TBWA 4IBWA 3DGDA 5IHHA 4JFHD 1QUNA 3TP4A 3HB3D 3ARXA 3TA3B 4IEFA 1R3LB 2DZSA 4DAGL 4L3ED 1O60A 3HE6A 4U0QB 4XNZC 5C0IA 3GRGA 5AAWA 1V0NA 4HS3A 4M5YH 4F5CA 6PAZA 1LO3H 2FEEI 5AALA 4QRRB 1U33A 1FSKB 1J0JA 1IM3B 1PQZA 1PIGA 3QHTC 3MRMA 4MJ2A 4HJSA 2NPLX 3REWB 5F6IC 1C9SA 4KQ4L 3QVAA 4UINH 2X4NB 3BH8B 2MHAB 4QWWD 2WCPA 5C07A 2Q3XA 3UTPD 3NQAA 1XV8A 2VEKA 2PPAA 3AIWA 5I0VA 3S36L 5DZNA 5JR1L 1VD6A 2VDMB 4EE2A 3RJYA 4WIQA 5DD5H 4G11A 3MRKA 4ZAKB 3GZPA 4KQ0A 3W1MA 1EJOL 1JZ6A 1JERA 2B4GA 3RKPA 4K3EH 5BPPA 1J5IA 1KY6A 3U2OA 2I5YH 1MI3A 2WXJA 5EO1B 2VYRE 3LI1A 3KG5A 4IG2B 2FQFA 4MS8C 4QDGA 2ZCLL 2DMCA 1ND0A 2OFJA 5LUMA 3KTSA 2ID5A 3OKMA 1NKGA 1IT0A 2D31B 4HK3N 3JUGA 1X44A 4B92A 5BV7B 1WC7A 1MFBL 1ET7A 5HHQA 1PZ1A 5DZVA 4MWFA 2WBKA 3LY0A 1ACCA 3MFFB 4JIIX 1ZSDA 1DLHB 4LP5A 3ZDZF 4L56A 5AKQA 3TCEA 4WEMB 2HTLD 2VN6A 3L1OH 1BQHG 4O17A 1OK6A 5LWYH 3O3AA 2VDNH 4DWDA 3EADA 2AXHA 1RCXB 3F05A 1DLFH 4J8RA 1KA9F 4NJAL 2A4AA 1UD2A 1HKLH 3KDPB 2OWCA 1SDDA 2PYFB 4UU9B 3U9PL 2DY3A 1N2VA 1UD6A 2VITA 2CLPA 4K4KA 3HIZA 4NGHH 1ROWA 3V0FA 2CZEA 4QAIA 1XYLA 4KRNA 1I2RA 4POYA 5L2JB 3ULVL 2LLGA 2BB0A 4WCJA 3JYBA 3SZ8A 5FKPB 5TIMA 1T7XA 4I5XA 2VB5A 1JUKA 2ZRZA 3KLSA 2VXUL 4HU4A 3X1EA 3BVWA 3KWXA 1WJ3A 2R1PA 5ETUA 3RWHA 3UX9B 1S2TA 4C6OA 5FGBA 3PWPE 2FGZA 3K81A 4HKXB 4N8VG 3IRZA 1TQBC 2E5BA 3PNUA 1JNHB 4H2CA 2HH0L 1U8PA 1C8QA 1UASA 4QCFA 1KXQE 4QF1A 3CT2A 1ZT4B 1BAWA 2AXWA 4DCQA 3CK0L 4G7SB 1K72A 1I0DA 2CHRA 3G8RA 4EI5D 2D03H 2E27L 3W00A 2CIIA 3BI9X 1SQMA 4CMMA 2B4CH 2A21A 3G5YA 3LH2H 4NSKA 5CSBA 2JKAA 2VCCA 1EUNA 4Q4OA 4UTFA 4B53A 3VNKA 4CSPA 4HNUA 4FG4A 5T1LD 2BSSB 4CKQA 1G7LA 2EE9A 3BRGC 4CDGC 4DFHA 1G1CA 1QLRB 2JV6A 1YPZE 2QCHA 4P7OA 3FN0H 4M29A 3LHVA 4K8RL 4XVOA 3AI0A 1IWAA 3CFDA 1MI5B 4FFWD 4BCYA 1CF8L 4D0BB 3L13A 1PAZA 2QDEA 3GWQA 4FXLA 3DSFH 5D93B 4NNBA 3CV6A 3BGMB 3B7YA 3VXRE 2ZOKB 2FJUB 4EF8A 1L9OA 3AITA 