1SZNA

The structure of alpha-galactosidase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
417
structure length
417
Chain Sequence
b'IVMPDGVTGKVPSLGWNSWNAYHCDIDESKFLSAAELIVSSGLLDAGYNYVNIDDCWSMKDGRVDGHIAPNATRFPDGIDGLAKKVHALGLKLGIYSTAGTATCAGYPASLGYEDVDAADFADWGVDYLKYDNCNVPSDWQDEYVACNPDFVKTGPNGTCTTALDPTLAPPGYDWSTSKSAERFGAMRNALAKQSHEIVLSMCIWGQADVFSWGNSTGISWRMSDDISPNWGSVTRILNLNSFKLNSVDFWGHNDADMLEVGNGNLTAAETRTHFALWAAMKSPLLIGTDLAQLSQNNINLLKNKHLLAFNQDSVYGQPATPYKWGINPDWTFNVTYPAEFWAGPSSKGHLVLMVNTLDITATKEAKWNEIPGLSAGHYEVRDVWSDKDLGCLSSYKAAVAAHDTAVILVGKKCQRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-galactosidase
publication title Crystal structure of alpha-galactosidase from Trichoderma reesei and its complex with galactose: implications for catalytic mechanism.
pubmed doi rcsb
molecule tags Hydrolase
total genus 139
structure length 417
sequence length 417
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2004-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17801 Melibiase_C Alpha galactosidase C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1sznA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1sznA01
1KWKA 4U31A 3K30A 1T96A 4JXCA 1I2QA 1ICPA 4MJMA 3W1UA 1G6CA 3AXHA 4WSKA 3WDJA 1OG0A 1Q6LA 4J3VA 3DZ1A 4NX5A 3C52A 4WOQA 4WY0B 1NF0A 2ATMA 1TQWA 2VUYA 3QQ0A 5LNUA 5DN1A 2YGYA 3EXTA 3UYCA 3WDHA 3GVGA 2QR6A 2YW4A 3PBWA 5K7JA 5HUOA 4MOZA 3EJPA 2FJKA 4Q33A 1QDSA 1TREA 4TIMA 2W6RA 4Y96A 4UFHA 1SU5A 2P0OA 4N2YA 5U7SA 1KBJA 2ZZ4A 3STFA 2DZWA 4FLRA 3V75A 1IGSA 3IGUA 2YDAA 1M7PA 3WMSA 4KMQA 2X2HA 3LHTA 2C15A 3HG3A 4HHPA 2EABA 3CEUA 5F1UA 3RK8A 3DFSA 3SFKA 4Y9AA 2ZRZA 2O7QA 1YPIA 3FFSA 2Q8ZA 4UQCA 3ABOA 2FB2A 3L4TA 1IIGA 2QJGA 2QCHA 4OV9A 3S1XA 4MFDA 3WNOA 3R5EA 3GLCA 3LRKA 1YTKA 3BARA 3N14A 3GXMA 1VHCA 4AAJA 3USBA 2X2IA 3P60A 3TCEA 1CGXA 1X1ZA 4POCA 2GVGA 3VE7A 3G22A 2J9XA 3DFPA 3LCLA 3NYZA 4XKYA 1KXTA 3O16A 4EOUA 3S9YA 3JR2A 2E4TA 4PCSA 3G8EA 1YYAA 5F7UA 1SSGA 3L0KA 2Y24A 4XKYB 2OYKA 1ME8A 1ZENA 1EUAA 2PRHA 3C8FA 4LWWA 5FEXA 3THAA 1R34A 1VFUA 2ZQ0A 4LQ1A 2NUWA 4O53A 1M7XA 3BAKA 4FNUA 2E5CA 1Q45A 1TMQA 1SO4A 3DH7A 3O6YX 4HPJA 3KVLA 3ECQA 3IIXA 3IJ8A 3I7RA 2QAFA 1H7XA 5LNWA 2HTMA 2EEXA 3LRMA 5I3FA 5HR7A 3EX2A 5E70A 4LV4A 2YX0A 1TTQA 2E6FA 3IGSA 1PPIA 1TPWA 2Z1KA 4UFMA 1JR1A 3TJLA 5HXMA 5AFDA 2A7NA 1J0IA 2DH2A 3KOFA 1KBIA 4LC6A 1SZEA 1CXEA 3W7QA 4FLQA 4AMWA 1HL2A 4MB1A 4O12A 5AHEA 3TU9A 3LB0A 4R7JA 1L0PA 4LXFA 5D30A 3STCA 1GPWA 3QPYA 5TIMA 1XSIA 1CGWA 3BH4A 4X0NA 1UKSA 3K8KA 5CG7A 3SY5A 1CI1A 4UIOA 2V3FA 3BAWA 2J25A 1I75A 2QLYA 3W7JA 3UQNA 4WSJA 1XSJA 1W56A 2PWGA 3KFTA 1UA7A 3WNLA 1X8FA 5ABTA 2VENA 3LHUA 4N9BA 4O16A 4NNBA 4AHOA 1JCLA 3K1DA 1G4SA 1IXNA 3G1SA 3N3MA 4K38A 1S46A 1UUOA 2QUTA 2ZA3A 2ZUUA 4O4WA 5H91A 4A3UA 2I1OA 3CGTA 3TW6A 5CLTA 2NX1A 3L5LA 3LTYA 3NZRA 4MLRA 4DPQA 1QO5A 3S1WA 1VZWA 3DHDA 4O54A 2ZRWA 3TE9A 3U8GA 2YSWA 1ICSA 2A2IA 3W07A 1WQ5A 4NVTA 2YPIA 5LKYA 3OVQA 1XBYA 4ZQMA 3WDIA 1SSDA 2Y5EA 2YYUA 3BVWA 1THFD 1KTCA 1ONRA 3P80A 4UTTC 2IQTA 1H1ZA 3W3OA 1EWEA 3DHUA 1HFBA 3WENA 2Q3OA 4O17A 3GKFA 1VRDA 1IXQA 1L6WA 2BHZA 2ALDA 4NJIA 5KINA 1AW5A 1UKQA 3EDDA 2DH3A 4PEKA 1S5WA 2WVUA 2QF7A 3NQVA 4JY9A 2RKXA 4HT3A 1Q3NA 5EL1A 1N55A 4RCXA 2Y70A 2AMGA 8CGTA 3NVTA 2VOMA 1LZOA 3GAYA 1JULA 4AWUA 3MI3A 1F73A 1QMLA 3DKLA 2D0GA 1JF6A 2BHUA 4O28A 2DP3A 3G1DA 2E8YA 3DX4A 1QOQA 1OX4A 1XSKA 2Y7DA 1TRIA 1S5VA 4FXSA 1MVYA 1K8YA 1PAMA 4DO6A 1VYPX 4LVGA 2FIQA 1HTYA 3OEXA 5HUPA 3L4WA 3LRLA 1OX4B 2JK2A 2F1AA 3MWAA 4CQ9A 4CNOA 2B7OA 3BGJA 4IJBA 3GDTA 1FDZA 4UC5A 1OHLA 4FO4A 3VGBA 1VFMA 3ZSSA 2CLLA 3GNNA 3TNOA 3HGRA 1UOKA 4CCEA 1JDCA 2Y7FA 2HSAA 1JCNA 4ONVA 2QAPA 3EWUA 5EA9A 3TW7A 1QNVA 3TXZA 3BC9A 2QCDA 1OVDA 1YXYA 5A2BA 2ZZ5A 2OT1A 3QC3A 3C2VA 4MUZA 3FJLA 1EP1A 1H51A 5EKYA 1B9BA 3L21A 4KWWA 2QCDB 3BW4A 1ZJIA 2FGZA 2WPGA 3VNZA 3GXNA 3B4UA 3CEPA 3L2MA 1F05A 3NEVA 2PCQA 1PCKA 3B06A 3IK2A 3BVUA 4J3XA 1R2RA 3CIWA 1EH9A 2OT0A 3CC1A 2Z1BA 3W84A 5AC6A 4E2OA 3WFZA 3W70A 1CXFA 3FEMA 1OT2A 1LBLA 3C3NA 3TQVA 2YIHA 1EEPA 2NT1A 3CQ0A 1YTEA 1V3KA 4CNPA 3TR2A 1H3GA 1XUZA 3TFCA 5DXYA 4EF8A 3ZT5A 