1SZNA

The structure of alpha-galactosidase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
417
structure length
417
Chain Sequence
IVMPDGVTGKVPSLGWNSWNAYHCDIDESKFLSAAELIVSSGLLDAGYNYVNIDDCWSMKDGRVDGHIAPNATRFPDGIDGLAKKVHALGLKLGIYSTAGTATCAGYPASLGYEDVDAADFADWGVDYLKYDNCNVPSDWQDEYVACNPDFVKTGPNGTCTTALDPTLAPPGYDWSTSKSAERFGAMRNALAKQSHEIVLSMCIWGQADVFSWGNSTGISWRMSDDISPNWGSVTRILNLNSFKLNSVDFWGHNDADMLEVGNGNLTAAETRTHFALWAAMKSPLLIGTDLAQLSQNNINLLKNKHLLAFNQDSVYGQPATPYKWGINPDWTFNVTYPAEFWAGPSSKGHLVLMVNTLDITATKEAKWNEIPGLSAGHYEVRDVWSDKDLGCLSSYKAAVAAHDTAVILVGKKCQRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-galactosidase
publication title Crystal structure of alpha-galactosidase from Trichoderma reesei and its complex with galactose: implications for catalytic mechanism.
pubmed doi rcsb
molecule tags Hydrolase
total genus 139
structure length 417
sequence length 417
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2004-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17801 Melibiase_C Alpha galactosidase C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1sznA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1sznA01
3P74A 5LKYA 1FWTA 5E0KA 1RP8A 1A5CA 2NUXA 3HGOA 1N7KA 4JDBA 3KAOA 2ZXBA 1GVSA 3WNMA 1WXJA 2VEIA 3G1AA 2V9DA 1NAL1 2YKKA 4H7VA 1N55A 3NQEA 4MLJA 5CXPA 4MFEA 2OZ0A 1PJ9A 1K8ZA 3SSJA 1Q6OA 3P60A 4AB4A 2V0TA 5T26A 3HBLA 4W93A 2OW7A 2XN2A 1D3HA 3WK0A 2J88A 4RR4A 3BGGA 4J27A 3PAJA 2UV8G 2E09A 3BLBA 3CT7A 2FYVA 3BLKA 3M6YA 4PCFA 3K8KA 2Z2UA 4DBEA 3W7IA 3NNTA 2YYUA 3BC9A 4BWLC 1OFPA 4K8EA 3MWAA 4JY9A 1AW5A 1VC4A 3CIWA 3IIPA 3STGA 3HPZA 3L4TA 1XUZA 1MVYA 3DHPA 4JL1A 3NPUA 4U28A 1VYSX 2CW6A 3AXIA 2QJGA 1XCXA 4NJGA 2AAAA 2VFEA 1CIUA 1UH3A 4UNKA 2C13A 3DZ1A 1GYLA 3TNOA 1KTCA 2CPUA 1CGVA 4IOTA 3S1VA 4WSJA 3QW3A 1KWGA 3LXAA 4FO4A 2X16A 3L0GA 3A6OA 4J3UA 2X30A 4LRTA 2ZUTA 2RDUA 3NQAA 5D09A 3TFCA 2ZRXA 5J5RA 3WJYA 1G9HA 4GI8A 4WY0A 2CLFA 3QC3A 1IXQA 2DZVA 4NJKA 2XVLA 3MHUA 3WFZA 2QCCA 3N9RA 1FDYA 1ICSA 3PC0A 1KM5A 1PIIA 3RFAA 4NXKA 2BZNA 2EO7A 2F7OA 5F2LA 3TTYA 3EJPA 4CN1A 2EPHA 4H8UA 3SGUA 1XM3A 5FF7A 2A6NA 4OHQA 1MO0A 2BY3A 4Z1BA 3VFLA 2E68A 2V3DA 4PL2A 3USBA 5F1VA 3VMPA 3A23A 1K02A 3UY8A 4WSKA 3OLIA 4DF1A 1F73A 1I2NA 1KV8A 5EYWA 2BSLA 2D0FA 2QF7A 3MUXA 4JEQA 1LRQA 1AL8A 4HHPA 1H50A 3AXHA 2DORA 3MBFA 4M6QA 4AWSA 4UIOA 1O60A 3T7VA 4WOZA 1VHNA 3W7MA 3VM5A 8CGTA 1XBZA 3G8EA 4RKAA 3WDHA 4GUIA 2TMDA 3GDKA 3IIXA 3SECA 3Q2DA 1QI4A 1YTEA 3A4AA 1CYGA 4ORIA 3TX9A 4DQWA 3NM1A 4ADUA 4HT3A 3BCDA 4FMVA 5DO8A 1IXOA 1AK5A 3S1XA 3LCGA 2OCZA 4RV8A 1J4EA 4JTGA 1XBXA 1OG0A 3WJXA 2E5DA 3ECQA 2WSKA 1H61A 3KWXA 1GT8A 1UA7A 2ISSA 3IVSA 1LDCA 1TREA 4OV4A 3P61A 5CSSA 3PBVA 4FLQA 1L0PA 4BA0A 3P82A 1FY6A 2TYSA 3DXIA 3DFPA 4UQDA 2ZRVA 1FDJA 1YDOA 4NT0A 1QWNA 1VQTA 5CZSA 5I3GA 3HPXA 3GDTA 1IXNA 4AHQA 1JF5A 3CB8A 1JCXA 1ZAIA 2Y85A 1MW0A 1OGSA 1RQEA 3GXTA 5I0DA 1KFJA 2QCDB 1FUYA 3BO9A 2ZZ5A 2VFIA 3QM3A 1P5BA 2G3MA 1OYCA 4KFNA 3QMTA 2YW4A 1BKSA 3A21A 4Z0JA 3BAJA 2C3ZA 1LWHA 4GJ1A 1KXTA 3NGJA 2RHGA 3CPUA 2ATSA 4KWUA 1VLIA 3NQMA 3UY7A 4EOUA 3N3MA 4LV4A 5EMYA 2YW3A 5AC6A 4UFLA 3IRDA 4YCOA 2KZHA 2XIBA 3ZS4A 2HS8A 3UNDA 1AQMA 3PB2A 2A7PA 1SW3A 1I2QA 3LRKA 4H3DA 5U4NA 2NX9A 1H5YA 3R12A 1KW1A 2GJLA 3GVGA 1W1ZA 4GNJA 4C1LA 4PEKA 2GQ8A 4K38A 4GINA 3M7WA 1H60A 4UOQA 3BLFA 3HG3A 1HXKA 4W9TA 4CCDA 2CLEA 3TAOA 2WKGA 3TJLA 4KWVA 4QM1A 3WK2A 1QMLA 2E6FA 4YL2A 3A9IA 4Z1DA 5DY2A 2C15A 2ALWA 1TJPA 1TV7A 1GPWA 2NXIA 3SI9A 5J5DA 3S8HA 3L5LA 2WJZA 4N9DA 2ZQ0A 1QWGA 4GXMA 1TCMA 3WNOA 2AQWA 2ZICA 3G1YA 2QJHA 4FNRA 3DENA 3H55A 4IPIA 4IX2A 1LCOA 3LI1A 4HPHA 1XFBA 4HIBA 2YDAA 2G3NA 3BAXA 2E5CA 3DBPA 1Y7VA 1WZLA 2ZWZA 1SO6A 4IWWA 5AOUA 2A4AA 1CGXA 3CZGA 4AF0A 3IVUA 1TPUA 5LZLA 3DC0A 5TBOA 1QI5A 1XSJA 5G2HA 4FEZA 3BUIA 1B9BA 2DZSA 4WXYA 1TTQA 2I9EA 4J3VA 1W37A 3WEOA 3JS3A 3UXDA 4UQAA 1KBJA 4E38A 2C18A 3QMRA 3BUPA 4O28A 4UNIA 3M16A 3FAXA 3M5XA 3LRMA 4JFWA 3VNYA 3W3OA 3LOTA 4O10A 3DX0A 5TQLA 1KTNA 4LU0A 3LTPA 3D50A 5A2CA 4X0NA 4GWEA 4EF8A 1QHPA 1TPC1 3N34A 3QPYA 3FFSA 1VJSA 3W7PA 3VNZA 3BG3A 3FYPA 1XSIA 2QMKA 3SR7A 3VO0A 1PZ3A 3BAYA 4G1KA 1EUAA 3PSWA 4GO9A 2PURA 3BSGA 2CU0A 1J5TA 4FLSA 5CGTA 4CN4A 7TAAA 5D2YA 3PBUA 3TV8A 1PEZA 4JR5A 2VRKA 1JULA 3DGRA 4IUOA 3QPZA 2ZTJA 4MFDA 4I7VA 1KM6A 1JQVA 2CLKA 1QO5A 4MJMA 3M47A 1FXQA 2CLMA 2QCGA 5K2ZA 1G67A 2PE4A 3OLGA 2FB2A 4EVZA 3GX9A 3NEVA 1KGWA 3LHTA 2ZXAA 3G0XA 4CKQA 3C2OA 2JKPA 1JDAA 3NOEA 4HNUA 2E6DA 1BWLA 1QPQA 5FI8A 3G22A 1P0NA 2VT0A 2R8WA 1GEQA 3TUUA 1UUOA 3L4WA 2YIHA 3UCQA 2OSXA 2FQIA 3OHIA 4KKXA 3WDJA 3CLMA 4RLIA 3TU9A 5KZEA 5LNRA 1GZGA 3BLEA 4H8VA 3D4YA 2WO5A 3DX1A 1VGAA 3W86A 4JGDA 2OYLA 1HNYA 1ZCOA 1GOXA 4PCSA 3TC7A 2BY0A 4QNWA 2QCLA 1TV8A 3FJ6A 4JTUA 4U2ZA 3SIZA 3MI6A 2QLYA 3II1A 3DX3A 3LM7A 5D02A 5K4XA 1KGUA 4GUJA 3DHUA 2Y88A 3P8JA 5FEPA 2BHZA 1JCNA 2VFFA 2OYMA 2YR1A 5I24A 4UC5A 3L4VA 1ZNNA 1FQ0A 2ZA3A 4IXHA 1S3HA 4PSRA 1AMKA 5D32A 1PS9A 3L4XA 3MBDA 1NF0A 1MW1A 1TPVA 3TIMA 1CXKA 1K03A 5LSMA 3B0UX 4WD0A 3KLLA 4FX8A 2ZX9A 2W79A 4DO5A 1RZMA 3T78A 2ZRWA 1GVQA 1M7PA 3Q94A 1QW9A 2ZX7A 3FYOA 3IVTA 1TV5A 1R75A 