3F6JA 3LUTA 2X6AA 4BJHA 1FQ9C 1KCSL 2B2XH 3PJNA 1XB6A 4GISA 4GD0A 3ONCA 3CH9A 1GC1H 3FEMA 4W9HC 4IOFD 5EU9A 2GUOA 4K9EH 4M3KB 3TH3T 4IGSA 2FQGA 3QNXB 5D02A 3O6LH 4Z77A 1QO5A 2R1WA 3VFWB 2ZE0A 3ISRA 4OLVH 2YXWA 2A4ZA 2H26A 5DFAA 3ZZSA 1MRDL 4MQ7A 1KLUB 4WI9A 4JKPL 1A0DA 4AMCA 4UFKA 4CC0A 3H9SB 3QQNA 2VLKE 2OOGA 1X5MA 3H4XA 2IJ0C 4B95C 4EKJA 5KZDA 5A3HA 4LLWB 4X4ZA 4CQBA 3P0GB 4FQJL 1SO5A 4YPJA 4LSSH 4MYPA 3TT1L 4WV1C 3OU8A 3HI6L 2ZKXA 3QC5X 2BOCA 1NGQH 1IUZA 4XMTA 4P9HH 3M0IA 4F0RA 2C91A 5JW4N 5FUCC 1JWSA 4LRNL 5E1QA 3DKHA 3CN3A 3UJIL 1DVTA 2CLRB 1QFWM 3G5XB 4GA8A 3V7PA 4YTTA 2BP5M 1XHGA 4LZKA 4NNPH 4K15A 5CCKH 2ILLA 3TN5A 1W72A 1M7DB 2QUVA 4LHUA 3D52A 1PXGA 3GIPA 3NPWA 3C6LB 1S7TA 1H7PA 4ES9A 1GYNA 3ATBA 3BUDA 3NQDA 3V5DA 3OIXA 4OCRL 3FOMB 4AUJA 5EF0A 1T5AA 3RVWC 4K3GA 1J5OH 3APYA 1U3JA 2R1XB 3CMGA 3H2CA 4UV7H 1T40A 2NY5H 4Z0BL 1U92A 1WIOA 4XKYA 2EC9U 3E6FA 1FXPA 4XBEL 5HHOD 4XB7A 5J6SA 1ZPTA 3W84A 3UADA 5DJZB 5B3NA 4XPAL 3TEVA 2CDFB 1VEPA 4X8JA 4OLYL 5C2UB 5JHDE 1NCNA 1FKWA 1F7BA 3PC0A 1S5MA 2X70B 3R8GA 3TLLA 2IMRA 4KX7A 3B7TA 3BT0A 4DKFL 1Q2RA 2GTQA 1TZOA 4EVZA 3PWPA 1F6FB 1KBPA 1ZGLM 4O54A 1D2PA 1I85A 1DJHA 4K1WA 3FUIA 4A63A 3P0VL 5KBKA 2R91A 1YDPB 2LLEA 1FV1B 3O8XC 1I9IH 3GJEB 5DRXB 1A6ZB 4PH8A 1KXQA 1E40A 1QPXA 5IW6A 1A65A 4M5ZL 3ZDZE 1HHGA 2DQCH 3S97C 4POUB 3ARBB 1QFWI 2R8SL 1ZSHA 2X9XA 3WKML 3BP5A 1HL5A 3FSTA 1ZA6B 1VYRA 1OAYH 3RWIB 3CVHB 4QYOA 2HLFC 3SE4A 2NSXA 5IFTA 5DT5A 2EO9A 1RIUH 3OLEA 4N26A 4R27A 1QO3B 4FQQA 4Y1AA 5BMWA 3F7LA 4CQCA 2Z34A 5EBWA 2VOMA 1YPZA 4G6JH 2XPGA 4S11A 4PJ9D 4AIUA 4OV5B 1YEFL 2VYOA 7XIMA 3VD4A 2IADB 1MZYA 2E7MA 4FQ1H 2DFAA 5T3ZL 5CPSA 3VXRA 1V27A 4UV4H 4UT9H 4FMKA 4R84A 3UW6A 3H2EA 3KL0A 4OFYD 3QJXA 4J3SA 4KFZC 3ZJKA 4CBPA 2AJ3B 4HHAB 1IKFL 2YD5A 2P52A 2YB4A 1GYLA 2J71A 1G7UA 2OBGA 4NZUL 4M6ML 5GIRA 1UH2A 4FDWA 2FUTA 1BHGA 4FAAB 2E7HA 2CBIA 3PPSA 