4UXDA 3VM7A 1EP2A 1UBSA 2Y85A 3PUDA 4M6VA 2VEMA 1Y0EA 3VMOA 4J3TA 2GQ9A 3EX4A 2DZUA 2QUVA 2XIBA 4J3WA 1I2PA 1VYRA 3PS7A 1CGVA 4UUIA 5LNRA 7CGTA 3PWAA 1UJPA 2ZRUA 4NQ1A 5F4WA 2ZTJA 3BO9A 4IQLA 1D3CA 1HG3A 2ZZ6A 4Z1AA 1QWUA 2Y4SA 2X2JA 3EDKA 1AW2A 1JRCA 3CZEA 2B0MA 3NQDA 1CW2A 3Q2DA 3T78A 6TIMA 1QI4A 1E3ZA 2H8XA 1GVSA 4JFUA 3STGA 1K3UA 3PF3A 1GT8A 2OSXA 1PHQA 4R33A 4JCLA 2J88A 3SGUA 4P61A 2ZIDA 3C6CA 4LY8A 3W7GA 2F84A 8TIMA 3VO0A 3SI9A 1N7KA 1FWRA 4FB7A 4YCOA 4X3ZA 3VX1A 2ATSA 1SO6A 3HPXA 3BGGA 4JX5A 3S1UA 3NOEA 3H54A 3WNMA 3QM3A 4FX6M 2PWFA 3UXDA 1SMAA 3M44A 3UZJA 4JS3A 4J9JA 3HPZA 4XB3A 3F1QA 3LI1A 1TO3A 3ZSTA 5A6LA 3CWNA 1KBKA 1WO2A 4AXKA 2G3MA 2OJPA 1V5XA 1R46A 2ZX9A 3FLUA 3IEBA 4XTIA 3GX9A 4XBSA 3N2XA 3WJXA 3I7QA 4H4IA 1H61A 3DFQA 1K7XA 1X7FA 4QAWA 2GOUA 2O7SA 1QI5A 4GXMA 1YADA 1KGXA 2Z6JA 3FYOA 1WDWA 1XH2A 2IGTA 5FF4A 1FCUA 4PH6A 3LXAA 1K8XA 1TRDA 3DDFA 4YLWA 3W75A 2G97A 3Q37A 1WOAA 2V8ZA 4N6FA 2AAMA 3CZNA 3DX1A 3NQFA 1UKTA 4AF0A 3HZ3A 4RZ5A 1G9HA 3YPIA 4B5NA 3P8IA 2JKAA 2A6LA 3VMPA 2V9DA 4HNVA 1MXGA 3W85A 1UA3A 5L9FA 4AF0B 3W1LA 3ZQ9A 3EB2A 5L6UA 1Z48A 4UTLA 3MHFA 3B0UX 1XDMA 1PIFA 4X9YA 3BLBA 1VLWA 3GR8A 2ZX8A 2EAWA 3LERA 2QV4A 3FIGA 5CGQA 3MO7A 1JRBA 2GJRA 1FBAA 2Y62A 1HX0A 4CVWA 1HNYA 5D2XA 2RDWA 3B0PA 5DLCA 2OZ0A 1RD5A 2V5BA 4WOZA 2V2HA 3W6YA 4GBUA 4BZYA 3T55A 1TQVA 5D33A 3KWXA 3PG9A 4XQ6A 3R13A 1BTMA 4JTLA 4U28A 3CLWA 1RP8A 3VGFA 1ZHAA 3NZ1A 5KZEA 3P74A 2X2GA 3QGVA 5F2IA 1L6SA 3PSWA 4GNJA 3STEA 3IVSA 3KX6A 4RZ4A 1ZAHA 1G4TA 3FS2A 4FEZA 3DFNA 3DU0A 1SO3A 4RLIA 3NPUA 3PB0A 3HJEA 3GKAA 1HT6A 1HO4A 3IJ9A 1OYCA 3IIVA 3QH2A 1WZAA 3E9AA 4O4VA 1TPEA 3SECA 2C6QA 1SFJA 5E93A 1OYAA 2RH9A 4QNEA 3BK0A 4AW7A 1OYBA 5CSSA 1W5MA 3ANYA 4PODA 4WLCA 1PE1A 4CGTA 4PL2A 5IBXA 2Y7GA 1RP9A 2VEIA 3FKKA 3O6CA 3PR2A 1A50A 2WNNA 3S6DA 6TAAA 2YKKA 2ZWYA 2NUXA 2RDUA 2HMCA 4OWGA 3W7MA 1GVIA 2X30A 1NOFA 1W54A 5HQEA 2F7RA 1J0KA 1CXHA 3EWWA 3NL3A 3WK1A 1KB3A 1PZ3A 4HPHA 4GC4A 4BF9A 3N34A 3QRHA 4QM1A 3W83A 2ZUSA 3TTYA 3C0JA 2J24A 5LNVA 2WSKA 4EIVA 1LRQA 3HPSA 4LUJA 1R30A 2FHFA 1XD0A 3UY7A 3EWXA 1L9WA 1UH3A 3L4XA 4Y6GA 4FNTA 1GG0A 3O07A 4MKNA 5DBTA 3BW3A 4RX0A 2QMJA 4GO9A 2FB3A 4QSHA 1TPB1 5LSMA 2QCFA 4GUHA 2QPUA 1YDVA 3LV6A 1R75A 1NEYA 3D52A 3T44A 2NLIA 3AJ7A 2H6RA 3VSTA 2WJZA 1Z32X 5IM51 3PM6A 1JVNA 3CTLA 1QCWA 2E5BA 4AIOA 3HG2A 1GOXA 3M5XA 1B3OA 5F2GA 4K8EA 2V2DA 1VC4A 4RZ6A 1H7OA 1MZHA 5AHLA 1Q6OA 3DHFA 3W88A 2CXGA 1JF5A 2YOCA 4QNWA 2C14A 1ME9A 1TPUA 5G5IA 2Y6ZA 3VGGA 5D2TA 4M7SA 1B4KA 9CGTA 4O1AA 4P2VA 1TIMA 2OYLA 4OJYA 1WPCA 4NXKA 4O15A 3BVTA 5HULA 4NJHA 3O15A 1OF8A 4JCMA 3W1TA 3LLDA 1YPFA 1KXHA 3PUEA 4JDBA 1D3GA 4LVFA 4A2SA 2YYTA 3G1FA 3KRSA 2ISSA 4KKXA 4M56A 4Z1DA 3M9YA 1QX1A 2C7FA 2FTPA 3W74A 1DEDA 1E43A 4IX0A 3C2FA 3G1VA 4ZQCA 2ZUWA 1TJRA 1K7EA 1LBFA 1JIBA 1BWKA 4GJ1A 5T26A 3GDMA 1PS3A 1W5QA 4BR1A 3QFEA 3PY2A 1QI3A 1W5PA 1KTBA 4FLSA 1U5JA 4PCTA 3M5VA 1OGSA 2A85A 3VNDA 1SFLA 3TIMA 5U4NA 4UR7A 3TAOA 3D4ZA 3M5YA 2XIIA 1DOSA 3O63A 3M1ZA 4CN6A 1UB3A 3NQ7A 3NXFA 4OE7A 1EA9C 1F6KA 4O10A 2P1FA 4UMCA 1TPC1 3WY1A 2X1UA 2XN0A 1ODUA 2P10A 1EX5A 1GVOA 4O0ZA 1BSIA 4FX7A 2GVJA 3D4YA 1F76A 3DGRA 4TO8A 5F2MA 5C2XA 2WPBA 1AQHA 2C0AA 2YA2A 3EX3A 4E38A 3VMNA 3W7HA 3W7RA 1GTEA 1H7RA 3DX2A 3CB8A 1WBHA 4NU7A 5K9DA 2BZNA 2A0NA 4K36A 1A53A 4MY8A 4Z1CA 3II1A 4AEFA 2F7OA 3NM1A 1KGWA 3PVFA 3AMLA 3RLUA 5BOOA 2X16A 4I7WA 2OX1A 1ZCOA 1JUBA 3WJZA 3BUPA 3EJQA 4JFVA 1H7PA 5K4ZA 1XH1A 4D2JA 1M53A 1HVXA 4ZVJA 1C8VA 3B04A 3N2MA 2YCEA 4LRSA 4LV9A 2F7QA 4MAZA 2G3NA 1VS1A 4GUGA 4GWEA 1XBZA 4NJKA 2F7PA 3ZWSA 2TSYA 1CIUA 5DCDA 4U3CA 5G1YA 4QQ3A 1JQXA 1PS9A 1AMKA 2A4AA 1MO0A 4FLOA 3L67A 5I3KA 2ZE0A 6ALDA 2F18A 2BY2A 2KZHA 2TRSA 5E0FA 4H8UA 1ME7A 2QEZA 4N9DA 3HG5A 3G0UA 4AHPA 1AL7A 2PC4A 2WKLA 4J3UA 1TPH1 1WX0A 3S42A 3W7KA 3P62A 1ZNNA 3GDLA 1VGAA 1LM1A 3TKFA 1QW9A 4TR9A 1W0MA 3TX9A 4DBDA 3CZGA 1O5KA 3R89A 3W2UA 3QW3A 3GXFA 4WJEA 3GXTA 3WK3A 2BLEA 2X1TA 1I8JA 1BVNP 3QMRA 5AC7A 1FXPA 3MBFA 5G2WA 3SIZA 2DJLA 2CWNA 3BLFA 3B03A 3KVKA 2D73A 3VGDA 3ABRA 1V3MA 1LYXA 4WF7A 5FEZA 4GUJA 1D3HA 1OSEA 2LLEA 3ZT7A 1A5BA 2C3ZA 3W2KA 3O06A 