5AYYA 4UZUA 4CQ9A 2C16A 4Y6GA 3NM3A 2A6LA 3E9AA 3W2JA 4M7SA 5CPNA 4OU1A 5MHBA 4TR9A 1UA3A 2VENA 2NX1A 4ADSA 3BVTA 2BWGA 5H2ZA 1YYAA 2Y63A 5FEXA 3W1XA 1ZENA 2GOUA 1UASA 3BLIA 3U8GA 3VX0A 1W3TA 3TSDA 4GKLA 2EGZA 4IXXA 3FA5A 2Z0IA 4I9AA 3UG5A 1KA9F 2WANA 1HVXA 3NQ2A 4GUGA 3W7RA 3MHFA 1S5WA 1EP1A 3OLDA 4KFOA 4B9YA 1OB0A 4JL2A 2CLLA 4LV9A 3EJTA 1Q6LA 4J3SA 4IMFA 2ZZ3A 3HF3A 1S5VA 4FIRA 3W23A 1U33A 2VNCA 1QNVA 2VC6A 3EX4A 3VU2A 1TJRA 1KLYA 1WOBA 1CX9A 1OF8A 2Q3OA 5KMYA 3P81A 3LCFA 4O57A 1MW2A 3TCEA 1DL3A 2NWSA 3UWZA 3PULA 2VFHA 1H7PA 4HNVA 3LTSA 2OYKA 3VGDA 2CHNA 1KM4A 2X2JA 5FESA 3M43A 2BY1A 1F6KA 1O95A 5FEZA 3NQGA 5BNKA 1QW8A 1LOSA 5A2AA 1EA9C 4OJYA 1TPDA 2WV8A 2Y2WA 5E70A 1DJQA 1SR9A 1T8XA 3JRKA 3UZ5A 3ABSA 2A5HA 2CLHA 4XB3A 4K6AA 1XH2A 5DLCA 4JCLA 3KEHA 2NXHA 4R7JA 2Y7EA 4N02A 3CV5A 3W1UA 5HWNA 3W2LA 4JFVA 3W7LA 3UG3A 1SSDA 2B0MA 3BAIA 4LWWA 2WVSA 5H91A 5BMWA 4Y8FA 1WX0A 4R34A 1JDDA 4BI7A 3GXNA 4O1AA 3QSRA 2CZFA 4UTJA 2QMJA 5KITA 2X2IA 1EWEA 2D0GA 2NSXA 1G4SA 3W1LA 1H1YA 2ABBA 3G3DA 4O1CA 4HNTA 2XFWA 1OX4A 4WOQA 4PODA 4LNYA 3KL5A 1HWWA 2WSRA 3PS7A 2H90A 3LDVA 3OVRA 1QOQA 5BRQA 2DP3A 2GUYA 3FIGA 4JIPA 4O16A 1Q4NX 4UTTC 3WELA 4A21A 3GR8A 5AC7A 3OG3A 1XL9A 1OFQA 3TK7A 5CGMA 2QKFA 4O53A 4U2YA 3FS2A 3CWNA 1QHOA 4M8UA 4IX0A 1B4KA 2J6XA 4JTJA 4DF2A 4DPPA 4UQ9A 3Q37A 1Z41A 2YGYA 1EP2A 4JTLA 5FEWA 3TQ0A 5AYZA 1KM0A 4TMCA 2ZZ1A 1EIXA 2O7SA 3KRSA 2ZA2A 3W75A 4U3CA 3L2LA 3ZSSA 4XTDA 4FXSA 4PH6A 3MI3A 1YLVA 1TMQA 1X8FA 2WKJA 2Q8LA 2PWHA 1YADA 1XBYA 2TPSA 3B4UA 3M1ZA 1E3XA 2Q3RA 1SFLA 3ZWSA 2XVKA 3S1WA 4TU1A 3W73A 2YZRA 1JF6A 1UCWA 2V3EA 3CWOX 1B57A 3WFAA 1SW0A 1V3KA 5EPDA 2WQPA 3LCXA 1O4UA 1T0OA 1PHWA 1RD5A 3BGJA 3TFXA 1K7XA 2E8YA 1TTIA 3WK3A 3GIYA 2PC4A 3T44A 3W9ZA 1SZEA 3O63A 3CLWA 1ZAHA 4WX2A 3WNPA 1KM3A 4CGTA 3GDMA 4UFHA 3EWXA 3NL6A 4DO6A 3FLUA 3PUEA 1CW2A 2NXGA 4GC4A 2QUTA 3W22A 3NPVA 5LNWA 4YWIA 3GAYA 3JR2A 2NT1A 3QRHA 3U2OA 3I7SA 1EX5A 3VGEA 1OABA 3G1DA 2LLEA 4HNNA 1W3IA 1BWKA 1GVOA 4IPJA 1G5AA 5G4WA 3VX1A 3IV3A 5F4XA 1WZAA 2WC7A 1TB3A 3CQ0A 4JX4A 5L6UA 3VSUA 1AW1A 1C8QA 4OGZA 3NQ7A 4IMEA 1MXGA 4E2BA 1M53A 1G4EA 1T96A 1HO1A 2EAEA 2YA2A 5BMXA 4LY8A 1NM9A 3S5NA 5IM51 2G97A 4FX7A 3WY3A 3ZSTA 3BMVA 3EDFA 1VPXA 3TONA 1J0KA 1CPUA 1DVJA 1QOPA 4U33A 1ZFJA 3N2XA 1Q3NA 1LORA 5F4WA 3W1TA 1IIGA 1OVDA 4S2BA 4ALDA 3ZOAA 3OBKA 1X1ZA 4O18A 3LPPA 1W5NA 6CGTA 3G18A 2G95A 3EXTA 2XN0A 2OT1A 1G4TA 2V2HA 1O5KA 1NOFA 1IIHA 1JRBA 1XCFA 4ZVJA 4MJZA 1K7FA 1TPEA 2EABA 3C2RA 1A53A 4E2OA 1EO5A 1QCWA 1P6WA 3O6DA 1VS1A 1OFRA 1PZ2A 1AW2A 1GCYA 2EADA 3IK2A 3ZWTA 2ZYFA 4XKYA 4CQ8A 3F1QA 3D0CA 3KVMA 5I3JA 2FPYA 3O06A 5AHEA 1ME9A 4ZQCA 2JKAA 5CLTA 1VFOA 2DIJA 1KXQA 3RU6A 5K9CA 5IBXC 4U4MA 2J9XA 5F2MA 1SMAA 2ZWYA 4AXKA 1ME8A 1ZJIA 4JFSA 3BK0A 1JR1A 1PV8A 1EEPA 4WY0B 2CLOA 3NO5A 1IV8A 3EEGA 3W71A 3EXSA 3W7JA 4LS2A 4MKNA 2IQTA 1HFBA 2PRLA 1XSKA 5CZ0A 3UPBA 3W7OA 4PL1A 4O54A 3BSHA 4M7TA 3GLCA 1AQHA 3LBCA 1KXHA 3SZ8A 2WVUA 4LXFA 1KWKA 2ZDRA 3C61A 1JXKA 1TTPA 2GUUA 3O8AA 1HT6A 1F2JA 3LHYA 5ABTA 3EX3A 4JTTA 2XIIA 5CPMA 3C52A 1FWSA 1JUEA 1FCBA 4K8HA 5C6MA 5LNVA 1B2YA 4OE7A 3VKJA 1UBSA 5BW6A 3NR0A 4AHOA 1PCWA 3VNDA 3QZEA 3DHFA 2QAFA 3LX9A 4X9YA 3G8RA 4UTTA 4NJJA 3EKZA 1GG1A 4AEFA 5DCBA 4WY0F 3CTTA 3ZR5A 1VH7A 1JI2A 1BG9A 2NV1A 3GXPA 5DN1A 1CLVA 4O12A 5EBUA 4PTNA 2YPIA 4XUGA 3NQFA 2ATMA 1FX6A 1F74A 3IGXA 3TSMA 4ZQPA 3DI0A 4Z1AA 3NXFA 2CLIA 3RLVA 4B5NA 2H8XA 3GXIA 3LCIA 3O05A 3ZT5A 2WNQA 3U6WA 4UCFA 1OFBA 1TRIA 1Y0EA 2HMCA 2E77A 3HG5A 3W2UA 3LXCA 3KRZA 1LLZA 1W8SA 2PWEA 2QR6A 4WZHA 1TQXA 4O11A 1EP3A 3I68A 4X22A 1HL9A 4I7WA 3BVVA 3S5OA 1GWJA 4LC6A 3CM4A 4KFPA 3CIXA 4NJIA 4NNCA 1QPNA 3HQ1A 3OIXA 1SZGA 1ZS2A 1KM2A 3TMQA 1CGWA 4UQCA 2ZFAA 4IJBA 3M9YA 2PWFA 1AVAA 1K8XA 3B0VC 3PVFA 4JTSA 4Q33A 4UUIA 1EWDA 5HJLA 1WOAA 4FNUA 4JN6A 2JK2A 3MHGA 2XN1A 1X1OA 3L0NA 1P4CA 3W2NA 1H51A 2FH6A 1JVNA 1H7OA 2E0PA 1OK4A 1VCGA 1V3LA 3A5VA 1W5QA 1UH4A 2DJLA 3NZ1A 1XH0A 2E6AA 5G1TA 3LLDA 1QX1A 3BW4A 2FFCA 2JGYA 2A85A 4BF9A 5HR6A 1FWWA 1TQVA 3OVPA 3O16A 4U31A 4IMDA 1SW7A 2O7QA 4OV9A 3TROA 4RJEA 3G1VA 2QJIA 3M07A 4JFTA 3CEPA 3STCA 1DV7A 1SMDA 5EL1A 4UXDA 5HUOA 4PA8A 2YJQA 3RK8A 3QYQA 2Z1KA 1VRDA 1W3NA 3GXMA 3LHZA 1L6WA 3DX4A 4BWLA 1I45A 2RDTA 1L9WA 3EDDA 1SO3A 1TPH1 4ZQNA 4O1BA 3QFEA 4UTLA 1GVFA 1VHCA 3ZR4A 2BXZA 4O14A 4CLMA 3W7CA 3W87A 3TMLA 2QV4A 3IJ9A 3NL5A 4J9JA 2WOQA 2ZZ6A 3GXFA 4JXCA 2V2CA 4ZQMA 3TKFA 1TTJA 4UFJA 4ORMA 1TPWA 2C6QA 1N8FA 1WBHA 3RIKA 4QSHA 2ALDA 4Z1CA 4WQ6A 3TQVA 1RPKA 1TCDA 3W6YA 1MXSA 1XH1A 3T4CA 5E0FA 4AF0B 1CXHA 1L6SA 3EX2A 1V5XA 2GQ9A 4I7UA 1ODUA 2VUYA 5DY3A 3NPXA 3TAKA 3HB9A 4UTWC 2R91A 3LTYA 4Y96A 1KCKA 5I3KA 5IBXA 1KFLA 3MW7A 4XQ6A 3W1RA 3GDRA 4JNMA 1BPLB 2X2HA 3C6CA 5E93A 4AMXA 2D3LA 1XD1A 4HN4A 4FIQA 2F7FA 1NF7A 2ZIDA 1XDMA 4N6EA 2F1BA 1O94A 1TRDA 3NZRA 5C5YA 2EKCA 3NA8A 5LHFA 2Y4SA 4ADTA 2B4GA 3OVQA 4MB1A 3BVJA 3TH6A 3KE0A 4J3TA 3W2KA 1VLWA 1F05A 4RX0A 2V8ZA 3KFTA 4UTUA 2RDWA 3G1HA 3L66A 1TIMA 1ZJBA 4HSNA 3S6DA 3E96A 4AEOA 2ZTKA 2WSPA 2ZXDA 1XV8A 3NQ6A 3AMLA 3CZLA 3QEZA 5F7UA 4BI6A 3C2EA 1Q45A 2X1RA 4LVBA 4UTKA 3L2IA 4LUIA 5CLWA 2D0HA 1HTIA 2WNZA 