1K8XA 3U2SB 3VXMB 4GVGA 4F9LA 4HHHA 4IHBA 3QFGA 3CBWA 4OCXH 3PAJA 4MNGB 5KVGH 1FG9C 4FX5A 4WFFD 5DEFA 1EIXA 1WFIA 3O45A 4GKLA 4U49A 3HFTA 1MHEA 4HKPA 3Q4DA 1M3JA 4KPHH 1AL7A 3OAUL 1IAKA 3ALGA 4U3SA 4HTYA 2PDYA 1K02A 2QKIA 5TFSL 2EILB 2GJZB 4AKOA 3ULUH 2CZFA 4GVHA 5GRJH 4D0DB 4CQAA 3RNKA 5CN3A 1FIEA 2IQTA 4KK8C 1NM4A 3LLDA 2NZIA 1VJSA 1BX2B 3FTGA 3FJLA 2G3NA 4HAFA 2KC0A 3N85L 1E6ZA 3QQ4A 4IFOA 4GRLC 4Z3FA 1NFKA 2P1YA 1YY8B 2B8OT 1WUEA 4HVXA 4HNLA 1TFVA 1DR9A 4GVIA 1HC1A 4QM1A 3B2VH 4FERA 3BDBA 4C5YA 4HBCH 4FNUA 1MQQA 2DPEA 1FZOA 4Z2IA 2CLOA 2D3VA 1A6UL 4GUFA 4Y5XB 4Y5VC 3RM8A 5ALCL 1ZLDA 3JV0A 5FGRA 1R0MA 4GXVL 4RDYA 2O9RA 2UYLA 1AGEB 4INFA 3RDTD 4NKMA 4LW7A 5LXXA 3ZRCC 2EC9T 4MJZA 5F72S 4JM2B 1DFBH 3R4DA 4DF9A 3F4VA 1IAOA 4TLSA 1T6VN 3MAWA 2Z9TA 2PWHA 4PTXA 2NWSA 4J3ZA 1C93A 2WBXA 1KB9K 2G5WA 4U1IA 4MNJA 1FO0A 3AAZA 3P4MB 5D6DC 2W65B 1E9PB 2P5EE 2WLHA 3B7UX 4I0PD 5EIVA 4JGMA 4PGCA 4MQSB 1PKQE 5JHDA 5CKSA 5CZTA 3ULUD 3CFBB 4XP5H 3RWFA 3UJFA 3CN4A 3N1FC 4TQEH 2GSEA 4JDTH 1N8ZB 4Y8FA 3W37A 3HB3B 4XMWA 2YPVA 2X6CA 3MHZA 1RHHA 5GRUL 3SQBA 1TJHH 4QXVA 4X7SH 4P2AA 1IB5A 2XTJB 3QJSB 1H7WA 5I0WA 4ELMF 1JGMA 3C5QA 3ZR5A 1CL7I 4Z0XB 1QD0A 4PB0L 1JUFA 2FYYA 3LQAH 5CEYB 5JIQA 5SWSB 2VDPL 3VYOA 2A38A 1EAOA 5C1MB 3IJEB 3FULA 4LLVA 3FYYA 1I9RH 3E5BA 3MZGB 4KUZH 3QQ9C 4N6QA 4AHPA 3BEVB 4UTHA 5D2TA 1IYXA 1VACB 1JZIA 2WHKA 4AQ1C 3G1XA 4ODTH 1TOXA 5E4IA 1EYEA 4UIKH 4US5A 3GW0A 3OKNA 4ZNCD 2D4DA 4A7UA 1AUSL 1FL3B 5I0ZA 1QRND 1AP2B 3LBMA 4KWVA 1BIHA 4PJ7F 4PJAF 5J11B 2ADGA 4ZQKB 4PN6A 1G5AA 4I3GA 2XIBA 5LNUA 1I3GL 4A7QA 4NPKA 5E23A 3ESUF 5IW1B 5G4OA 5CGYD 1SR9A 4BSWA 1DORA 1E4WL 4NI3A 2IO5A 3T4WA 1ESOA 4F15C 2OFQA 5CFAA 2AI0L 2BERA 2Z1PA 3SKUD 4PWIA 3GD1C 2QR0B 4HK6A 1B3YA 1IT7A 3DX9A 5HYSA 4DZHA 4U10A 1VS1A 2Q02A 3BG9A 1AW2A 1CE6A 4FTVE 1EOKA 2OKTA 3HOGA 4JFQA 2OJEA 1S5NA 4GUGA 4C54A 4JTCA 3DJRA 5IEHB 1GPOL 