4MZ8A 1B0IA 2TPSA 4JTSA 4UCGA 1XM3A 3W9ZA 1MFVA 5HDRA 4UNLA 3JRKA 3W7CA 1SMDA 3CTTA 5DO8A 3W7OA 3LV5A 2EAEA 1TQUA 3B05A 3GDKA 2D2OA 4J27A 3TSMA 2CLEA 2EACA 3W7EA 4Y8FA 3VCRA 4A21A 4JN6A 2CLIA 2GQAA 2YW3A 3FKRA 4TU1A 1WP6A 7TIMA 3FJ6A 4UR8A 1LCOA 3CPUA 4GE8A 1O7DC 3H55A 3TMLA 4CN4A 4N4PA 1KGUA 2XVGA 4Z08A 3UERA 1C9DA 2NV2A 1JUEA 4G1KA 4MPQA 5F4XA 4ZL1A 3CM4A 1LWJA 3UCQA 3HBLA 3K8LA 2H3BA 4QITA 2ZRXA 4DF2A 1XFBA 3W7PA 2PE4A 2WNWA 2Z2UA 4DXVA 5I23A 3ABSA 5I3HA 3NL2A 1NM9A 2E8ZA 1PIIA 4XTDA 2XVKA 2WSRA 1T99A 1U2YA 3S5OA 3ELFA 4OV4A 5D04C 1DHPA 1MW3A 4GIAA 3NR0A 3TDFA 3LHWA 2YA0A 1I2NA 1KLZA 1F2JA 4OU1A 1MEHA 2BWGA 3GIYA 4LVBA 2QCEA 2PWHA 4K37A 2ZRVA 4OGZA 4H3DA 1WXJA 3VGHA 1QWGA 4CCDA 1ZJAA 4J7RA 1T8XA 3NGJA 4HIBA 2XWDA 4BA0A 3WJSA 1OF6A 1VJIA 2I9EA 4JYEA 3THQA 5F4SA 3GBDA 3I65A 1XI3A 3K8MA 4S2BA 1BVZA 2B7PA 3QQ1A 2TAAA 1LDCA 4JIQA 1S3HA 1HUVA 3L4VA 2ABBA 4N9CA 1RZMA 2NX3A 2QCCA 2VXNA 4CCCA 1C29A 2WNZA 3S8HA 1EPXA 2NXIA 3ZT6A 3KLKA 3NAVA 3OBKA 1JXKA 4CLMA 2C13A 3MBDA 3NPVA 4HP5A 4GI8A 3S2CA 1UCWA 2BSLA 3KRUA 4M7TA 1XCFA 4UFIA 5DBUA 3BCFA 4AIEA 4LNYA 2PRMA 2NXGA 4UCFA 1VCGA 3TK7A 1EWDA 4BK9A 1U83A 3DBPA 4JTIA 4GI9A 4N6EA 3UWWA 4UOZA 3EKLA 5K2ZA 3A24A 3UWVA 4JIPA 1BEUA 1QAPA 3GNDA 3MP4A 4UTWC 2FPTA 4QIUA 4H8HA 3OHIA 2E5DA 3UEQA 3LCXA 5IBXC 2VRQA 3IV3A 2GVYA 2A21A 2EKCA 1FCBA 1UD8A 1DL3A 1F5ZA 4CNNA 2VFIA 3UPBA 2EJ1A 1FUYA 1WBJA 3DDGA 1FDJA 1KFJA 3EDFA 3TMQA 3LBMA 3P67A 1XCXA 1IXPA 4HNTA 1TPFA 4MY9A 2EO7A 2PWEA 3W2LA 3P82A 4I7VA 5I3GA 3CHVA 5C54A 3CU2A 1GZGA 5CGTA 5TQLA 1FWTA 3W23A 2E1DA 1CX9A 2EGZA 1EIXA 3P61A 3QMTA 3BG9A 4JYDA 2NZLA 3WEOA 2FHBA 1D9EA 1TQXA 2H3DA 2ZTKA 1CXLA 4JTJA 4BWLA 2A1YA 1VIWA 1A5SA 2BHYA 1FX6A 2W0UA 5CSRA 3DI0A 3KEHA 1OJXA 3L0GA 4HNNA 2CLFA 3L5AA 4CKQA 1W9XA 4FNSA 1G4EA 1M6JA 1OFOA 1RVGA 2E68A 3FAWA 3TONA 3CLMA 3MI6A 4DBEA 1WOBA 5DY3A 3HF3A 2RFGA 2DZSA 1X6UA 4NZFA 2J6XA 2GJNA 2ZXBA 3GB6A 3PBUA 3VI2A 4IWWA 4NI3A 4EWND 4Q32A 4O13A 4PTNA 3GYEA 1PL9A 1CXKA 3W38A 1PHWA 2AGKA 1MXDA 3WEMA 3HB9A 3W87A 1O5XA 4AEOA 2ZICA 4Z0SA 3E96A 2CW6A 5DFAA 1QPQA 2QCNA 1PVNA 2OW7A 1TQTA 1IIHA 4PC8A 2CLMA 2YJQA 3MP5A 4KFOA 1C8QA 2BY3A 1QPKA 3W2NA 1WZLA 2DZXA 2FFCA 4LW7A 4GRSA 4FNRA 5LNSA 5AYYA 1J4EA 1PJ9A 4ICNA 2OSYA 2F7FA 3FW6A 3OLEA 3EJTA 2XVLA 2ZRYA 4LVAA 3W7NA 3BMVA 2CLHA 3P8JA 1SUXA 5HWMA 3KXQA 3Q94A 3RIKA 5AHFA 2EADA 3VM5A 3GAKA 4TX9A 3KLLA 1QW8A 1WAUA 2ZX5A 1YXCA 2TYSA 2X1SA 4NUWA 1LP6A 4PSPA 3QSTA 1BAGA 1OFEA 1XXXA 4UTJA 1W31A 3DFTA 4H2CA 3LPOA 5KSWA 1VB9A 4UFLA 4HA1A 3NQEA 4LUIA 2ZWZA 3EX6A 3O6DA 5K9CA 5AHNA 2A5HA 4Z1BA 1K7FA 4UTKA 3BUIA 1YTDA 1B4EA 4JGDA 4FMVA 3M16A 4JYFA 4ZQRA 4HSNA 4QAIA 1TTIA 4AMAA 1H1YA 3AXIA 3A5FA 2YFNA 3UNDA 2BY0A 1H7NA 1I45A 2WNQA 4L4MA 2VFDA 1JCXA 2ZYFA 2V2CA 4JD4A 1LRNA 5I5RA 1FXQA 4H6KA 1WYIA 1YDOA 3B8DA 2FH8A 4O8RA 2GPTA 1OFDA 4GUIA 2DZPA 3RLVA 1WZMA 3TC6A 4OIFA 1JJKA 3BVVA 3VSVA 4UFKA 3TSBA 5LGXA 5C5YA 2WVVA 3L4YA 4ORMA 1RPXA 5D2VA 2V3EA 4KWUA 3W1MA 4AWTA 4ORIA 1YLVA 3L68A 3PBVA 1QO2A 3MW7A 3WNKA 4HKPA 1BF2A 1O95A 2WVVB 4WXZA 1F7BA 4YWIA 3TQKA 3AMKA 2Z0IA 1FCQA 1VHNA 3OLGA 5HPOA 4MYAA 4IUOA 3W7DA 4NT0A 4UTUA 3LHZA 1G67A 3ZR6A 3UWZA 3TC7A 3WY3A 5AC8A 1XBXA 3V1PA 1NAL1 3G0XA 3L4ZA 5CLWA 4IX2A 3NL5A 1GQNA 2ZDRA 4YMZA 5FESA 3ZS4A 2OMAA 4JL2A 4U2ZA 2J9YA 3EDJA 3WN6A 4OT7A 4UTMA 3BPWA 3S5YA 1P5BA 4UMAA 1JAEA 4TMBA 3OIXA 5BMXA 5EMYA 1F74A 3KL0A 4GKLA 1AK5A 3NQGA 1JQVA 4AVFA 1XD1A 1HO1A 4E2DA 3LPPA 3W7IA 1W5NA 1RQEA 4KFPA 2DIJA 2GJPA 4UTHA 1P6WA 3QW4B 3C2OA 3DHPA 3Q58A 2DORA 1VCVA 1KWGA 1W5OA 5D2YA 1F6PA 1QR7A 1MSSA 3P81A 4WZHA 4UQ9A 3VNYA 1VQTA 3S1VA 3F4WA 5E0KA 2FHCA 4IMFA 1DKWA 3LX9A 2Z6IA 4BI5A 5AYXA 4O0KA 3EKZA 1ZALA 4UQBA 1DORA 3PC0A 1DTUA 2WANA 1ML1A 5E6YA 4LTSA 4FNPA 5CZ0A 3WJWA 3UPWA 4FF7A 3EXSA 1G1YA 3W7LA 1H5YA 2VKZG 5EPDA 3SZ8A 1PCWA 2PWDA 3A21A 2VELA 1L6YA 1ZS2A 1PEZA 5CPLA 2E6DA 5DXXA 2R94A 5A5WA 2EQDA 2C8NA 1GG1A 3VE9A 4NJJA 4ZZ9A 2FPVA 5BRBA 3EJUA 4ML9A 5D05A 4WQ6A 1Q6QA 4OQVA 5G2HA 4O14A 4K8HA 4H8VA 1WE5A 4X2RA 3BG5A 1OK4A 2VR5A 1LOQA 1OFQA 1XV8A 2NXHA 3OVRA 4MZ1A 2CZEA 1A47A 4JFSA 4JTHA 4O1BA 2JKEA 1RPKA 3BUQA 4JX4A 4DEFA 2CHNA 