3ANYA 3OLEA 1PVNA 2GVLA 4AAJA 3WENA 1JJKA 1U5JA 3MMTA 4M6VA 3W1QA 3EJRA 1C8VA 4O8RA 2D3NA 4MVAA 1OSEA 1LM1A 3V1PA 2F18A 2HSAA 3MP3A 1KGXA 3MYOA 4POCA 1QFEA 4FLRA 1LP6A 3IIOA 2VFDA 2F7RA 2ISVA 1WP6A 5LGZA 5D38A 3C3NA 4D2JA 3I7RA 3GXDA 1K3UA 1NEYA 4O15A 1PHQA 1TPB1 3E0IA 2WCGA 3ZT7A 2EQDA 1OYBA 2B7PA 2QCEA 3W7KA 1U30A 3AMKA 1A47A 4ATWA 2BXVA 2HTMA 4IGHA 1JI1A 2FE0A 1YDVA 2IGTA 3W38A 3KOFA 4A22A 1J0HA 2OJPA 4GO8A 2JGQA 2TAAA 1C9DA 3W1NA 2C19A 2YA0A 1JGIA 3PWAA 2J9YA 2B7NA 1VYPX 3HPSA 2A1YA 2VR5A 1GJUA 3GKFA 1QAPA 2NT0A 1CXFA 1R2RA 1DHKA 3IGUA 2V3FA 3ZQ9A 1M5WA 3KRUA 3LRLA 2ZRZA 2WVVA 3S5YA 5KZDA 2XWDA 2ZCGA 3NG3A 3UWVA 4AYSA 2VEKA 1XCWA 3CZKA 4N6FA 2NUWA 3PF3A 4UMCA 3SY5A 1W54A 3LPOA 3GKAA 5E9AA 2Y89A 3TJXA 2AAMA 2VXNA 4X9SA 5HUPA 1UH2A 3NYZA 4UFMA 1NSJA 5AB3A 3H53A 3HJEA 1J2WA 4CNNA 1JL8A 3GB6A 1S46A 4S1FA 1O5XA 2FLIA 2D73A 4CNPA 4A2RA 3VGGA 3QW4B 3R89A 2NUYA 1E3ZA 1WQ5A 3GZ3A 1X6UA 3NQ8A 4GRSA 3WN6A 1Z42A 4JIQA 4JY8A 4R33A 3BUDA 5I3FA 1LOQA 1LYXA 4AMWA 4OQVA 3QQ0A 1DEDA 4MOZA 3S42A 1A5BA 2A21A 2EAWA 2WSYA 4JYEA 1BLIA 4TX9A 4Z0SA 4NVTA 1ADOA 4WUIA 5DCEA 3W1PA 4O19A 1H1ZA 5AC8A 3NQVA 3VE7A 1QPKA 4FNSA 4JX5A 1F76A 2V5BA 4JTHA 1QI3A 2EEXA 3BPWA 3AJ7A 1DKWA 3DHDA 3E49A 1JAEA 1XBVA 4MIMA 1QO2A 2A0NA 4RZ6A 3MP5A 2QCNA 4N4PA 1XUUA 1JFHA 3N14A 1SZNA 3DFOA 4GBUA 1PL9A 2B7QA 4RXFA 1TMHA 2ZXQA 1NVMA 4Q32A 2C14A 4LOCA 4Y90A 1PCKA 1OK6A 1SSGA 5I3IA 3BW2A 3SFKA 3VMOA 8TIMA 1FCUA 1IXPA 2YYTA 1H3GA 4J3WA 4N9EA 4M6PA 2XVGA 1JG9A 3CTLA 3EXRA 1CGTA 1BAGA 3NL3A 3R13A 3DH7A 5DXXA 1KBIA 2F2HA 5GVJA 3KVLA 1CDGA 3VSVA 1VCVA 1CGUA 1O7DC 1XDLA 4LQ1A 1LZOA 3GYEA 3BVUA 2QCMA 5G2IA 2WNWA 1B3OA 3C2VA 1SFJA 3MJYA 4UTWA 1VYRA 3WK1A 2FIQA 3P7YA 4QJ1A 3HGRA 1G69A 3A22A 1RQHA 5LNUA 1ONRA 4DXVA 3K8MA 1HTYA 2E4TA 3VGBA 3LV5A 5KEZA 5HINA 1CXEA 2FDSA 1GVIA 3QH2A 1R2SA 5E1QA 6TAAA 4XTIA 5AHFA 1OX4B 1R33A 4FX6M 1TO3A 4OIFA 4IMCA 2OSYA 1KFEA 1Z48A 1FCQA 1F7BA 2FHCA 2AMGA 4B9ZA 4NJHA 1IZKA 3L68A 2EACA 4S2CA 1W56A 1UB3A 2DZWA 4UTMA 4UZSA 3WDIA 1JCYA 5K4ZA 4J7RA 1JQXA 3LBMA 5K9XA 1M7XA 3W7HA 4GI6A 2OMAA 1WDWA 3W85A 5C55A 1EPXA 1GYNA 3T55A 2FB3A 4K36A 1G94A 3R8RA 1H7XA 5KZMA 1RVGA 1FWNA 3L4YA 3CU2A 3CZEA 5CSRA 3NDOA 3GNNA 3QJAA 1LWJA 2QAPA 3MP4A 2JBMA 3HO8A 2QEZA 4ONVA 2BX7A 5TIMA 3EWZA 3STFA 2J25A 3DX2A 2EF9A 3HOJA 1V3MA 3NAVA 4XWUA 3DFSA 3L21A 4NXSA 1I8JA 3PY2A 2TRSA 4LVFA 3UZJA 2GVGA 3G0SA 1IF2A 5L9FA 5SWUA 5K9DA 4LVDA 3PUDA 2H3DA 3VCRA 4EF9A 2YFNA 1OYAA 1ZAJA 1YPIA 1AL7A 2F7PA 2YX0A 4WF7A 3VE9A 1V3JA 3FW6A 3BV4A 4FNPA 4ICNA 4O4VA 4YMZA 2DZPA 3L2MA 1JDCA 3ZO9A 5D2VA 4ZL1A 1OFAA 3B06A 1P0KA 3L67A 1MW3A 4AH7A 2ZZ2A 3RNDA 2D2OA 1KM1A 1EHAA 3SJ3A 4NQ1A 2Y62A 2BLEA 2QUUA 5DCDA 5F4SA 4AWTA 1RV8A 4NX0A 3ABRA 3R2GA 4WLCA 3MI2A 2DH3A 2WKLA 1YTKA 2ZUWA 5CGQA 3WMSA 2Y61A 2FGZA 1F6PA 4TMBA 1B0IA 3UEQA 7CGTA 3K8LA 2QPUA 2ZX6A 3W1MA 1H7WA 3LCWA 4XZ9A 5LHEA 2DH2A 1RPXA 1K8YA 2EJ1A 1FXPA 1M7OA 4JS3A 5AFDA 1BVZA 3S1UA 2CZ5A 1MEIA 3HMJG 3IJ8A 1G6CA 1JUKA 3L65A 3IJ7A 5D2WA 3P5YA 4O0ZA 2Y5EA 4LRSA 4WJEA 4QITA 3BUBA 3UYCA 3E12A 5FF3A 4QNEA 1G1YA 1KBKA 2C7FA 4TIMA 2YFOA 2ZZ7A 1XGZA 4HSOA 1DJNA 3PG8A 1LBMA 1OFEA 4FXRA 4AWUA 3BH4A 1E43A 1I2OA 2ISWA 1QWUA 3N73A 3VI2A 3IEBA 2VELA 5FF0A 4ZZ9A 5AYXA 4JFUA 4PCTA 4CQAA 3WNKA 1H7RA 1SQ7A 3TQKA 1TQWA 2BXYA 3P5ZA 1DHPA 4LW7A 2E9BA 4XKYB 1OHLA 5I3HA 3UD6A 2VEPA 1DORA 3P8IA 4TO8A 3EDEA 1HL2A 4P2VA 5C2XA 1YDNA 4MUZA 4ZQRA 1KFKA 1Q6RA 4PFMA 1GJWA 4OBTA 3FKKA 3ATYA 2OW6A 1ALDA 3VGFA 4LTSA 4H2CA 4O17A 4H4IA 3HJZA 1AG1O 1W9XA 4QAWA 1I4NA 5HWJA 5C54A 2JKEA 2Z1BA 4HKPA 3W7EA 1M6JA 3B8DA 1K7EA 1SO5A 1UJPA 2Y7GA 3RILA 3ABOA 1UOKA 1BSIA 4TVUA 3UG4A 3LHVA 3YPIA 3GBDA 3WEMA 4CVWA 5BRBA 3WNNA 5AHMA 3EDKA 4AIOA 1PPIA 1W5PA 4NUWA 2I14A 1UD4A 1HG3A 2A7RA 4O50A 1MXDA 2J9ZA 3W84A 4AIEA 3A24A 4HA1A 3C56A 3HIJA 3EWUA 1VZWA 4JYDA 4L4MA 3THQA 1DOSA 1KBBA 2BHUA 3ATZA 5DBTA 1JCLA 3KLKA 3DFNA 5A6MA 1XI3A 5K7JA 5I23A 3W2MA 4CCEA 1LBFA 2DIEA 3QMSA 5CKSA 1THFD 1ZY9A 1YPFA 3EWBX 3C0JA 4BFAA 2GJNA 1V7YA 3W74A 2GJRA 3B05A 3W88A 4E0CA 3LERA 1YTDA 1CGYA 5LNSA 4RK8A 1LRTA 2C1HA 1KFCA 1ICPA 4LVAA 4MZ1A 4KMQA 4MZ8A 4M56A 2AGKA 1W0MA 2FPVA 1P1XA 3TW6A 3L0KA 3EDJA 1MWOA 3BG5A 1Q6QA 4MLRA 3S9YA 3UXAA 2NV2A 2ZBTA 2DJXA 1JD7A 2J27A 5A6LA 1RP9A 3TC6A 3PBYA 4YLWA 3GDLA 5AHIA 3TTSA 1G4PA 3NPWA 2VFGA 5CPOA 3ZR6A 1PE1A 3N9SA 3DDGA 2QCDA 4LC8A 2NZLA 3STEA 3D51A 3V75A 3NQCA 2WCSA 3KL0A 1JRCA 5HR7A 4GUFA 1I2PA 3QF0A 2H6RA 4UNLA 9CGTA 3BMWA 1DBTA 1VFMA 4DPQA 2W6RA 3T40A 3N19B 5FF4A 4E2DA 2A7NA 2WNNA 5D04C 4HPXA 3WY2A 2Y7FA 3GBEA 3QSTA 2ABAA 1PAMA 2VEMA 5CZJA 2RKXA 2BTMA 1UUMA 2WVTA 3ELFA 3GNDA 1OF6A 1UKTA 1R2TA 5D33A 3GK0A 1HX0A 3DFQA 4GQRA 1L6YA 1BF2A 4DELA 1A5SA 1R47A 5D30A 1VCFA 1KLZA 3L5MA 4AEEA 3G0UA 2FHBA 2P0OA 3ZFHA 4JTEA 1EUNA 3W7NA 1OX6A 5A5WA 1A5AA 2GVJA 3CPRA 3SW6A 2GPTA 1OX5A 1LROA 1F5ZA 1JUBA 4N4QA 2GQAA 2GJPA 2FPTA 4K37A 4AMAA 2ZA1A 3L9CA 4X2RA 2YXGA 5HPOA 5HULA 1XKYA 3NVTA 1GTEA 4N9CA 5AN7A 4EIVA 2RH9A 4Y9AA 3S5ZA 2BY2A 5CZTA 4K39A 5EA9A 4NNAA 1VB9A 5K3VA 3QGVA 4BK9A 3H54A 3TA6A 3CGTA 4DF0A 3IIVA 3M0ZA 3WJSA 4BR1A 4Q4KA 1XC4A 4DEFA 4YXGA 5BRPA 3HG4A 4O0KA 3EKLA 