5C8JB 3CFNA 5TPWH 1DKWA 4BCEA 4QNEA 3S2NA 4PV9A 5EZIL 4NN6B 4MA7H 2BRQA 2R2BB 4J3OH 4C58B 2E59A 3JWNC 5A16B 3SJVB 5FYJH 2BOFX 4PMRA 2UX7A 4IRJA 3V7AE 5I6NA 2WZEA 1G94A 5I1AA 5HJ3B 3L6FA 2YCLB 4ADJA 4NF7A 2E47A 3LHPL 2ZNXA 5GRVK 1ZXKA 4U3AA 5ANMB 4B5TA 3EB3A 4J8QA 1TTBA 1UZHA 1PFCA 1SUJA 2BPBA 1DV7A 2W60A 3VFVB 5M3WA 2V9TA 3MBEC 4LF1A 2CIKA 1S7RB 1GXEA 4DJFA 4HWBH 4K7VA 3IDIB 2ISWA 4XNXH 4GP4B 4IUOA 3EBVA 3EYSH 3N9SA 1Q3NA 2EDLA 2IAND 4LOCA 1W2KT 3WLPA 3TW7A 1UATA 2OJZL 4MJIB 1T2JA 4HKBB 3NA8A 5AL0A 1E6PA 4M3PA 4L6DA 2H3KA 3RFZB 1IQWH 3N41B 1FFOB 4D6DA 3QGVA 3I9GL 2GW5A 4DAIA 2F18A 5FEWA 2RB8A 2AVFA 1PKMA 2OXNA 3QNYB 5I18L 1IEVA 5KTLA 2R8WA 3QDJB 1O7DE 3MUXA 2BXYA 4RZCB 3SD5A 4Q6IC 5DXWA 3W5NA 4RNRB 1KBBA 4UM8B 1LYXA 1WT5A 3JR2A 5M95B 1PKQA 3ETTA 4UILH 2NY6B 2YSSA 2QJDA 2C9PA 1E90A 2DZUA 3C0LA 3LZLA 1OAUH 1SOKA 3EUDA 5IQNA 5MEPB 1ES0B 3B40A 2DQEH 3U57A 1XGYH 1JI2A 3PJSA 4EBQH 1NCHA 3IN2A 1QNRA 1JCVA 3VFLA 3QZWA 2DVXA 3FQTA 4F0HA 3ITLA 4C6QA 4MS6A 3BAJA 3IFPA 3X14B 4H8HA 3H4WA 4W84A 3IM1A 3WMQA 1T5WA 2KPNA 1VADA 4PRBB 3RMEA 3ZL1A 3OZYA 1LE9B 4R7LA 1WWCA 5KSUA 1A4JB 2Z25A 4HZ8A 4GIYA 4MAYC 2VH5H 3FQYA 4Q58C 4FIRA 4UIMB 1CLXA 3SDXF 1WDDA 3VIMA 1BFVH 2C6QA 2G4GA 1HN1A 5T9BG 4WWPA 2JI3A 5G2NA 1POKA 1GOFA 3VWJC 1FNGA 4DPPA 1H63A 4NG3A 4GSUA 5INCB 2YXGA 2AJSL 3K2MC 2OMVB 3TV8A 1F1GA 1O7VA 4N2HA 3SDDC 4ZYKB 3LA4A 4Z3EA 3IWUA 1QI5A 4OIIH 4R8WL 1I3VA 3DGCR 4LS1A 2ZRXA 5B3JF 4ZFFA 1Q72H 4DWSB 3WTXA 3HTLX 2Y7MA 3VKAA 2VN5A 4ICWA 3U4KA 3UJTH 3ARDA 3W1PA 2KZ1B 3MGTA 4DETA 1E9LA 1R3JA 1KJMB 4XAWH 2J79A 4Y7MA 4UTAH 3IS0X 1BFOA 2YLKA 1PYWB 4LLQB 3IK2A 1W9UA 1A1NA 3EHBC 5F4XA 1EGJH 4WUUB 2EACA 4XH2A 3EOUA 4XMUA 5D4JA 2W66A 4FTVA 5KJ7E 1NF7A 4X5WA 4ZR8A 2QSQA 1V6UA 2BZNA 2XGIA 4I3SL 4ELME 1OGAE 3BVNB 4AK1A 3ESVF 1CIUA 3GB7A 1XF4B 3HG5A 4O50A 4ZQNA 1AANA 2WBJA 4KHTL 2A1YA 2PEVA 2OT1A 5BXFB 1CGVA 4CCZA