4R34A 1L2UA 1K03A 3EWZA 1VLIA 3RFAA 1KW1A 1X1OA 2F1BA 4JTEA 5EBUA 2WOQA 4MYXA 5SWUA 1JD9A 4RR4A 1WA3A 3VU2A 2I14A 2CU0A 3A6OA 4E0CA 1H62A 5D03A 5BRPA 1JXJA 1VYSX 3LTPA 3TXVA 3DFOA 2QDGA 3MHGA 2WO5A 1MW1A 1BKSA 3T7VA 1EO7A 4A2RA 2OSWA 2V5LA 2ZA2A 2VNCA 3S0CA 3D50A 4UOQA 1QHPA 1LTDA 1SPQA 3RMJA 2DZTA 4JTGA 3G1AA 1BWLA 3ZR4A 3HGSA 3HIJA 3G18A 1U33A 3A22A 4X9SA 3KVMA 5FI8A 1GVRA 1K8ZA 4ALDA 4U33A 1OT1A 1G5AA 3EXRA 3O1NA 4N4QA 5F2LA 3W76A 4XUGA 4PCFA 1FWNA 3VX0A 3M7WA 4IXHA 5LHEA 4MLJA 4JL1A 3IVTA 3ZFHA 1Z41A 4UZSA 5DCEA 3TSDA 3UWUA 1KM0A 2NV1A 3LHYA 3ABQA 4RJEA 2ZXAA 3UWQA 3NQ2A 3LTSA 3TOPA 3GTNA 5K9XA 5CKSA 3A4AA 5I0DA 1KM6A 1VAHA 4JEQA 5E1QA 4AMXA 1SZFA 1DQWA 3L2LA 3M0ZA 3MI2A 2WC7A 3I7SA 4J28A 2ZCGA 5LZLA 4LS2A 2R91A 1MFUA 2ZFAA 3CWOX 3TFXA 1P4CA 5C55A 1IZJA 3UZ5A 4C1KA 1D7FA 5BW6A 2E9BA 2R14A 5HINA 3KE0A 3UWYA 1KFKA 1KM3A 3MYPA 3N19B 1GJWA 1MXSA 4GUFA 4S1FA 3B0VC 5CXPA 5D02A 3W2MA 5MHBA 5CPOA 1TCMA 2D0FA 4IXXA 4RKAA 1XC4A 1GWJA 4M6QA 1TCDA 5CPNA 3HGOA 3ATYA 1XBVA 4BWLC 5CZSA 2WKGA 2BXZA 3TTSA 1FY6A 3D51A 2OW6A 3M43A 1VFOA 1O4UA 3HGJA 4DF0A 4AYSA 1I2OA 3G3DA 2GUYA 1TV5A 4K39A 3C61A 3EDEA 1AVAA 4L4LA 4DO4A 2Q3RA 3BUDA 5EYWA 1FWWA 3UG3A 3BVXA 1W3TA 5AYZA 1QPRA 4JDYA 2PURA 2EHHA 2VFFA 3BAIA 2ISVA 3W71A 1A5AA 2BX7A 2WKJA 3A23A 1KLYA 1KA9F 1KTNA 2WCSA 2V30A 5G1TA 2VC6A 2XN1A 4YCPA 1G69A 2NWSA 4Y90A 1QOPA 2E0PA 1AW1A 4A22A 3HOJA 4DF1A 3KVJA 6CGTA 1GYNA 3MYOA 1GEQA 4LS0A 1LBMA 2AQWA 3FYPA 4NNCA 3KL3A 1CGTA 4O1CA 4ZQNA 1ZJBA 5K3VA 2V81A 1OB0A 1UD4A 1MWOA 3BSHA 3W1QA 1QWNA 1MEIA 2OCZA 1TQJA 4OBTA 1CYGA 3OLDA 3WK0A 2FH6A 1TJPA 1HXKA 4HPXA 1BG9A 1TV8A 3W86A 1UH2A 1E40A 4NNAA 5D32A 4NZJA 3R12A 4LVDA 4LC8A 1W37A 1TTJA 4IMEA 2YR1A 4PA8A 4UQAA 2Y63A 2NUYA 2Y2WA 2CZFA 1PIGA 3M47A 1FDYA 1GJUA 3BG3A 4UMBA 3ATZA 5CZJA 5A2AA 2ISWA 3PG8A 1P0KA 2WQPA 1AG1O 3DI1A 1W3NA 1XL9A 4JR5A 4XWUA 3GXIA 3DC0A 1JFHA 1AQMA 4H7VA 3BAJA 3I6RA 3UG4A 3OA3A 1OK6A 2AAAA 2FPYA 1RQBA 1W1ZA 3LHVA 3PAJA 3AO0A 5CGMA 3EX1A 1OFPA 1KFLA 2NT0A 4EVZA 3H53A 2ZZ2A 1EUNA 2E09A 3QJAA 1ZAJA 4B9ZA 2A6NA 3DAQA 1FWSA 3KRZA 5G2IA 4AHQA 1WZKA 2A7RA 3LM7A 4JX6A 2QCGA 4QJ1A 1SW7A 1UASA 2JGYA 1GVFA 4BI7A 1FCVA 3RU6A 3TV8A 1ICQA 4I9AA 3N9RA 3OLIA 1WV2A 4UTIA 1TSIA 5AN7A 2OYMA 3BLEA 3BUBA 3W37A 1HTIA 1TPDA 3W1XA 3MMTA 1SZGA 1XKYA 5C6MA 5AHIA 3HJZA 4CQAA 2YFOA 3C2EA 3INPA 2B7NA 2CZ5A 1LLWA 2BTMA 3DKJA 2CLOA 4HOZA 1TYGA 2CLKA 1I4NA 2F2HA 2WCGA 3LXBA 2ALWA 2VT0A 1CGUA 3BLKA 1HWWA 1JUKA 2TMDA 5A2CA 1OFAA 3SSJA 3SGZA 1M5WA 5KITA 5E6ZA 1B57A 3BCDA 3NNTA 5HJLA 3L0NA 2VRKA 1KFEA 2J27A 5AHMA 2CFFA 1JDAA 4PFMA 1ZAIA 7TAAA 3E12A 5FF7A 3VSUA 3F03K 5G4WA 5LHFA 2J9ZA 1XDLA 3G3MA 3FOKA 4JTKA 3W73A 1UUMA 2H90A 2B4GA 5KTLA 3QF0A 4UQEA 1EA0A 2G95A 4B9YA 3O05A 1UD2A 2ZXDA 3CZSA 3LI0A 4LOCA 5H2ZA 2VEKA 1TPVA 3S5ZA 3TJXA 2JGQA 1DJNA 1R2SA 1IZKA 1Q4NX 4PL1A 3GXPA 3NQAA 3RILA 5GVJA 3U6WA 3W2JA 4GQQA 2FLIA 1H63A 1KV8A 2CZDA 2WV8A 1HL8A 1BPLB 3N73A 3P5YA 3M07A 1JCYA 3CV5A 1FQ0A 1KM2A 1G94A 1GVQA 4MFEA 4O57A 3S5NA 3LCIA 4FXRA 3W72A 4RXGA 1LORA 3A9IA 3FA5A 2DIEA 1SW3A 3W1RA 3L66A 4X22A 2Y89A 3L2IA 3CIXA 1YXDA 3LCGA 1RQHA 1EHAA 3OVPA 3SR7A 1KCKA 1OX5A 3C2RA 1KM4A 1KBBA 3LLFA 3O8AA 2VEPA 3QZEA 5EMUA 2ABAA 1GCYA 4DQWA 1RR2A 2B7QA 5D2WA 3T40A 3MUXA 4OKDA 1JG9A 2CPUA 3GBEA 2WSQA 3IIPA 2BXVA 4ZQPA 4CQ8A 1O60A 1A5CA 2GVLA 3G1HA 3LGEA 4LT9A 2H8ZA 1CGYA 1S5TA 4WUIA 5FF2A 3LCWA 4IMDA 3EWYA 1XH0A 1JCMP 3KAOA 1E51A 5D37A 2FQIA 3UXAA 3ZWTA 3BSGA 1H60A 5FF0A 1U30A 1KXVA 2QUUA 4UQDA 4O11A 3WNPA 1VR6A 4A29A 2QCLA 3EEGA 1OFBA 4S2CA 1DVJA 4UNKA 3KL5A 3NPXA 5J5DA 1AMYA 4PSRA 1KXQA 1V7YA 2V82A 2DU2A 3G8RA 1BLIA 2VFEA 4I7UA 4XBKA 3WY2A 1O94A 2ZUVA 3BAYA 4GFSA 1K02A 3T4CA 3P7YA 1ADOA 4M6PA 5FF3A 1KM1A 1JL8A 1Y7VA 3C56A 2GQ8A 3DX3A 2YA1A 4JFWA 4WD0A 3SJ3A 3E49A 1VH7A 1MW2A 1J0JA 2DJXA 1JDDA 1EP3A 4JICA 1DHKA 1KFCA 4W9TA 3NA8A 5EY5A 2Y61A 4UNIA 4U4MA 5LGZA 3WY4A 4ADSA 1JI2A 5HNRA 4JNMA 4O19A 3RNDA 3BV4A 2QPSA 1DV7A 1ZY9A 3JS3A 3GZ3A 1NSJA 3QSRA 4AYGA 1SQ7A 4K7YA 4YL2A 2WVTA 5TD4A 3GXDA 1V3JA 5DCBA 3HG4A 1VCFA 2ZZ3A 1CLVA 4JTUA 3NQMA 3EJRA 2PRLA 4MY1A 2QDHA 1MW0A 2Q8LA 1UD5A 3KHJA 4AH7A 