2ZZ4A 2V2DA 1WZMA 3P84A 3R5EA 1T99A 1EA0A 3LXBA 2P1FA 4GQQA 3E02A 1D3GA 2ZRUA 1MSSA 1JXJA 3VGHA 1GTHA 3GAKA 4LPCA 3LB0A 1HL8A 3BARA 2FHFA 5D03A 5HWMA 3BUQA 4QIUA 3TSBA 1B4EA 2V81A 3LV6A 3TDFA 1ZJAA 5A2BA 5DXYA 1I75A 4NNBA 4YCPA 4GE8A 3KVJA 1WE5A 1SO4A 5LGXA 1KFBA 1KXVA 2P10A 5G1YA 1UD3A 3W70A 3F03K 1OT1A 3WJZA 3O6CA 5G2WA 3DU0A 4K7YA 3EWWA 4DO4A 3MYPA 4UR8A 4HP5A 1KTBA 3K1DA 1JCMP 1OT2A 2HS6A 2F1AA 4ZQOA 2ZUSA 1WA3A 2QCHA 3G1XA 3W1AA 1OFDA 1QDSA 3W7GA 3UWWA 5FF2A 1UD5A 1MFVA 1W31A 4NX5A 3UWYA 1VJIA 5G4EA 1DTUA 5DBUA 4A3UA 4JTKA 3RLUA 3FJLA 1FDZA 4HOZA 3THAA 5KTLA 3BAWA 2ZUVA 1TPFA 1U2YA 3BVXA 2A2IA 3QQ1A 4HOWA 3M5ZA 3LGEA 5EKYA 2RFGA 1OJXA 3EX1A 3LCHA 1EO7A 4JCMA 2Q8ZA 4QAIA 2X1TA 1J0JA 3LI0A 4UCGA 4WXZA 5F1UA 2Y24A 1Z44A 2W0UA 1TQSA 3PB0A 4OT7A 4JD4A 3RMJA 4NU7A 3O6YX 5U7SA 5EMUA 3P80A 4FNQA 5CPLA 4BZYA 3VMNA 1MEWA 3NL2A 4UQEA 3HGSA 4X3ZA 1SPQA 3DFTA 4PSPA 4MAZA 3MO7A 3IGSA 3WJWA 1ZHAA 1XXXA 1WO2A 4UQBA 2H3BA 4J28A 1PS3A 3PUOA 2PRHA 2WPBA 3EWYA 1PIFA 2ZE0A 2QUVA 2Y70A 2BHYA 1BEUA 3DAQA 3Q58A 4AVFA 3LCLA 1WV2A 2CWNA 5D2XA 1VIWA 1FWRA 2TSYA 2X2GA 3PM6A 2ZX5A 3INPA 3GR7A 3M41A 5DELA 3M5VA 4GFSA 3TW7A 1W5MA 1LLWA 3LLFA 2Z6IA 3BLPX 2F61A 2H8ZA 1JD9A 5F2IA 2DU2A 1S5TA 4A2SA 4GUHA 2Y6ZA 3F4WA 4JYFA 4UMBA 3AJXA 3S2CA 4RZ4A 2J24A 4CNOA 3BAKA 2CXGA 4LVGA 1LTDA 2QCFA 3W7DA 4UMAA 3LHWA 4FNTA 4UOZA 5E6ZA 1DQWA 1TQTA 3KL3A 2NX3A 3W7QA 1I2RA 4H8HA 5A8GA 1JCJA 3BCFA 3B03A 4JICA 4EWND 6ALDA 1YXYA 3CZSA 3M44A 3DKJA 4O1DA 1D3CA 3EJUA 3KHJA 2PWGA 4PC8A 1QPRA 2FTPA 3VM7A 1H62A 3KXQA 4R53A 2WVVB 4H6KA 5KSWA 4FF7A 3W37A 4LS1A 1SZFA 1IGSA 5D37A 4XBSA 2YCEA 4C1KA 4O52A 4RXGA 6TIMA 1KV5A 4MY1A 3EB2A 2DZXA 1OFOA 5D2TA 2G5WA 1CXLA 1XD0A 1LBLA 2DZUA 2OX1A 4JDYA 2X1SA 2YSWA 1TQUA 3OA3A 1GJPA 5HXMA 3CHVA 4O13A 4MYAA 3WNLA 3EX6A 1W5OA 3BW3A 3P67A 4XBKA 4FHAA 4GIAA 1H63A 4Z08A 1H7NA 2PWDA 2CFFA 2YOCA 3ABQA 4AW7A 1G7VA 4LT9A 5AHNA 2E8ZA 2VKZG 5G5IA 4J3XA 1FCVA 3O1NA 4UFKA 3K30A 3L4UA 1WPCA 4UTIA 2ZRYA 2DZTA 4M19A 5EY5A 3W07A 3DDFA 2PRMA 3FOKA 1MFUA 2GVYA 1PIGA 3CC1A 1CXIA 5HDRA 1X7FA 4KWWA 1AMYA 4LS0A 3F4NA 5DFAA 3TXZA 4DBDA 3UERA 4FB7A 1LRNA 1ICQA 1LOLA 1E51A 1GVRA 3KVKA 4NI3A 1D9EA 3PR2A 1IZJA 2FJKA 3TE9A 1MZHA 3PSVA 5HNRA 3WY1A 2C8NA 4AHPA 2FH8A 4JTFA 3EJQA 1RR2A 5BOOA 1Z32X 1WAUA 3A47A 3S0CA 3FKRA 3D52A 4AYGA 1MEHA 4ML9A 1SUXA 3EJSA 1EH9A 2QDHA 1UD2A 4OKDA 2Y7DA 3G3MA 2R94A 5CG7A 4RZ5A 3W72A 2OT0A 1R46A 4NZJA 1TSIA 4N2YA 1L2UA 4QQ3A 3D4ZA 5AHLA 4CN6A 3DI1A 3UPWA 4GI9A 3CEUA 3DKLA 7TIMA 3B0PA 3L5AA 2NWRA 3RF9A 5KINA 1D7FA 3N2MA 1WZKA 2VOMA 1NFBA 2E6YA 3OEXA 4NZFA 1JIBA 3WY4A 1TYGA 4MY9A 1E40A 3FAWA 1VR6A 4L4LA 2E5BA 5E6YA 1CI1A 3NQDA 1A50A 3TXVA 3G1FA 3G24A 4RCXA 3M5YA 3PG9A 1KCLA 3A5FA 1GG0A 4BI5A 4PEEA 1QPOA 2F7QA 3I6RA 4IMGA 2ZX8A 2VRQA 1ME7A 2WSQA 3P62A 1WBJA 2I1OA 1RQBA 1R34A 3I65A 1DQXA 4MPQA 1UKSA 2NLIA 4JTIA 2R14A 4O4WA 3HZ3A 2CZDA 3O07A 1VFUA 2ZUUA 3B04A 5I5RA 1HUVA 3LHUA 2Z6JA 4FLOA 3BG9A 1VAHA 4IQLA 4LUJA 4UTHA 2X1UA 3ZT6A 1C29A 1HO4A 2EHHA 3IIZA 2YA1A 5HQEA 3O15A 3I7QA 4MZYA 5D05A 3G1SA 4QISA 3VSTA 2F84A 3HG2A 1GQNA 4K7VA 4OWGA 4UR7A 3C4UA 3C8FA 4A29A 2G96A 5TD4A 1BVNP 1QR7A 4HOXA 1FBAA 1SU5A 3W83A 3UQNA 2XWEA 3UWQA 3SGZA 1YXDA 3L4ZA 3PBWA 3W76A 1UD8A 1KB3A 2WPGA 2CZEA 4JX6A 1TQJA 1R30A 2B7OA 4P61A 2QPSA 2E1DA 1U83A 2C0AA 2QDGA 4M5PA 2V30A 2V5LA 4MY8A 1ML1A 1ZALA 1BTMA 1G7UA 3TR2A 4HPJA 3KX6A 3CZNA 4MYXA 3TOPA 3C2FA 1UKQA 5F2GA 4N9BA 3AO0A 3BVWA 3HGJA 4ZMGA 1YXCA 1UD6A 3FEMA 1WYIA 2V82A 1EB3A 2PCQA 3GTNA 4UFIA 4CCCA 2OSWA 1J0IA 5HMSA 3UWUA
chains in the Genus database with same CATH superfamily
4XZMX 4M1CD 4OLVH 5FDWA 1RP8A 3ZBMA 3T8QA 1P4LA 2XUWA 4P23B 1B30A 2YKKA 2CE6A 3EHBD 4UB0H 4WI9A 5CF3A 1KELL 2XU2A 5CMAB 2NVAA 1DVYA 4D8ZA 3BLBA 1HE8A 2YPVH 3K8KA 3S88L 3BC9A 2QADD 1RZIA 1KCSL 4ABUA 2AAAA 5DUMH 3PXHA 2C13A 4FF9A 4JLRB 3I75A 3NQIA 5ECGA 3LXAA 3RKDC 1CBGA 3LD5A 4KCUA 5DMGC 2X3CA 2XTJC 4XZBA 3NJFA 1XJBA 4H5SB 4XN2A 5BUAA 2J55A 3EOTL 3AMGA 3RFAA 2NY1B 2AJVL 3QDHA 4H8UA 4TTUA 4DYEA 3V0TA 5HMDA 4NYLB 2E68A 4OFYD 2P5EE 3VMPA 3CFKB 2YC1A 3RJDA 2G30A 4ZUSA 4HHPA 2Y2TA 1T6MA 2IGFH 2QELA 5GGQL 1O60A 5C0IB 1VHNA 2D7TH 3DMMC 3H2WA 4NRZA 1CYGA 2DQCH 4JG0L 4AD5A 5KUKA 4W4OC 1A7RL 1WWBX 4EOWL 4LSDA 4Z78B 4W6XB 2Z00A 1S9VA 4JQ3A 3V52L 4OV4A 4ZD3L 1IGFL 4G70B 3W5MA 3LENA 3MGTB 5DFTA 4NZDA 1NGZA 1JF5A 2PODA 4H26B 2BNRD 3SO3C 4JQXA 3WKQA 3PTMA 4HJIA 4JRLA 2ATSA 1T5XA 2WINA 4M5SA 3VXQB 3RZWA 4JQ1A 4QYOA 2X3AA 1EJFA 4A66A 1MIEH 3VGAC 3AICA 2V2XA 5U4NA 1JHKH 2GJLA 3DSFH 2WXHA 1KYOK 3TCLB 4C1LA 2VLRA 3BP5B 3QJFA 4DUOA 2GTWA 4HLJA 5JVLA 1RIVH 1QEXA 3L3GA 3RYSA 3AQZA 3IRSA 2KBGA 4OD3H 5LWYH 3GRIA 3RDTC 3RBGA 4XNZB 4QM1A 3A9IA 4F3FB 2VQ1B 4HUCA 4MVBC 1KT2B 3QTGA 3T1WA 2NQJA 4P2QE 3N13A 1N0LB 1E5BA 2BP0B 3RWDB 2FR4B 3OKKA 1I85A 1AQ8A 2FWSA 2CDEA 4UTAL 2CIIB 2ACRA 3ZY7A 1IFRA 3LHPH 3JS3A 4PZVA 2OLAA 2C18A 3QMRA 3FAXA 3R0NA 3PJLA 3BIKA 1NFPA 4W68A 1RI8A 3LTPA 1PL3A 1QHPA 1OQFA 4HIJA 3U4AA 5HVFB 4FLSA 4YHML 1G6RA 5HDLA 2D2JA 1QBAA 4OKVB 1JULA 2VX7A 3NFUA 5I71C 5HHXL 4ABWA 3OLGA 4KI5F 2AABH 2ZXAA 1GYUA 5ISZA 2EVIA 2DKMA 1COBA 4JO4H 2YIHA 3TU9A 4GP8B 3VXMA 1NFKA 4RLIA 3P4OA 1YKWA 4NT6B 4PBDA 4RISH 3N4EA 4H8VA 3WUBA 4DZIA 3DX1A 1YDYA 3FKUS 2LOEA 2WIIB 3IU3A 3QQXA 3TV3L 5DMIH 4PRDB 5DZAA 2VFFA 3GSMA 2NUPB 4IS6B 4K71C 5D1ZD 3AT8A 5I8EA 1FDLL 4OCYH 4MCNA 1AXTH 4RRPM 3VRLF 3MRNB 4FX8A 2AXHA 1UJ3A 4DO5A 5CILL 1XCTB 4FA8A 5F2FA 2IDQA 2HRPH 3BT2L 1UXSA 1NUDA 1UFUA 4HX1A 1IGIH 1L9TA 1IU1A 3F12B 2OTUB 4IPNB 1ETJA 3OZKA 5C86A 3I02A 5EV7A 1EOMA 4O51A 3GNOA 3FMGH 4U1KA 2FJSA 3QXDA 5CJQL 3O6KH 5D7JC 1IGJA 4I5RA 1SFTA 1ULVA 1K5NA 5EEZA 1W3HA 3PP4H 3BWWA 4QR6A 3NFNB 4YNGA 1S7XA 1I8KA 1Q6FA 3QUHA 2IIJA 4H9YA 2P7TB 4ICMA 4M1BA 1KZQA 3NZQA 3QZOA 3AWEA 4OJFL 4IOFC 2DGAA 3E8VA 2J7GA 1IKFH 1QATA 2R1MA 2OX5A 4DNMA 3E38A 3GF8A 3EGDA 2QMJA 2NV9A 3HR6A 3QUXA 1US3A 4D94A 4JDEA 4PP1C 3RGVC 2XFWA 1DANT 2DWXA 2I9TA 1HWWA 4NKDA 2FYYB 2ZNXA 1TELA 3U46A 4GVFA 3D39A 3PPHA 2K6ZA 3CWNA 1EJOH 4XX1G 3QUZC 3V4PL 3UA4A 3LD8C 4JTJA 1OAUH 3QUMB 4F57H 1WCBB 4PH6A 5D96B 3MI3A 2WKJA 1QSFD 1V05A 4N2BA 3R8BB 3WUFA 4ONHA 3MO4A 3MV7E 4P5RA 3K74B 4MNKA 2WQPA 3NABL 1RD5A 3NSDA 2V7NA 3RU8X 2PC4A 5I2IA 4I5XA 1SZEA 4LBEA 4YE4L 4J3OG 5IB3A 4XPTH 4UFHA 3K3QA 1IWBA 3TC3A 1ET5A 3QZWB 2ISDA 4D1JA 2WWKT 2HG5A 3FT0A 5K33A 4GABA 5I19H 5DVOA 1XLIA 5D4YA 1A5MC 4WVRA 5A69A 5HHPA 1Z9SB 2E7CA 2XV2A 1HXYA 4D7PA 1AW1A 4QRPD 3K5RA 1C8QA 3L3IB 3MV8E 3P30H 5FAGA 1IIKA 4XNQA 5DD5H 3DIPA 4M9OA 4YPJA 4OZOA 1XBRA 4XPBL 4YYFA 1CPUA 1E8YA 1QOPA 2BPBA 1Q3NA 4ALDA 3G18A 3VQLA 1C7SA 2CR6A 2EXWD 5AQ0A 4BINA 1EJ6A 1NFDA 3C5QA 3UYIA 3TC9A 4DUXA 2VDKH 5LBSA 1Z0NA 4OQTA 2DIJA 3AU2A 2IV8A 3OXSA 1G1CA 1A6VH 1EEPA 3EJYC 3KM1A 1XF2B 2DV6A 2VDLB 3CXOA 1KTDB 3QBTB 4G6ML 3ENLA 3MRIB 4IDJH 1KWKA 4XVUD 5CCJA 2D9QB 5HDBE 3O8AA 1MAML 2XIIA 2DT2A 3C8KA 3ARVA 5CPTA 3Q3GB 4LP4A 4F9PA 1UBSA 4JFEE 5IJKA 2UYLB 3S3SA 4KVNH 4X9YA 4HCRL 5AZ2H 1U8IA 2R4RH 2CDGA 2IVFC 3CHFA 2F19L 3DI0A 3S8FB 3NXFA 3T8VA 4PU2A 3RJQB 3LKOB 4AM0A 2F7IA 4IOSD 4QOKD 4X22A 1J9YA 3U7BA 5E7BA 2NX5E 3DG6A 4KUZH 4UIKH 3OIXA 5F0MB 3G5ZA 4X6BA 2B9BA 4UQCA 4HZ1A 4P5KB 1NLBH 1VBJA 5AB2A 1CLCA 4OFKA 3W28A 4L64A 4FHBD 2V2TA 5EB8A 3OKMB 1KXTB 4A6YB 2Q02A 5D2NA 2ISFA 5C0ND 1CNVA 3IU4L 3M07A 5F1IA 1TVLA 4JFTA 5CZXD 1JZFA 3RK8A 1D5XA 2Y0FA 3D4CA 3FUDA 2GDVA 2X4SB 2CRMA 3I6GB 3QFEA 2X41A 4XX5A 4DETA 1TYRA 3H9SE 4GRLB 4P46C 3GW3A 3AHZA 3NL5A 4J9JA 2WLIA 3TKFA 1TJHL 2WP3T 2BSCA 3JWOH 3PNRB 2BRRH 1MRFL 4HK5A 3H0TA 3QCTH 5E0FA 4EN2A 1ODUA 1KY7A 2R0ZH 4TSBH 3LTYA 5I3KA 2Q8XA 4PJ7A 4YSDA 4E5XA 5DUPH 2BFVL 1X7QB 1A6ZB 4APQC 2H9GA 4B6ZA 4P0DA 3WQVA 3OVQA 4Y19D 5LB1A 1ESWA 2PZ0A 1QRNA 1ZXKA 2WOBA 3G1HA 2YAOA 3QR0A 4GY1A 4PJHB 2Y7SA 2OO0A 1Z3NA 4ZYKA 3ZL2A 3WENA 5D1XC 3K2IA 4FYRA 1MI5E 2WBKA 1PLAA 3BN3B 1AJZA 3OG2A 4FR1A 3L23A 5DHYA 1K3UA 1OW0A 1OYBA 3OVUB 4UT9H 4P04A 1U30A 4ATWA 1FWGC 4EDXA 4PJHF 1OALA 3XINA 1Y07A 4MMXC 3MJ9A 4N0UB 1CXFA 3TA3B 2AVFA 1TZOA 4K2SA 4NZUH 1ZLDA 1CE6B 4N6FA 1EEXA 2Y25A 3BEWA 3ROLA 2QGHA 2V8MA 3GKAA 1KN4L 3TJXA 4A8IA 1FORL 3GH4A 4LF3A 4QRQA 3QXWA 3ATDA 3IMSA 2CBVA 3DSNA 3WN6A 3GMQB 1Z42A 2IOOA 2AL1A 4FG0A 2GGEA 1R3QA 1T2QL 2P88A 4N0RA 1IKNA 1OP4A 4MOZA 3BE1L 4P49A 2JIXB 3UR8A 5DCEA 4LESA 4YDJA 1IFGA 4MB3A 5I74C 1MREH 4JFPB 1P5UC 2N56A 1U1UA 1GONA 3QCVL 4MKVA 3U1SH 2P8BA 1JAEA 1GTNA 4DEPC 3EYVB 1OGPA 3VCCA 3CN3A 5CN3A 1TTGA 4BFNA 1BOYA 4M48H 4OZHA 5AW4B 1DE6A 5CBJA 5FYJU 1KTJA 5FGCB 4X0VA 4DKTA 1B3OA 1B9ZA 1A3ZA 4ICCX 4TQEH 5KYUA 3N1PC 4OFCA 4X4ZA 1ILSA 5KOMC 4I0KA 4N6RB 3BZEB 4PB3A 5E24E 3IE9A 3BP6B 1VBRA 1T5WB 3GO1H 3F7KA 4WI2A 5A95A 5K4ZA 4ACZA 3B1UA 1N8IA 3AHXA 3ZGHA 3T55A 3OQRA 2FB3A 1RIHL 4HQVA 5FWQA 2ALAA 3V0WL 4Q52A 5CSRA 4AQ8A 1S39A 2VM8A 3AQYA 2QAPA 1DUZB 4MGXA 1T83A 1Y6NR 4JRYD 4WZ9A 4X42A 2WMIA 4LDLB 2WO4A 5BPPA 3UZJA 1DDTA 1A6AB 2K1MA 3TS8A 4IBLT 2D7OA 4GKZA 1VESA 3L9RA 4Z7NB 2F7PA 4U1JA 1GGTA 2F9BT 2VN6A 2B5IC 4ZL1A 5F9OH 3B06A 4JN7A 2ZZ2A 3OKLB 1BZOA 1RV8A 2VAJA 3R2GA 2C9XA 2UV3A 4UBPC 3FEQA 3WMSA 5EU4A 4PJXE 1F6PA 3KJ4C 2ZX6A 2X7WA 1U92A 1PFOA 2DKUA 3T0EC 2GITB 3TN6A 4O0ZA 4KH2A 3BUBA 1C12B 4Z7NF 1W2VA 3TEYA 2CD0A 1UZ8A 1DVFB 1ZPUA 3ARXA 3VH8B 3JWNG 3BXNB 3TYFB 4FI6A 4ANWA 4QRTA 1B3VA 2P8PB 4ZZ9A 3BQVA 5T1LD 2CBQA 1OD7A 2R2HB 1NCAL 2VGLM 3MOAH 2PR4H 4N3UA 4TO8A 2YSSB 3D2UD 1IBHA 5L6YL 3D08A 2IAMC 4GVGA 5DLLA 4Y1AD 1AG1O 4HKPA 3B8DA 1W6TA 2VZSA 3AMDA 3EGXB 3T0AA 4HBQA 1JHTB 1YMYA 3IUIA 5EOCH 3W5NA 1I4FB 1US2A 3I2CL 2HPTA 3WHXA 2R8SH 4LARH 2WK2A 4F8QA 2GJRA 3FJTA 3OGCB 1QZNA 4AZ8A 3V35A 4P57B 2JV6A 4I8DA 1KBGL 3UTTA 1MWOA 3IFPB 2XQBL 5IFPA 3PWNA 2J27A 3N50A 5A6LA 3K6DA 1BW8A 1LL4A 3CYJA 4F15B 2OMNA 3N9SA 3DDGA 4IRZA 2GSIB 4WKHA 2WCSA 3KL0A 4GUFA 3RO8A 1ZVSB 1FRBA 3FUFA 2H6RA 4P07A 3DVNA 4U6VL 3OSVA 1Q8JA 2ITCB 3F58H 2HFGH 3UP8A 3L3JB 3WY2A 2Y7FA 3X3FL 5LXGH 2OAAA 3MCOA 1R3KA 4WTZA 4FP8H 3OPZH 3WLOA 3Q44A 3NOYA 2XTKA 1F00I 3QTPA 5AKRA 5E2VL 3CG8A 1AKPA 1NBZB 3CPRA 2KS0A 1QNQA 1ZL1A 2OMWB 2YAQA 5I6MA 5JW3H 2MJWA 4X2RA 4IRSB 1VACB 5HULA 3WTXA 3C0SA 3BPNC 3QG6A 3MRRA 2J6EH 4NNAA 4MLIA 3MODH 4NQDD 4DZ8A 4PJ5A 1U93A 4BR1A 1XC4A 4L0YA 4BQ2A 5SWQB 3WS6A 3PJWA 4HF5L 3P84A 3FN3A 2YK1H 1DWIM 4ONFH 3PGDA 3EOEA 3QNZA 3THUA 2NW0A 1UM4H 2PDPA 2NR6C 3MV7A 4DN4L 4MUPA 