2NSXA 4JY8A 3A5VA 4IGHA 4FHAA 1KM5A 2YXGA 5CPMA 5G4EA 3W1PA 3C4UA 4CN1A 3P84A 4FNQA 5KEZA 2V0TA 3BMWA 3MHUA 2YZRA 4BI6A 1QPOA 3LCFA 4O50A 1P1XA 4HN4A 1DJQA 1R33A 4NX0A 1NVMA 2A7PA 3HMJG 4U2YA 2QCMA 3M41A 3PBYA 2EPHA 2RHGA 4O18A 3AJXA 3UG5A 1TMHA 2E6YA 3PSVA 4J3SA 1T0OA 4LU0A 2X1RA 4Z0JA 1UD6A 3DXIA 2D3NA 4HOWA 1DBTA 1G7UA 4JFTA 2GUUA 3WNNA 5CZTA 1CXIA 5A6MA 3QEZA 4C1LA 4M5PA 1TB3A 3W1AA 5AOUA 1HL9A 2QKFA 3LCHA 2R8WA 2G5WA 2JKPA 5FEWA 5F1VA 4JTFA 4XZ9A 1W8SA 3BW2A 1SW0A 4ZQOA 2V3DA 4WXYA 2Y7EA 1Q6RA 3WK2A 3G1YA 3L9CA 4MZYA 3IJ7A 3G24A 1J5TA 3IIOA 3RF9A 4UTTA 3L5MA 4LS1A 2NX9A 3PULA 3QPZA 4LRTA 4WY0F 1E3XA 3LBCA 1QPNA 1KV5A 4N02A 4QISA 5BMWA 5I24A 1IXOA 4EF9A 2ZA1A 3PB2A 1LOLA 3R2GA 4GQRA 3WELA 2ZXQA 1JI1A 4MJZA 5D09A 1KCLA 3VFLA 4NXSA 3OG3A 3L4UA 4ATWA 4GI6A 3GR7A 4FIRA 3MP3A 1XUUA 3QYQA 3TA6A 1ALDA 4ADUA 3UD6A 4W93A 4K7VA 2QJHA 1EB3A 2BXYA 3DENA 4RK8A 2WVSA 4K6AA 4AWSA 4HNUA 5HR6A 2D0HA 3WJYA 5KZDA 3P5ZA 4PEEA 4DELA 2C18A 3MJYA 4IOTA 4MIMA 1CPUA 3EJSA 4UZUA 3SW6A 2FE0A 4AEEA 1I2RA 3R8RA 4YXGA 1SR9A 1P0NA 1NF7A 3U2OA 1OFRA 3N9SA 4ZMGA 2ZUTA 2G96A 5DY2A 4WX2A 2ZZ1A 1V3LA 3QMSA 1DQXA 2EF9A 3CT7A 1NFBA 1XGZA 4O52A 2VFGA 3GK0A 5J5RA 2QJIA 2UV8G 1R2TA 1G7VA 2NWRA 1ZFJA 3E0IA 1H50A 1UH4A 3NDOA 1TTPA 2ZX7A 1R47A 1YDNA 1CDGA 2HS6A 1LWHA 1XCWA 1LRTA 1TQSA 2E77A 4UFJA 1Z44A 3IGXA 1RV8A 2WSYA 1J2WA 4GO8A 4UTWA 3IVUA 3TH6A 2XN2A 4E2BA 3VKJA 2D3LA 5HWJA 1GYLA 2XFWA 4DPPA 2HS8A 4N9EA 3FAXA 1PZ2A 3WFAA 3BAXA 1N8FA 4RXFA 1LLZA 2ZX6A 4BFAA 4AB4A 3EWBX 2VFHA 4TMCA 2ZBTA 3DX0A 3TUUA 4GINA 4R53A 2FDSA 3NQCA 4IMCA 3NQ6A 3PUOA 1MEWA 3A47A 3BLIA 5A8GA 1AL8A 4RV8A 2C16A 1TV7A 3G0SA 3I68A 4KFNA 4Q4KA 2C1HA 2WSPA 1IF2A 5HMSA 3NPWA 2FYVA 4IMGA 4OHQA 1VJSA 3UY8A 3TROA 5FEPA 3W22A 1KFBA 2ZZ7A 4DO5A 3IIZA 1M7OA 1GJPA 1LOSA 3D0CA 3LOTA 2QMKA 1PV8A 4ADTA 3BVJA 2C19A 4O1DA 3LDVA 1VPXA 2F61A 4HSOA 3ZR5A 1J0HA 3VGEA 1G4PA 4IPIA 4MVAA 5HWNA 2W79A 3CZKA 4M19A 5I3JA 5BRQA 4JTTA 2JBMA 3NO5A 1SZNA 3TQ0A 1QFEA 5KZMA 3LXCA 3TAKA 3E02A 3ZO9A 4M8UA 5AB3A 1JCJA 2XWEA 1OX6A 2E6AA 4HOXA 1OABA 1IV8A 4LPCA 2BY1A 3NM3A 4KWVA 4TVUA 1QHOA 3BLPX 1H7WA 5KMYA 3GDRA 1GTHA 2DZVA 5E9AA 5D38A 3W1NA 3NG3A 4IPJA 1Z42A 3L65A 3F4NA 1SO5A 2GJLA 1JD7A 3CZLA 3G1XA 5TBOA 4NJGA 5BNKA 1EO5A 2Y88A 3HO8A 3M5ZA 3ZOAA 3CPRA 3HQ1A 5I3IA 3IRDA 4FX8A 1LROA 3M6YA 5DELA 3NL6A 1B2YA 1JGIA 1UD3A 3NQ8A 2RDTA 5K4XA 4FIQA 1W3IA 4WY0A
chains in the Genus database with same CATH superfamily
2FD6H 3SOBL 4FL4B 4GEIA 1FWHC 2VMJA 3X11A 4L2LA 4AI7A 4ROPA 5HUOA 4MOZA 2J79A 1JGDA 3GTXA 2P0OA 4N2YA 1OP4A 2JF1A 2ZZ4A 4FLRA 1J10A 1OGTA 2YDAA 3WMSA 4ZS6C 3MRGA 2C15A 2HRPH 1BFSA 3TPUA 2MQCA 3O6LL 4NQUA 2EH8L 1J1OL 2Z8VC 1KYUA 1IKNA 1GOFA 4PUMA 3S1XA 1U9KA 1D2PA 1MY7A 4PJHE 3PJNA 4DJFC 2KKQA 1MDLA 1B0GA 1UKPA 2YSTA 3NTYA 3URBA 2J9XA 3CUXA 2GK2A 4AUUA 4XKYA 3S9YA 1PZ0A 5IB5A 4X8CA 3MQIA 1YUHA 3T0TA 1XHGA 5EU7E 3TNBA 4BKNA 2QVMA 1PJWA 5KG9A 2ZCKL 4Y16A 2RFXA 5LNWA 4D94A 1FZOB 4G7VL 4Q4PA 1TTQA 3WLRA 1JR1A 3SYAA 2NY0B 2NW3B 1SZEA 2J77A 4R7DA 2BFGA 3PZIA 4P23D 3SE3C 3FMGH 3MT1A 3UR5A 3VAVA 3BJFA 1BTCA 4V1DE 3KFTA 4M03A 1AQKH 3WNLA 2FATL 3RR4A 1IJNA 1T6VN 1JCLA 4UT7L 2PFHA 4S3DA 1Z3NA 1MRAA 1A9BA 3V6FB 2M1KA 1P5UA 4NRYA 2PLMA 4JE0A 1XBYA 4FNLL 1H1ZA 2F7IA 4O17A 4F37F 2O6EA 1KCBA 4A7GF 1OP5H 2R9RA 4ZO7A 2BSTB 5HJYA 1FRGL 4UBDD 4CNTA 2X4QA 1JF6A 4F2FA 1G7JA 3ULUH 5TFSH 5KS9A 2VD9A 5C3TA 2PD9A 5DJ8B 5AB2A 4IJBA 3UJTH 5IOPA 5D8ZA 1YRRA 4EAMA 4XRCA 3X1FA 4I8DA 1XR9A 3TNOA 3HGRA 1OXYA 3VIFA 3EWUA 5HJGA 3ZVVA 5FIEA 4X7SL 4W8LA 3HQNA 4M9PA 3GXUB 4KWWA 4I4WA 4F9LA 2WINB 2XN9D 3TQPA 1RFDH 1IGML 2YAMA 5K33A 1YMMB 1F05A 5TPWL 4WO4C 2WXOA 5FIPA 3W84A 4F91B 4I9JA 4M3HA 1FLTX 2P8MA 1OAXL 3ETBJ 1LBLA 2J5LC 3JZEA 4KKLD 2OPJA 3HBZA 5C0DB 2VW4A 1T83C 4U6VL 2VTFA 3TA3A 3VM7A 1KYOK 1UWIA 5C0BB 4LLYA 2R1WA 1RA0A 4NAFA 5FYKH 3QFJE 3VI3A 5ESVB 5F4WA 2X2JA 1UQSB 3NQDA 4PB5A 5C09D 3B2DC 1E9YB 3CX2A 3PF3A 1RUAH 3QY6A 2Z4GA 4R33A 4QRPE 3VO0A 4PRNA 3GKWL 4X0VA 1SO6A 3CZJA 3FU8A 2BERA 3MLZL 3K2IA 3PK7A 4JPKH 3ZMEA 2MQGA 4ENED 3EO9L 4ODWA 3APYA 1YADA 2GW5A 5I16B 3C60D 3LXAA 1E9OB 4M4RA 2G97A 1S7WA 3D39A 