2D2CC 4XD4A 4ZQOA 3EW3B 4PY7B 3R7QA 3JZUA 4TLTA 4HV8A 5JZ7C 5LA1A 2CBTA 4PWGA 5ESVA 1ETZA 1GEHA 3N17A 3OB0H 2BNQA 4FABH 3Q8BA 4V2CB 3THAA 5LN4A 5JPNB 1LD9B 3RURA 2YDRA 1GOOA 2CBUA 5FL1A 1DLHB 4IH3A 3V5KA 2X1TA 5JR1H 3V8OA 4EJ1C 3QEGL 4XI5D 4V1DE 3VTMA 3N3EA 1FNSL 3DTDA 4FJ6A 5LGJA 2MSPA 2FBJH 1ED3A 2Z24A 2WPBA 3ZLFA 1NAMA 1YPZF 4A3QA 3R1GH 4AVFA 3M88A 2IG2L 3HE7A 4NGHL 3FVMA 2TSYA 3M5VA 3BLPX 3ABXA 5A2JH 4A2SA 4OCSL 3AJXA 4Q2ZB 4CNOA 3BAKA 3DV4B 4N2IA 2QCFA 4UOZA 4UYQA 1TQTA 5MP6L 1MQ8A 1AQKH 2YLKA 5M1TA 1NCDH 4DYKA 4EWND 3KHJA 3KXQA 3VM7A 5HYSA 4GS7C 2XX1A 3Q6GL 6TIMA 2OKOA 2G5WA 5IHUL 2DZAA 3OA3A 3ALFA 3SCWA 4O13A 1A1MA 4WJ8A 5JO5A 1L0YA 3D0LA 2QPXA 4IMKC 4KROB 3KWWB 3B9AA 2APTA 2ZRYA 3FGCA 4OF6A 3AM8A 2A77H 3B1TA 5HDRA 5EULV 5BZAA 1BQUA 5M7QA 1KCXA 3KVKA 3C8DA 4WO4B 1JGLL 2FH8A 4HFUH 4IMLA 2EIMB 3F4CA 3MNMA 1UD2A 1FIEA 4IM8A 1NSNH 3WD2A 1Y5VA 4L4PA 3HNTH 1DQML 1NFBA 2VDMB 3EYSL 4MY9A 3LKNA 3W39A 4R27A 2NX5A 4NQCE 3A5FA 3RLHA 1OSYA 3V4VA 2NY5H 1FZKA 4IL0A 1T7LA 5FGRA 3D2TA 2EVJA 3GLEA 4FXTA 3HZ3A 4GPNA 4CEXC 4Z7QB 5DI8B 3MLWH 5TGBB 3BG9A 5JMOC 4BDVB 4DP2X 3W0WB 3FU5A 3I7QA 5E2UL 4WRLA 5IQMA 4ZODA 5E6ID 4X9FA 3O2WH 3QGAC 2UXVA 2DYSB 1AI1L 1O6TA 2X7LB 3QWOB 4CC4C 1R30A 4E6MA 4M5PA 2V30A 4G80A 4ACPA 4Z7QF 5E0QA 4NQTA 3V0GA 1EQCA 1XIWA 1CYWA 3BDYL 1NCTA 3H9SA 3S2MA 4B91A 2G9HB 1ZP4A 2F74B 4KJWC 4XSMA 2YBTA 3OR7B 3HAEA 3B9KD 2EKSA 4AXNA 1V8HA 1UA6H 1WXJA 4OIIH 3HV9A 1JGUL 1ZA6B 3HCVB 4KY1L 5TH2B 3B8YA 3BZ4A 1ZGDA 4R88A 3U4BL 3V9CA 3C8HA 4PVBA 3OX8A 5JW4Q 3MWAA 3S96B 3DHPA 1U95A 5MI0C 4MHBA 3KPRB 3GIPA 4KK9C 3ALXA 4P2OA 3L5XH 2JKRM 2R59A 4MQTB 2PMZA 2ZRXA 2EO9A 4GQ9L 1H6TA 5IJVB 4Y9PA 2A73B 1MHPH 4ZMTA 4IQEA 5CU5A 3LLXA 1SGKA 3ARDA 5BZWB 4OZFA 3H24A 5F1VA 4XCEB 3UY8A 1I2NA 2FZ9A 4XWGL 3PWUA 3FCGA 1QD0A 2XZ9A 2QQKL 4UIOA 1DP0A 2KZBA 3L81A 3AY4C 2YD5A 1TTCA 3OZYA 2XN9A 4Q6IA 3UTQA 1GW6A 4XAWH 2BASA 2HQAA 2H45A 5E8NB 1DL7L 5MERB 1FHDA 3GHEH 4HT3A 3GU2A 3D85D 1QLFB 3SGDH 3JTTB 3J27A 5SWZE 1TR1A 5I76A 4YQXL 1PFCA 3D7PA 3QDMA 2DQTL 1UQSB 4PGZA 3MV9B 1CLKA 1QWNA 4G6CA 5ICYB 4I9MA 1TFPA 2Q9OA 4MHHI 1MY5A 3BESR 1W72L 3ZIYA 1T5AA 1RXLA 1JN6A 2EC8A 3NVDA 2L3BA 3GM8A 3TEUA 5C0RH 1VLIA 5GZND 2CXKA 1YEKH 5F8RC 4RESB 4S3BA 3DV6B 3ZS4A 2YQ2A 3APNA 3VXSB 2QFRA 5AAWC 1L4IA 1NGXB 3F01A 1W1ZA 5HPMB 4Q22A 4PVNA 3L9YA 1OF2B 4B96A 5EMLA 5KYYA 4MWAD 3TBTA 5FKYA 4TVPH 4YL4A 5C0AA 5ERWB 4F2MB 4JDZB 5DY2A 2BGNE 3VKKA 5I6OA 2ZCZA 1SHWA 2QJHA 5CWSB 1NBVL 3KYOA 3JWDH 1XFBA 4PJBE 3VD2A 2EYRA 2JF1A 3BAXA 3DBPA 1K9TA 3S37L 1BCIA 5LZLA 4KT2A 1ZBKA 2I9EA 2D24A 3F8UB 3D5HA 1QRQA 3FHEA 4XN4A 5I8KH 5BOEA 1G9MH 3KCWA 2Y1HA 2NTFA 2IJ0C 3EFOA 1OGAA 5HGGS 4JR9H 3SSGA 5HHVH 2HLFC 3NAAH 4D9RD 1ACCA 2QMKA 4AJYV 2KUTA 3G5EA 2R2BB 1P9MC 4W9LC 3G1RA 5CGTA 1E67A 3BURA 5AW3B 1CVSC 2WXKA 1UVQB 2F8XC 3PUGA 2PB1A 1A7NH 5CPQA 1QK2A 2I7GA 1CD9B 1H9DA 1FO0B 3FF7A 4G9DB 2WXPA 2ZOWA 3R4RA 4HJTA 2EDRA 3H21A 3O3DB 4ZG1A 4E68A 1MFCL 3VW3H 4W9HC 3UCQA 1ZVNA 5KZEA 4R7VA 3WKPA 3NRFA 4Q97A 1VRSA 3F7JA 3ULVE 3JT2A 2I9UA 2PGRA 3CK0H 3QC6X 5AVRB 1TV8A 1TVNA 2DQMA 4YJZL 1JAKA 3MI6A 3UZQA 2AL2A 1OY3B 4UOW1 3DX3A 1BVKA 5D02A 3F7VB 3QXVA 3CN4A 1KELH 2AQSA 1UATA 3OJDB 4LB8A 4LUTB 2PGWA 4M1CC 4DM2A 3G5VB 4GIPD 5SX5H 4MX7B 1U3NA 1KCSH 3IVTA 5CSZB 1CD1B 1H1NA 3EHBC 2B59B 3WIIL 1HVXA 3ZZ1A 2QADC 3X12B 4XMPH 5BO1L 4FFYA 3VYLA 4FKKA 3EOTH 1QNVA 1E56A 4IKJA 1TVBA 3KPTA 2Z7YA 1W1YA 2ZUQB 3APDA 3MROB 4FTDA 2PCPA 3UWZA 4ZPVA 4HNVA 4Q6YA 3NCCB 3W0KA 4EWJA 3U4EB 3CDCA 4N2MA 4WWOA 1T8XA 3ABSA 1NCGA 2K6YA 1LQ0A 4XB8A 3UTZB 4MMYB 3BAIA 4LWWA 2WVSA 3GXNA 4JG0H 3DPBA 1IAKA 3QDGA 2VLRE 4FXGA 1G4SA 3H4GA 3O3AB 1DSFH 3U36B 1YEJL 5DEGB 4E9VA 3MU7A 4PODA 4LNYA 3H7RA 3H7LA 1QA9B 1QOQA 2IXQB 3V52H 4ZD3H 3TK7A 2ZPKH 1QHOA 4RE0A 3IGLA 4ZFCA 2HN7B 2IMMA 3O8XC 5DRNA 4BFGA 3FSWA 1MWAA 4XO3A 3RVWD 5I1EL 2DW6A 4XTDA 2XQYG 1UJQA 1YLVA 3IFLH 1T3FB 4Z2JA 2ZP0T 2RACA 3ILPB 2QDDA 4TU1A 1ND0B 2FSDA 2Q3AA 3QNXA 5INCB 3SDCA 3GO2A 3QWQB 3PL6B 4FQXD 3EWDA 1TTIA 1KIQA 1OIMA 2GK2A 4AT6B 5BOJA 4CGTA 4LNCA 5HJYA 4YAQA 4YWIA 1TMCB 4OLZL 4I2XB 2VLKD 3KNBA 3EMQA 4JE4B 1BWKA 1DLFL 5HATA 5GGTA 4P7LA 2QJMA 3UH8A 2RFXA 2VMCA 4OGZA 5ISZE 3TVMA 3HV8A 3S5NA 1OCJA 1NMCB 2XG9A 4UTAH 3MRHA 1J0KA 1N7MH 4LOEA 3FU7B 3MJ8B 2NY0B 2VMFA 1AYRA 5JU6A 3QRGL 2EABA 1P6WA 2G37A 1JGEB 4ICWA 3WTYA 1FH2A 1PZ2A 1P7KA 2PZNA 3GM0A 3QXAB 3WN5C 4B2DD 4Z3JA 1JZEA 2EE0A 3AZUA 1W1PA 4PR5A 4DBWA 3QFDB 1HWGB 1MN4A 4L4TA 4IKLA 1W8EA 1LM8V 1X5XA 2NXZB 3LBCA 4V2XA 1XX9C 1IEQA 2DQEL 3CJPA 3MA7B 2CA4A 5JPMA 1SXAA 3EYUH 4U1HB 4KZDL 4B50A 5EN2B 4AHOA 3ZKND 1MCFA 4ZFOB 2Q6WB 3LX9A 2AEPL 4OCRL 1E72M 3TV3H 2JQAA 4AEFA 3TM6A 4JW3A 3LG3A 4Y8DC 5A7BA 4X2PA 1AXSA 4K8RD 4L1HA 1KGCD 4JFZH 4KNQA 2YXMA 1WIUA 3H23A 5HGDA 5CILH 1W8SA 2CLRA 4R7NB 1HOCB 3I6LE 1A6TA 5EMKA 4P2RD 2YKLL 3KYNA 3ES8A 2GSMB 3T1GA 1VADB 4KF1A 3UESA 5EBLA 3HN8A 4WHTB 5HJLA 5GS2D 2Z4QA 2XN1A 3RITA 4QCIA 1H51A 1SDYA 4GYFA 3D39E 3A6CL 3SIKA 3WLKX 3SN4A 3RA7L 2A85A 4HDIB 4TX8A 3UZVB 5L0QB 4JPKL 4A3YA 5JOFB 3G1VA 1ESOA 1S3RA 2JKIS 4WQOA 3L13A 4NQCA 2PPCA 1E5AA 4GFTB 1O7SA 4KUCF 1RUKH 3L16A 5FO2A 3BKJL 5F6IB 1OP3K 2F6UA 4LPXA 1ZSHA 2HRWA 1SLVA 1NEUA 3WQ6A 2O5ZL 4GK8A 3AYRA 5TE6H 3JVGC 1NWRA 4X61A 2JI2A 4Y1TA 3LQMA 2HTLD 2IQDA 4PRWA 3TYBA 4AF0B 4G1EA 4N26A 3U2SA 2ITEA 4Y16D 4DN1A 2DZBA 4B60A 4C90A 3O7UA 1CFNA 2ESVD 1HHHB 3DPDA 3W9DA 5KVGH 4W9FC 2ILLA 3HBGA 3ALGA 2BIMA 5DGRA 2OLHA 5CJOL 4F1SA 2DM7A 3E0FA 1JV2A 5I6PA 4FL4C 2RDWA 4L29A 3S6DA 1XQKA 1QFUL 5FJOA 3LN5B 3BWUC 4OLYL 3WX7A 2D0HA 2N7SA 4P59H 3DJTA 5IVXB 1NFDE 3CB3A 2ADJA 4GT7A 4A7TA 4GZJA 3CVHB 2CGZA 3GZOA 4Y9MA 7ENLA 4LVOC 1BDYA 2HROA 4Q4IA 4GLRH 1YBQA 2B7PA 3RWCB 5IHLB 6REQA 3B8TA 1NGWA 3OXRA 3IVKA 4E9SA 1JWMA 2AGTA 3PWAA 3OHMB 5H8UA 1GJUA 1QAPA 4X4MA 5IVXF 1DHKA 2J72A 4XPBH 2WVVA 5I5IA 4FQHB 1X9QA 3VD4A 3A0OA 1JCTA 3SY5A 4L4VA 4WHDA 3HZYA 2P49B 2JH2A 3U0TB 1O5XA 3FK3A 3VZXA 2Z4TA 4Y5XA 4L3EB 2WBJD 1L9NA 4QTHB 3F7YB 4JKPH 3BUDA 4JHMA 3R6IA 3E9TA 3T8XA 4M03A 5T1KB 3VIHA 5GNXA 2EXWC 2WMPA 3W1PA 2XIMA 2W5PA 3FQRA 5FGBC 4A8NA 4FNSA 4AIZA 2YS4A 4LAZA 1U3HA 3I4KA 4G6MH 1F58H 2PS2A 4G8GB 1BF8A 4FERA 1Z1WA 1CFQA 4W1TA 2OEJA 3R13A 1XZ0A 2IWGA 2YCJA 3VXOA 4HCRH 5FR3A 4NNXB 5E9DA 3B8SA 3NDZA 3EFFA 3FCSB 2EXSA 1E6QM 5IT2L 1ONRA 1HKJA 1NANH 4NKMA 1CXEA 5C07E 3RWJB 3MUY1 4R7LA 4FX6M 3MOBH 3WH9A 4NN6B 1F7BA 3EYFB 4RLDA 1KR0A 4EMZA 2EACA 2HK1A 4LNRA 5LCVA 5K9XA 5LGHL 4PRPD 5DJAA 3R8RA 1BIIB 5FHBL 2CBPA 3CV2A 3K4DA 2C79A 5CO1A 3GMPB 2ED6A 2ZG3A 4ZO7A 3SGDI 4ODXB 2EF9A 4XWUA 3DFSA 3OGOE 1I8JA 4ZPTB 4YMPA 2Y36H 1XG4A 1EX0A 5SWUA 5K9DA 2YFNA 3VVVA 1FGNL 1R3JA 2R1NA 4KIEA 1JDCA 1MW3A 4LGPB 4CNIA 3T2PA 5C0NC 4ZMYA 2DH3A 3NIFE 4XODA 3NSJA 5HTSA 3MGOA 1TJHH 4GACA 2VZOA 3GB7B 4XZ9A 1MRFH 5I1GL 2IPUK 4A2LA 1MEIA 5EIIG 5K1JA 4WJEA 1DQDH 4E9QA 1KBKA 5F97E 1DJNA 1REQB 4M61A 3MCNA 5FF0A 3IMBA 4JFUA 1UWGL 3KGRA 2DSWA 1T4KB 5FV1L 1ZEAL 1Q7QA 1O12A 3IV8A 2GJXB 4AYEC 1OM3H 4QEEA 4JQIA 4RA3A 5KZ6A 2E76C 4JY6B 2HX9A 3P4MA 3C75A 3W7EA 2CO1A 3FT4A 3QQ4B 4XZNX 3I50L 4CADB 1UOKA 1BSIA 1TZIB 1NJ9B 3CUPB 4ATLA 3FB7B 3PS6A 3QDJE 4BUHA 2YXOA 2CUIA 5L2KB 2W8CA 4XVOA 1JK9A 4W87A 3NCXA 4I3GA 4CCEA 5H94A 2H0JA 3ISYA 2G5BA 2VDPB 4YSTA 2BVTA 3LRSA 4CC0A 4JREC 4JM4H 1DBKH 3Q01A 3C09B 2HJPA 2COQA 4LGXA 4ZE5A 4EAMA 1WGOA 3EB4A 4OZ4B 3H9HB 1EZVY 4LEBA 4OZHE 2NTSP 2QQ6A 3HJ0A 3PBYA 5AHIA 1FORH 4GJIA 3A67H 1G4PA 3ZR6A 3NSFA 1G0YR 5L88L 5F88A 3D51A 2E3VA 1Z3RA 5IWLA 4KY2A 3ILEA 5FF4A 1G7HA 1ZLVH 3CFJA 4JFFD 2AGJL 1XGQA 3BE1H 2WVTA 1G7QA 4R3SA 2NQZA 2GHWB 2VXQA 1S9XB 1TTUA 1F3RB 3RRQA 2D3JA 5I17B 4DVOA 2LU4A 3UO8B 4KIRA 1IX2A 3WD5L 4L5FL 4DHGA 3RY6A 3TYDA 4NHVA 4G2DA 1BMZA 3PPCA 3RPMA 5EA9A 2INZA 4XKMA 4CNUA 5T33L 1R6VA 3Q67A 1IEBA 5L4IA 5EN3A 4DWDA 1T99A 2P1FA 2CERA 3QO1A 1K85A 1KB5B 2ZRUA 1MSSA 4IQDA 2RGMA 5JTWA 1TXKA 4GOAA 3UYRL 2OB3A 5D7KE 2R0WL 3REQB 2MWCA 2GUOB 1SO4A 5I1CL 4NOFA 1UD3A 4QHMB 1QW7A 2XYLA 4NBZB 4K7YA 3MYPA 1KTBA 3PLYA 3K1DA 3QO0B 3V1HA 2QCHA 4UNVA 1QDSA 5AOJA 4XMXA 1J96A 2N59A 1W31A 2PDCA 5LHDA 4S3EA 4RW5A 4LZKA 1JPST 3I6EA 3IARA 4XUYA 4LL4A 3JZ7A 5D1QB 5TQ2L 2HUHA 3HLAA 3N40F 3GMNA 1N0XL 4F92B 1E2WA 4NI6A 2J4WL 1H3PH 5EU9A 4IIHA 3RPKA 3O6FD 2H3BA 4ZNEA 1TA3A 2P0IA 5AAPA 4U3AA 2QNEA 4QRAA 4B9CA 2X05A 2A38A 4C8XA 2ZX5A 3TW7A 4XXDA 4HK7A 1TJIL 1O5QA 4C6MA 3AU6A 1JZ2A 5F2IA 2CG9X 3SE6A 2XNAB 5H37G 1I1RA 3E2HB 4LFHD 2ZT9C 1IEIA 4KJQC 4WNQB 1BXBA 5KSWA 3HE6B 3TASA 4O8AA 3RUGA 2OMXA 3GXUB 3KMDA 4JDYA 1BZ7B 4XO8A 4QDMA 4IUGA 4Z08A 1NCAH 4S23A 5AKQA 4GRWB 1KLFA 3UTTE 4MLSA 3DX8A 5L6YH 2DZTA 3VH8G 1PIGA 1CXIA 4FB7A 1NWTA 3VFNB 3HZVB 1D9EA 3LJ3A 1E4XI 1AO7B 4LKXB 3MXWL 2RUSA 2OXGA 1U8QB 3WLJA 3MBED 3U7AA 1F3JB 2B15A 3ZN6A 5G4MA 4KTYA 2BM3A 5KVDL 3I2CH 3PTKA 4GRWF 4WU5B 3M1BA 4IRJD 3G5XA 2Y1ZA 4G7QB 3VK5A 4NZFA 3WY4A 1CE1L 1ZHNB 4YO0A 5T9CE 4ZFGL 4PM1A 2CIKB 3G24A 3LMZA 3Q6FB 2EUVA 4TSAL 2ZX8A 1KBGH 5IQ9B 1NMAH 4HWBA 3P62A 1WXYA 1IAII 1UZ6F 3T0TA 4O4WA 4WFFE 2PDLA 3D0VB 4PJ5E 3B2MA 2YL8A 4GUPB 1NGPL 4IIQA 4JX0A 3G1SA 4OLXL 4U6VH 3LZFL 3MRGB 1DDHB 3RRXA 4YS4A 5IQLA 1I1FB 4NOBA 4FF5A 3X3FH 4RBPH 4ROQA 3GVQA 5DRZA 4BZ2L 3EJCA 4YSSA 1SF3A 3FV9A 4F80A 3MFFB 1ML1A 5IHZA 8FABB 1RL1A 1IQWH 1U8OA 4E36A 2XWCA 4ZMGA 2FQGA 3QH3A 2BNQE 1J0IA 3G6JB 4MA3A 2EUWA 4FR6A 1Q65A 3ME0B 3PP3K 3EO0A 3IUDA 3VFPB 2VH5L 1EFXB 4CMMA 3JV4B 2E75C 1E2ZA 2HJLB 2V0TA 2ICES 4HF5H 2OW7A 3LH8A 4ZBCA 2MQ3A 1GH7A 1AW5A 3L4TA 3DLQR 1TLKA 4JL1A 3G6JF 3IJHB 2W07A 1NL0L 2A6KA 1GYLA 5CJBA 5EGRA 3WLNA 2X1PA 3BKCL 2YRBA 4PLJD 4PYSA 2H32B 4JKLA 1LDPL 2Z92A 2RDUA 5D09A 1FJ1A 3GSQB 4OD1L 5IVNA 5F7LB 3CZFA 3AS0A 4NCDA 1XLAA 2ED9A 3QEGH 3PHSA 3CHOA 4OF5A 4E3VA 1HJXA 1FNSH 1OAZL 3RTLA 3L45A 1RLBA 4LUSA 8CGTA 2NZ1A 1BAFL 4OLWH 2IG2H 1JGVH 2WQ8A 5F7NC 1YTEA 3MJ7A 4XI5C 1HGYA 4ORIA 4OCSH 4TULL 5ANME 1QFHA 2WYZA 4AD2A 3N9GL 2OCZA 1MCRA 1WT5A 3G3LA 5MP6H 4AU0A 1FWEC 4MNQB 1IILE 4OVUA 3P82A 2Q01A 4AXWB 1V8EA 2ZWNA 2SEBA 4UQDA 4I0PB 4XP5L 3Q6GH 5GRZA 5IHUH 3H22A 3UDWC 5DR5L 2ZZ5A 5GS1A 3ZYIA 4EI6B 3TEZA 4KWSA 4WFEE 1FH5L 5A3HA 3IETB 5EMYA 2J57A 2TSBA 4JQ4A 1CT5A 4EIUA 2DB8A 4LSTH 1JGLH 1JXDA 1L3NA 4KV5F 4XVEA 1IUZA 4UOQA 1FL3A 3VFSA 3TAOA 5E8EA 5B1JA 4I5BA 2X4NA 2GTZB 5C07A 3L6FB 5EIIB 1DQMH 1B0GB 3GJEB 4AIUA 3H55A 3EYSH 3PF2A 1ROCA 4HA4A 1XL4A 4HIBA 