2ICWI 3O3AA 4HNVA 3QQ9D 1TELA 1IGYA 4OIIL 4EQ3A 3ZQ9A 5L6UA 4N1CA 3GR8A 5GGQL 5DRZA 3GS4A 3H85A 2WZPD 4ZZKA 4HJIA 2OMYA 3QUMH 4C7FA 2PYEA 1FJ1B 4M8QA 1KCRL 1IM9A 4JTLA 3L81A 4W8AA 3ZHDA 4U28A 4RNFA 1ISZA 2EDHA 1NCUA 5E2WH 2JKRM 5INDB 5IQ9B 1F6AB 1MCBA 3F7VB 3GKAA 3UTTD 5HYSA 2FEEI 5FHAH 1EXUB 1EQPA 1PE1A 2WQXA 4DP6X 4US6A 4NQQA 3SO7A 2ZWYA 4H4NA 2EC9U 3IXAB 2VR6A 4DJDA 2X30A 1X5AA 1UM6L 3CSFA 3U4AA 3NEXA 2ZOTA 1MFNA 4EIVA 1M71B 5I66B 5I26A 4F7TB 1RJPA 1XZ0B 2IPWA 2GAZA 2V5TA 3IM1A 4PB0H 3QGKC 7ODCA 1CWYA 3AJ7A 3D9AL 3PM6A 1NZRA 3ZE0B 4WWOA 3CTLA 4LSQH 3GH7A 3B3IB 3W6LA 3RVWD 4AIOA 2AI0H 1IGCH 1XIFA 4G43A 4XC1H 3WFEH 4K8EA 1UATA 3QDJA 3TVMD 1XEDA 2C9QA 4MWFB 1JPFA 3VGGA 4LSRH 3QHZL 1WUEA 4JFQA 1HXYB 1CECA 3HNVL 2TSBA 4K2UL 4JDBA 2YAEA 1D3GA 4D3CL 3ME0B 3THML 2P9RA 1DEDA 2FTWA 4IX0A 3KM8A 2X09A 5T5FL 1NCCL 4G7FA 1HINH 1HU8A 4BR1A 4YVNA 5FEBA 1WDSA 2EZ0D 3M5VA 5GNZA 3FN9A 1I3RA 3QDME 1NDMA 2VZOA 1F6KA 5KBPA 4ZW3A 4FX7A 2YA2A 4E38A 3TN0D 1H7RA 1U5HA 2H3XC 1KGWA 2NY6D 4TSAL 5CHNA 3EJQA 3OXSB 1C8VA 3TGXA 1F3DJ 4L1WA 3QY7A 3CFBB 2CA3A 2OMXA 2TSYA 3WH8A 4AY8A 3CS2A 2ZE0A 1MCCA 6ALDA 2KZHA 1OE3A 4Q0XH 1CLXA 1QKZH 3WLNA 1BJ1J 1C5DB 4L4VB 3NFPA 3CV6A 4Z3TA 2VR2A 3SDDC 1ZA3A 5C8JB 3AT9A 4LHUG 2POTA 3R19A 1DJSA 4NO2B 5D9NA 3BLFA 1FN4B 3KVKA 3OKOA 2WGXA 5DEFB 3NT0A 4GUJA 5DJXB 4L8SC 1O66A 3FT0A 4I6KA 4B90A 1XM3A 5HHQB 4R83A 2PYFA 4TKWA 4HXBH 1NCDL 1HH9A 3FO1A 5F1NA 1ZB5A 4QRNA 3H9HB 1UWRA 4PJ9D 5F1OB 1D6VL 2K6ZA 4PD4K 2CLIA 4UR8A 3NZHL 4I0PA 5F70A 3RRQA 2C3VA 2WB7A 4Y4HD 5IBLC 1PKOA 4HNOA 3W7PA 3LNIA 2Z2UA 1JHKH 3SE8L 3EH2A 1Q13A 1U2YA 4DP0X 1FE8H 3PHSA 4L0ZA 4LVBA 2PWHA 2NMSA 1VFBA 4PJAB 4L8CB 2E27H 4GNKB 4C1NA 2CDGA 3QNFA 5BZWB 3HHSB 2P42B 2NSMA 1BVZA 3EBVA 1LDCA 4JIQA 2L8AA 1YEEL 2NXIA 2DL2A 2HRHA 1J5CA 3PN8A 3EYVB 4UFIA 5C0FA 3GPSA 2XWZA 3D46A 2ROXA 4LNYA 1UWEH 5DC9B 1EWDA 2Y6TE 3WKML 5CEZD 1U83A 1JFQH 5HGDA 3FONB 5E6IB 1DZBA 3D0LA 4YHML 4TQTA 1WG3A 3VFCA 1USZA 3IV3A 1N0LA 1OZMA 4GFIA 3TEXA 4X9BA 5IG7A 4MA3B 4ERSL 2EO7A 1Q9KB 5E8DL 1A1NA 3Q6GL 5E8NA 4DKDC 1JK9B 4UU9B 1JTPA 1YDPB 4NG3A 4TNFA 2V2TA 3G04A 3KZSA 1GY1A 1AO7D 1EJOL 3VTAA 3QDAA 4KFZC 3TONA 1OGAD 3IDYC 3ZDYF 5I1LA 3L3DA 4JVPA 4QRBA 3S35H 2PODA 1AR1C 5EZOL 1HZLA 4MQ7A 2QW5A 4KGLA 4XAYA 3C2SA 3K4WA 2VZSA 3RWEA 4OLWH 3BKMH 3PTQA 4E3TA 3FW6A 3VILA 4ZQKA 2E9LA 1UHVA 1M2VA 3MLUH 1J5DA 1U0QA 5AZ2L 3TWCH 5F0LB 2PLKA 4AGOA 4HPGA 4TF4A 4JEGB 4WEBL 3DTDA 5ELIA 3QLDA 2I57A 2F8OA 4M7JH 2OMVB 2ERJB 4UFLA 4GMTL 3EX6A 5T5FA 4HIXH 4P2OD 5HHPA 4XP5H 3RWIA 4FMVA 4RDWA 3SO3B 2BY0A 4TOQA 1XINA 1XPGA 1S7QA 2WB1A 4PJXF 3TO4B 2HXTA 3RLVA 1RALA 4H2HA 1HKLL 3RX7A 4LSUL 3Q0HA 3BKYH 5LGXA 4YXLL 3VWJC 3T77A 3TJEL 4K7PH 1O95A 5CF3A 2F19H 2RCSH 3AMKA 3OLGA 1IM3B 1IQWL 4XMPH 3S7GA 1Q9WA 1SVDA 4JO8A 1A4LA 2J9YA 1JV2B 1T22B 4J6RH 4YDJB 2C3HA 5BMXA 3E6EA 4B2DA 2NXYD 3MLSH 4FULA 4Z7QB 4UTHA 2HP4A 1WK0A 2DM4A 3SGKA 1QR7A 2PPDA 3FCGA 4NC1E 4H20L 2WXKA 4YQXL 1LLAA 2VDLH 2W60B 2HUEA 3MLRH 4UZGA 1JK8A 4ZENA 1DR9A 3U2SA 1VLXA 2P44B 3QEUA 2IV8A 1PCWA 3DGGA 4WQ6A 4H8WL 4S23A 4PBDA 2N01B 4PWIA 1LOQA 4ZFZB 1A47A 3BUQA 4KXBA 4OIBA 5D1ZI 1Q90A 3F83A 1TJGL 4KK6D 4BINA 1X1OA 2XG4B 1DBBL 3O4LE 4W7UA 3QIWA 1IBDA 2RB8A 3INOA 3MACH 4CMMA 4PI2A 3EGXA 4P5TD 3OXRB 3GYCA 2GTWA 1LTDA 2QNEA 3SQBB 3HIJA 4UOW0 3RU8L 3GPEA 4ANWA 5IQMA 3TYEA 2WBJD 1COBA 4JL1A 4N2EA 2BIPA 3NQ2A 1RBAA 2VC5A 4DO7A 5CR8A 4NI6A 3CMOL 4IKNA 1YPZE 3C5JA 1ODZA 3WIIL 2JI2A 4BUHA 4AVOA 1FP5A 4Q8MA 2C4XA 5JPNA 4GUFA 5D02A 1TE1A 3X13A 5T8IA 1OD8A 1EAPB 5IEHA 3KJ6L 1MCIA 3L1OL 3ATYA 2A73A 4RSYA 3TTSA 5DMIL 3M43A 1J1OH 4Y9NA 3P14A 3O2DL 3CHXA 4NGHL 1X8CA 1FWWA 5AYZA 1A5AA 2XBDA 3IF1B 3HRPA 4MJHA 1WBZA 1AW1A 2FEDC 6CGTA 3NIDF 4KK5D 4LS0A 3PBMA 5D5MA 5AOMA 3RTQB 4QX4A 4GRWF 1OSZB 3FDGA 2ITDA 4M24A 1E40A 2ZJSL 2WQWA 2WAQA 4LVDA 1FNHA 1TTJA 4PA8A 2R0ZH 2ZSWA 2NUYA 4UQ3B 3HUJF 1FDYA 1AIFA 3OJGA 4DJMA 1AG1O 1V02E 3DI1A 3LZFH 3T81A 1CE6A 4JX0A 4Y0GA 5C70A 2CLRA 4UIMB 3SCPA 1E9IA 2IPKB 3H53A 1V6WA 3C3UA 5I9QC 4B9ZA 4KIRA 4JLRA 4JX6A 4R26H 1KACB 3ZVHA 3GUFA 3EOYG 4OOZA 4EANA 1M05B 1W2KT 2AKZA 2WUCH 5LXGL 4X4ZA 3HJZA 2IQDA 1F41A 3V52L 2B4CH 4G8TA 3DKJA 4WW1A 5CLYA 3S4TA 1CGUA 1RH8A 5E2UL 3LD5A 4ZS7H 5KITA 1YEHL 2G75B 2NV9A 3U1QA 3QUYB 3VSUA 2YXMA 2E7MA 2C71A 2WM1A 4P49A 4QDGA 4XP4L 3MJ8B 1ADQL 2VXUH 3DO4A 4PL1A 3RILA 4Q9QH 1H63A 1K72A 5HI3D 1W1VA 4F80A 3S5NA 1C5CL 2XETA 1BAWA 2XVBA 4RXGA 2UXGA 1HOCA 2EDRA 3AQYA 5DEJA 2XKSA 3C6LC 5G4OA 1E8ZA 3Q3GA 4DK5A 1KFAL 1QBBA 1S3KH 3FF7A 2DQ6A 2UBPC 5DGQA 1AFSA 1ZTMA 3HBPA 3KDMB 32C2B 4GT0A 2DJ4A 4WUIA 3LCWA 2FWOB 3UW6A 5KOMC 2HG5B 2FQIA 1H60A 4DNLA 1MFDH 3K6OA 1V7YA 1IGMH 3G8RA 4YZWA 4GSRA 3X3FL 4H5SA 4YFLF 1FZKA 4BCYA 2OEJA 4OJAA 3K6DA 1QNZL 4ZYKB 4JQ3A 4P3DB 3F2CA 3VRIB 1WTLA 4U6VH 3ANUA 1GS7A 5AW8B 4PN6A 4L3CB 2XFGB 1A3HA 4AYGA 3PS6A 5TDNA 1M3IA 1JPKA 1HJWA 1VCFA 5I1JL 5IB1A 3CVDA 4QTIL 1HN1A 5MHSE 1FH5H 4I2XB 1MREL 4BI6A 4B5ZA 4O50A 4HN4A 3ITXA 1NVMA 2L7JA 3ZJ7A 4DWDA 3DRQB 5REQA 4KX8A 1G7UA 3CV2A 2CZNA 2OV0A 1J1PH 4ZE4A 1U3ZA 5GGRY 4ILSA 3P9MA 3EFFB 1NCJA 4G7RB 1XG4A 4ONGH 2G41A 4CC1A 3EGJA 2X0VA 3UTZA 3WEXA 4OFPA 4HK5A 2QJNA 4EF9A 1S38A 3R2GA 1KD0A 4AEHH 3HC4L 4GI6A 3HZYB 4HFWA 3GVWA 4OIIH 1RMFL 4W93A 2WBKA 4IGBC 2IALB 3H42H 4UNUA 2BG5A 1LTXA 2IWGA 1MCOH 2XQYK 5C0CA 1WAAE 5IJDC 3UTSE 3CT7A 3BGFB 5BZAA 1S9WB 1HOEA 5HANA 3KPTA 5JMRA 1CG9A 1C16B 1TQSA 3VQ1C 3JWOC 4LVNC 3MV7B 3TT1L 3FQTA 4CSSA 2IAMA 3LDBC 4RXFA 1LLZA 4WO4A 2VLRE 3OZMA 4DAFA 4EZJA 4OFVA 5EDXA 1GOOA 2COVD 5HMSA 3A4JA 3R7MA 4DW2L 1GJPA 4ADTA 3MCKA 4GRWH 4O1DA 4HIEB 3U2ZA 2HJLB 5F7EL 3O9NA 3NFSL 2XUWA 3H12A 3TAKA 4XMLH 1AD1A 1SXBA 4TVUA 3IWUA 3TWBA 1AI1H 3QPQD 2DZVA 1EO8H 1E8WA 4D0DA 4WFFD 5CJ8A 2GJLA 1QLEB 2VX6A 1HIML 3RWDB 3W24A 4X5RA 5JBDA 4N20A 3QXDA 1XGTB 5DELA 3RDTD 3MBEC 1BRLB 4Z78B 4AD4A 3W56A 25C8H 3VFPA 3DURB 1MNUH 3THMH 5D7IA 1ADQA 2YDSA 5F72S 4U10A 4WI7A 1BFTA 5DGRA 3X11B 2Z7UA 3VIOA 5KBMA 3NCWA 4LAUA 5JZ7C 1ERNA 4HJFA 3BV7A 1JGVL 2DZWA 3LQGA 1JGDB 2OULB 4N5ED 4Y89A 1RVFH 4LFHG 3T07A 1OGTB 4P7LA 3MRGB 2KZWA 2F5AH 3TPUB 3F7KA 1NWPA 2QGEA 2WWCA 1DZ0A 3NCMA 4IDJH 1NBYA 2NZ9C 4MG4A 5FJUA 1YHPA 3OMNB 1B0GB 4EOUA 4TQPA 3S35X 4JHAL 1JNHA 3CQFA 2I17A 4Q4IA 4XKYB 2QIWA 3CFMA 5FHBH 2PRHA 1TLKA 5IB5B 4MKSA 3BUYA 3N18A 4P9MH 3BAKA 5I74B 3AISA 1YUHB 2FVMA 3T0ED 3SUTA 3IIXA 4Y4FD 5M7QA 5KG9B 3EX2A 4Y16B 4OF8A 2RFXB 2XX0A 3ARFA 4D9LL 1J0IA 4W88A 1H15A 4WSGA 1XWYA 1UYWH 5HVHC 4XX6A 3QPYA 4J2XA 3MANA 1CE1L 1CL7H 4R7DB 1ZXKA 5CG7A 2O30A 3UQNA 1W56A 3G1RA 1FFQA 4N6RA 1RIHL 4NNBA 4QYAA 2CBTA 5BOJA 2M83A 3M64A 1NCDH 2LW3A 3UL4A 3D5OF 1MI5A 1D6VH 3GTTA 1A9BB 2YPIA 2FX7H 2V3GA 1P5UB 2DWTA 3NZHH 4NRYB 3MJ7A 4LSTL 1RLDA 5IIEA 2ZWNA 1XT5A 1YYCA 4PWKA 2CGRH 5ECGA 3AG1B 2C4FU 2B5IB 5A6SA 2OQYA 2NX5E 3WS3A 3SE8H 2QQLL 3MMWA 3OOQA 4BBWA 2DH3A 3E0GA 4TV5A 1N55A 1MG2C 3NVTA 2Y9RT 1VESA 1DWHM 3VCCA 3FXGA 3LU2A 2YUVA 3U5YA 3PY9A 4PTVA 2X4QB 1YBQA 3O81A 2JIXD 1G7JB 4KZ0A 4XZMX 3S3GA 5G5DA 5KS9B 4CNOA 2QV2A 4PJ8B 3LYEA 3BP6A 3DETD 4Z95L 2Y7FA 3HTWA 5IOPB 4AK2A 1BXAA 4XRCB 4L6OA 3E2HB 3WF1A 1XR9B 4LHJB 3L21A 1Z8AA 4YHMH 4K2SA 3ZKMD 1Q7MA 2BX5A 4I5RA 2WPGA 4I4WB 3HHMA 3A67L 2E9WA 2XVNA 3VG0H 2DF3A 3QDHA 1W3LA 3WG7B 3B9AA 3ML8A 1BQCA 3W29A 4JKWA 4MS8C 2P8MB 5G55A 1N4XL 2VEMA 3PYCA 2XIBA 1EJOH 3TA3B 2MKWA 5JH2A 4LLYB 2R1WB 3IS4A 3TL5A 1JRCA 3CZEA 4Y19D 4NAFB 4LNRA 3VI3B 3HFTA 3ZE0F 5CGBA 1GT8A 2XM1A 3H7LA 1N7KA 3UXKA 3CD4A 5EZOH 5T1JA 3NABL 5KYYA 2Z0UA 4PRNB 3OIHA 4WWNA 5FM8A 4JS3A 4UAHA 2ZADA 1UMLA 2ZVIA 5IROC 4AZ5A 2X0UA 5SWSA 3VXUE 1LE5A 4GXMA 2ZG1A 3LS4L 4ODWB 1YZZA 3ZTNH 4G3YL 1YX1A 4M4RB 1X4ZA 3KYNA 3MJ9H 2VCAA 3DUHA 4CBZA 1S7WB 3WJMA 3D39B 4H9VA 4GMTH 1IR1A 1ORQA 2E76C 4WZ9A 5E09A 3O3AB 3V7MA 1FNEA 2O92A 1IGYB 3PLYA 2GJRA 3BZDA 4S0SD 1G9MH 3HR5A 5DRZB 5AVZB 1NC4D 1O7DE 2OMYB 3PG9A 3VRJA 2MMXA 2PYEB 5EUOE 5LDSA 1EZWA 5FUCC 4GVIA 3ETTA 4M8QB 1ETB1 1IM9B 3PSWA 2D7TL 4AC4A 3HPJA 3GFZA 3VKAA 3QPXL 1NU5A 1CLYL 4L9LC 4B27A 3E3HA 3N1MC 3QH2A 1F58H 3FVMA 3C5ZD 5HYSB 1F11B 3OR7A 5SWZA 2WMKA 2BSCA 1GGCL 2QJMA 1YEJL 3KBSA 4BCXA 1EEZA 1C7SA 3HPSA 3NDYE 4KFMA 4REQA 3OL2A 1XD0A 4G42A 2E25A 1ZU8A 2LR4A 2Q71A 5JXEC 4QSHA 2CYGA 1TPB1 4HJWA 4FK9A 1IC7H 2GAZB 1T66C 4Y2OB 2RJGA 2OB3A 3V79C 1UZ1A 2QHRL 4O1EA 2A83A 4E9SA 1XAUA 