2HKHH 1YNTA 1Y7VA 3QWRD 5JNYB 3RQ3A 3EOLA 3APGA 5TBOA 4L37A 3ZTNL 4G83A 4UQAA 3T3PE 5G5DB 1A9BA 5K69A 3DX0A 3VZZA 1EHLH 5CEXB 2XA3A 4OH2A 4DGIL 3SR7A 3ETTA 2NW3B 4FQJH 1WAAF 2ZTJA 4Q8PA 3EBHA 4I7VA 5EC1A 3RWHB 4HEME 2FWLB 4CQDA 4A67A 3W11D 3LHTA 3IDMA 4PYGA 5JHLL 5E6IC 3C2OA 2PDIA 3FY1A 3ULSB 3GSNA 5TDNB 2AV1A 2R8WA 3RWGA 1J9CT 2C4XA 1YHPA 5E4EB 4AKQA 3PWPB 5JBEA 2ZONA 5HJGA 3BD5A 3SCMB 1KG0B 5HYIA 4XBEH 4M7ZC 3FJ6A 3ZMEA 3B0YA 5IEKB 4MD5B 2MEJB 5K9QI 4KY1H 3L4VA 3P0XA 3JZYA 3EF4A 3U4BH 1BMWA 5KS9A 1TPVA 3P1VA 2FECI 1ZTXE 3B0UX 2OL3B 3B9KC 3P69A 3M8OH 4NHUA 4XAPA 5CBBA 3Q94A 5C9XA 1YNQA 5C0GB 1F8TL 3VI4B 2XN9E 4PMDA 5D9PA 1FNGB 1IQ8A 5JOPE 2NX1A 1VFFA 3LIZL 2IDFA 1GQIA 3RWFA 5J7CC 1TIWA 4HIIA 3NP4A 1FVEA 5F6HJ 5FYKU 1TJ1A 3GUTB 1XF1A 2BSRB 3LNGA 4LU5L 4JPIA 1TQBB 4REQB 3A6BL 3QDME 3QDJA 1HIZA 3KPPB 4O2CA 1E6RA 3IJEA 2HKFL 2OR9H 2FVKA 4QDGA 4MA1B 1Z7JA 3QDAA 2EXTA 1V3HA 2V63A 3VI4F 2KERA 2BOBA 1NY1A 1H7PA 1PO9A 1R6WA 4LSVL 1MCOH 3AAZB 3T42A 2OSLB 1QW8A 4Y5YA 1LOSA 1TPDA 1N6VA 2WV8A 3CNKA 2FFIA 3UZ5A 4AVNA 2CLHA 1PG7W 1JPSH 4JHAL 4JQVA 2YUVA 3GBML 4D6GA 4IKNA 5C0AE 1B6UA 1GKOA 2KX9A 2DQTH 3MLYH 1A64A 1M2OA 1A0DA 3RP1A 4AC2A 1XLLA 1KIPB 4YOKA 3LN3A 5IHBA 2YQGA 3OKEA 1BLNA 2UY7A 3LPWA 2ZAHA 4Z7VB 4NCC2 4TKWA 1D5BA 1P7QA 2NOYA 1HE7A 4JY5H 1W72H 4NAEB 4LK4A 4NO2A 3ZSSA 1SN0A 1X8FA 5I26A 3ZE1E 1IO4C 4XAZA 3O9WA 1SUJA 2YN5A 1HHIA 2HBXA 1OGAE 4ZB0A 3TFXA 1IM9B 5BXFA 5LBGA 3CQHA 5F7MC 3WK3A 1ZAHA 3MMEB 4P23D 1W1A1 1OCBA 4LCWA 3LKPA 4Z7VF 1HIMH 3W22A 4CBPA 3NPVA 3PRZA 5GZNC 5EU6D 5IMKA 2ADAA 2ZCLL 2LLEA 2OLSA 2OCJA 5A16B 1NBVH 5G2NA 1TIUA 2JTDA 3IV3A 2AV7B 3WEBA 4N0FB 3S37H 4MWAC 2MCPH 1NM9A 1BXNA 4ZDHB 4ADGA 3V0SA 5KSBA 5EU5A 2IOMA 2BDQA 1AGCA 2ARJA 1H0DA 1E6XM 4YHZL 3B2PA 2Y07L 4UUJB 1UHVA 3F05A 2XXFA 1HHJA 3F1QA 2NY1D 6PAZA 4C6CA 2Z8SA 2VIRA 1WHOA 5FF6B 3IMRA 4MDRA 4BFFA 3ZUNC 3S35X 4LSSL 3D18A 2CK0H 1E6ZA 3GTXA 3HHSB 2YOAA 5EUOA 1UURA 3UAAA 3AHYA 1I7TA 4XBJA 4AQLA 3GRWA 4O54A 2YN3A 2BOLA 2PDYA 3O3EB 3MNVA 1ONQB 4PB5A 3DBNA 3MQIA 5C8JA 2HRLA 4LNVA 2DQGL 2VGIA 2NPLX 3WDPP 4HEPG 3QZEA 5JHDA 2A3LA 4I4WB 5KBPA 3I85A 5B8CB 1V3IA 5EZPA 3EOBA 3D33A 3N2JA 4ZZFA 1FX6A 3QI9B 2BVOB 2J13A 3O05A 1GYCA 4GXUM 4ELDA 3VXUA 3WIAA 3EYOB 3FB8B 1U8PA 5TF1L 2HBVA 2FKPA 3AI0A 4F0SA 3SJVE 4L61A 2GY5A 3WIIH 3PDOB 2EDEA 3VC5A 3QDGE 2XDHA 3BE7A 2HVBA 4PGLA 3ASWA 3JV5A 1I1YA 4ZFZB 3MHGA 5DK2A 3W2NA 2IANB 1W5QA 3LMYA 1UXWB 3NZ1A 1XH0A 1QX1A 2P76A 2F68X 4XPAL 5IMMB 3U6RA 2FWOA 1THAA 4OV9A 4HS8L 4L9LB 5CSYA 1HN1A 4PA8A 4FFZA 3Q5TA 1J1XH 3QYQA 1SXSA 2Z1KA 5GZOD 3H3BC 3NFPB 1L6WA 3P77B 2QTEA 2R39A 2GEQA 5HANA 1E7VA 3CH1A 1TVHA 1H15A 1JUFB 3ZR4A 4C6KA 4PRNB 4FG2A 5DC0A 2CCVA 3W87A 5ADOH 2X1XR 4M81A 4KI5D 2Q0ZX 1K4CA 4FK9A 1YEJH 4LEQA 2ALDA 3W6YA 4TNEA 4YH6A 2CHRA 2R91A 1LL6A 4PWHA 3R0DA 4PRRA 4IGSA 3E1ZA 1NBYB 3U2CA 5ESAB 3BVJA 4JZJB 1R24A 4RQQB 3H3PH 4JPVL 2X0WA 2JJSA 2G2RB 1A4LA 1ZJBA 4AI7A 4Q4OA 5FYJD 3KVDD 1VBUA 3MU3A 4MB4A 4H9TA 3RVWC 1QEWB 3SE8L 5I8OL 2VKWA 2HSAA 3PXLA 4FLRA 3S0PA 2ICWA 1FN4B 3RBSA 4OLZH 1WAWA 1U3ZA 4L4TE 4NNPH 2C9VA 4CU6A 4FQXC 2HTMA 1GYMA 1DLFH 2OOFA 3W2DL 2YA0A 4HG4J 2J9YA 1HCFX 3IDNA 3SN0A 2F2KA 5I0VA 1M7UA 3OJMB 4EPKA 4IK7A 2DYRB 2CKSA 5I1LA 1W6LA 3D87B 5FYLE 2XV0A 5JH2A 3GLZA 4FDWA 3CHEA 1YAIA 1BZ9A 4TUJA 2O6CA 3RO6A 1A14H 5KBLA 1X6UA 2X6BA 1QSED 4OCLC 4DO7A 1TEFA 3E5BA 2EE2A 5CD5D 3NQVA 5BUPA 2PCYA 2GAZB 5T8GA 2RCSH 2L04A 2BW4A 4RZ6A 4RWYL 2DQEH 3IMVA 5ANMA 1ML0A 3AXXA 4XG1A 4KZDH 4W9KC 4M6PA 3WFHA 2GBTA 1I7UB 3TN3A 2AEPH 3VXTB 4HYTB 3WK1A 5GRVL 1HQTA 5A94A 3FRUB 4NZTL 5J5EA 1HILA 1J8HB 5LNUA 2HK0A 2FDSA 4K7FB 2J71A 1TUXA 3US9A 1E6OL 7ODCA 3ZKNC 4XTIA 2XWRA 4AEHL 3OPSA 1SHMA 3SQBA 1L7IH 3GJFH 4HUUB 3MDWA 4K8RC 5D7HA 3SQSA 2I5IA 3OSKA 4AQ1A 3TFKD 4UMSA 1KCRH 4M1RA 3GD1C 3ATEA 4FX5A 1Q38A 3A6CH 3RA7H 2B4CC 4QTFA 1YYCA 3F5JA 3CSFA 5TQ0H 1AR1B 1BX2B 4JPKH 5FO9A 5E5UB 2LFEA 4FXFA 2DAVA 1TSHA 4G6JL 1HSBB 2UY6A 5DRXA 3O3RA 5GRJL 4F9LA 1UWUA 4FNPA 5EO1B 4JIEA 5DXWA 4X7TB 2O5ZH 3SOTA 1MHCA 4NX0A 3EPMA 2ZUWA 2X53A 6XIAA 3OKOA 5FFGA 5J6GB 5IG7B 3W1MA 1O9ZA 1E27A 2EJ1A 1SXNA 5AFDA 3FTVA 3TLLA 1G6CA 2BMKB 5D2WA 2IADA 4DQOH 1QQDB 3PGFH 4LCYA 3MLTB 4HEMA 3TO4B 2MHAB 2PABA 2HTLC 1XF3A 3WNKA 4G9FB 4Z0XB 4X4ME 4DLMA 1J86A 1NDTA 2NQ5A 4FAMA 2AQOA 4XCYA 4Y16C 1KB9K 1KJMA 4P2VA 4D8PA 8XIAA 3L5IA 4L4VE 3S36L 4JN1L 2MNJB 4H2CA 3CFUA 4OLYH 4PJAA 3ZZQA 5C54A 3CL6A 4HMDA 3GYCA 3QYSA 3WQEA 3CFEA 4UAHA 1K6AA 4HLZH 2A7RA 3C56A 3VVGA 3BIBX 3Q9QA 3NJHA 3MNZB 3I4EA 5IVZB 5E2TH 3EYQD 3WLWD 3ZDZB 5FYJL 3N9KA 4LVAA 4MZ1A 4ZENA 4DH2A 1DXIA 4JZOA 2XKSA 2WXQA 3V0HA 1F42A 1OCOB 5AFAA 3FYIB 4IG2B 3CFCL 3CMOL 3P0YH 5E9DE 4JM2A 5JIDA 9CGTA 3NDZE 4KMLB 3ZTJH 1UACH 4M3KB 3QA3A 1ZGLB 3OM3B 4TOYL 3UPCA 3ZDZF 4ZXBA 2PP9A 1YMME 1HX0A 1MPAH 2GWGA 3GIVA 1T03L 5KYWB 5DANA 5D30A 1R5WA 3L5MA 3VNLA 3TBWB 4WO0A 4OFIA 1J8VA 3CDFA 4O02H 3BEVB 4XP4H 5EF1A 4TXEA 4DPRA 2D2GA 1WFUA 2KAUC 1LF1A 1MHEB 2CO4A 4GRLD 4N9CA 4PMYA 3JYCA 2WXMA 3H54A 4PGEA 3M0ZA 2WUCL 4K7PX 4UQ3B 5BRPA 2X6CA 2GSGB 2V2DA 2PLMA 1R5IA 2VLLB 1MCJA 3SDAA 1RZJC 3FB5B 3GRGA 2OMVA 1HL8A 3VXRB 5KTEH 4MD4A