3RVUC 4FXKC 3HMCA 4B9JA 1XTMA 2KLTA 1UFGA 3BIAX 4RDYA 4ZMLA 5AVQB 2AGJL 1H7OA 1MZHA 5I0ZA 4GXWA 3AU0A 2C14A 4G43B 3QDJB 3NH7L 1H8SA 2IVFC 3HIZA 3BZ4A 2OYLA 1UXSA 5DJ0A 4U5IA 4O58L 1JPFB 2NQDA 3LLDA 1PZSA 5A2LH 3EYUL 2X1PA 4JFQB 4LP8A 4HH9B 4KKXA 1X5FA 4L4JA 4W9FC 4F57H 5F9JA 3U0WL 4HYTB 3RDJA 4HC1H 1TJGH 4PJAF 3QOKA 1DBBH 1YEYA 3LZNA 4OLZL 5J8OA 1A7PH 2CBJA 5H35A 3UOAB 1J9TA 3OZ9L 1E15A 5EEZA 1AGFA 4DPRA 4CN6A 1EHLL 1PB0A 3IDXL 2PTXA 1I3RB 3RU8H 2QPFA 3WQGA 1NDMB 3DVNA 3KDOA 4F0MA 4ZUWA 4G7YH 3FRUB 2FUQA 4P05A 1BAFH 1NGQH 3AMLA 2X16A 2VKXA 1G1CA 4TTDC 3VWJA 1N59A 1SXAA 2VXSH 3IMWA 2CCRA 4H9YA 4LRSA 5CHNB 3H3PL 4GH7B 2J72A 4KITB 5ENWA 3W82A 3LD8B 3GMPA 1P84K 2OMXB 3L1OH 5D4YA 2R23A 5FO8A 3S42A 3ARPA 3MCMA 3BURA 3O2DH 5EOQL 1I60A 3P0YH 4R9XA 3NFPB 5AC7A 1GC1L 3UGUA 5G2WA 1RJCA 5ADOH 1TDQA 4L5ZA 4WF7A 4Z3EA 4HU2A 1JZJA 5A94A 1FWJC 2TPSA 3OKOB 4HXAL 5B1CA 1DLFH 3GR4A 4KRTA 1Q6EA 1XMWA 3VDHA 2W67A 3IUIA 1U1HA 4HVXA 5SX5H 1EFXA 2ZJSH 3OVUB 1KGYE 1VKFA 4FXTA 2PYFB 4LVOB 3KBNA 4TL5A 3F00A 1S9XA 1K2DA 1HH9B 3FO1B 5F1NB 1A3WA 3B2UD 1BECA 1QUPA 3BKCH 4PRDA 4GE8A 3RVVD 2BSBA 2VW6A 4I0PB 3NFUA 4DXVA 1PZDA 2C3VB 4QOKD 4PH8A 2VXTL 1T99A 3ELFA 4JIRA 4I18A 5D7KE 2C9XA 5E99L 4CCDA 2FZMA 4PUDA 2CNZA 2Y5SA 4JYEA 4LGPB 3THQA 1VFBB 2H2SD 1WWBX 1QHQA 3LQZB 2CDGB 4C1NB 1PZ1A 4NQCD 3NAVA 3LYRA 2VP8A 3KRUA 4JM0A 3C08L 2PRMA 4QS5A 2C9SA 2PDIA 1VCGA 2F6XA 5C0FB 1IR2A 4EXKA 6PTDA 4IBSA 3R06A 3VQLA 1ANUA 4HUKB 4JIPA 5IMKA 2ZXGA 1N64H 5HGDB 4PBEA 4WNQA 3OHIA 3D0LB 3ZMNA 3MRHA 1FYTE 4CNNA 2EJ1A 1IE4A 5AAMC 2CWXA 3H7UA 1B54A 1N0LB 3QJFA 2PWEA 1CB4A 5D7LB 2R1PA 3RPIB 5TQLA 5IG7B 3P61A 1KGCE 1D9EA 2CC0A 2P80D 3BWSA 3D3FA 2HLFC 3GC4A 1DCEA 1A1NB 3FCUB 4Z7QF 5DJYA 5E8NB 1Q7QA 3T65A 1OJXA 4KKZA 2CLFA 4OF5A 1RVGA 5I8EA 2V2TB 3NJKA 1GGIH 3G04B 5B1AB 5I1LB 3L3DB 1OCNA 2AGKA 4E8CA 4RISH 3X3FH 3ARBA 2CW6A 3N13A 1JPEA 2PTTA 3MOBH 3HNTL 1L0YA 4MQ7B 4ODUA 4BFFA 4QXWA 3FX4A 1LDSA 3RWEB 2CLHA 4P2QD 1E9LA 5HWMA 4AW4A 4I9WE 4YVPA 4ZQKB 4WHCA 1M2VB 3LIZH 4G83A 4PSPA 1WAEA 4OFYA 1W31A 3NPZB 4Y7MA 1ZLVH 5I1KL 4HA1A 5F7HA 3IE9A 4Z1BA 1QHZA 4NZUL 3GVQA 5HHPB 1X9UA 3RWIB 3MGOA 5BOEA 4BM7A 6ENLA 2HT3C 3U48A 2X89D 1FUNA 4FQ1L 1NMCC 3ZJ6A 1S7QB 1MCKA 3CUJA 3VSVA 4GKZA 1DQLH 5D2VA 2YPLE 3QORC 5GRJL 2FZDA 1BXNA 1S1PA 1AZBA 4G8FA 4D0BA 4ZUUA 3HC4H 3T77B 4MYAA 3EO0A 5FF6A 1NUDA 5AC8A 1IT9H 1GQNA 3K6NA 3KBJA 1IILE 4OT7A 3X1EA 1Q9WB 4DP5X 3KL0A 3NAAH 2N7BA 1G87A 1W5NA 2FL5A 2GDVA 1L4IA 1GGOA 2WZHA 1SLXA 4L5FE 3AZSA 3F65A 1UURA 1EAJA 3NJMA 4UQ9A 4RFNB 2EDWA 3TT1H 3IJ6A 3LX9A 2LGNA 4H1ZA 1BM7A 4JRLA 4IRSD 4DFHA 4UQBA 2CBMA 4JREB 5EPDA 5JNYA 1JK8B 2VELA 3U2SB 1FORL 3KH3A 2HUHA 2QQQA 4N3UA 3QEUB 1TJ1A 5K9JL 3EJUA 3DGGB 1O5RA 1Q0XH 2XIMA 4DW2H 5ILTL 3ULUD 2WQDA 1SF3A 3MUAA 3I9PA 5F7EH 4MNGE 1L2UA 3T5WA 1UP2A 3KYAA 5I6NA 3OC5A 1B88A 3EF7A 4F3HA 1NKRA 1XAKA 3UJJL 3QIWB 4FFYH 3MHGA 1FHVA 1QU4A 4UDUA 4CMMB 4KEMA 3EGXB 3V4PL 5C8BB 4NWUH 5TF1H 1MDTA 2DJSA 1OL0A 5HDOA 1U33A 2GTWB 4LRNL 4X9SA 4NQEE 1WWAX 3VCLA 4U33A 1OT1A 3EXRA 5ALCH 4DBSA 1OAQL 3IVTA 3AHVA 5IOBA 3TC3A 5SV3A 1V8HA 3PHAA 4M61A 3VKBA 5T1MA 2VVNA 4OJCA 1XIEA 4TPRL 3TFXA 3CVHL 3KWVA 3QEHA 4UTAA 5HINA 2R14A 3KE0A 5FYKD 5IBTH 4TX6A 1MXSA 4YK4C 5MHBA 2HRLA 5E9DA 2ZOLA 1ISWA 2BXZA 3X13B 4XOBA 1N8IA 3CDGA 3WLQA 1S9KC 5B8CA 5IEHB 3G3DA 2GUYA 4TV6A 4NT6A 2A73B 3A3WA 1TA3A 3BVXA 3GNMH 3BAIA 4OV6F 4AYBA 2QGDA 2HWZL 2D1ZA 1AZCA 4PREA 4A22A 2FRGP 3O3UN 1JNDA 3CFNA 2AQWA 4PJIE 4LB4A 3TM6A 1WBZB 1MWOA 1QWNA 1CYGA 43CAA 1IC4H 1BG9A 4P7QA 1PDKA 3R1GH 5D5MB 3IB4A 4DETA 2ITDB 3IXTA 4L3EE 1GL4B 2OLSA 3ATZA 1KO0A 1X6NA 1CD0A 1U8QA 2EDBA 4ZTPL 2ZSWB 5FOBA 1AIFB 1RQBA 3LHVA 1F4HA 1CE6B 1KV3A 1R9FA 2CLRB 2NQ3A 2QCGA 1GHFH 2ADYA 1SW7A 3FSOA 2ADFH 4JLRB 3ARGD 1MCSA 1MRFH 1TPXB 4XNZB 3ZVHB 3OSVA 3OKKA 3INPA 3VYNA 4XC3L 1LLWA 1TYGA 4OJEH 1QBLL 4B0MB 4WW1B 1B57A 3LN3A 3VFMA 4LAQH 3BLOA 2UY3A 3AT0A 2GIYA 3GQYA 1X4XA 2OX5A 1OE1A 3MBEA 4UQEA 1QXLA 3CUIA 2YBRA 3LI0A 3QEQA 1ULVA 3D48R 5EBMA 2FUTA 1TWDA 4M6NH 4YDLC 1KV8A 3V16A 3ILEA 3EA3A 1JCYA 3IDIA 4BQCA 4DGIL 1NEUA 4AVHA 4X22A 4U1HA 4JRXD 1FO0A 4W9IC 3SR7A 5D7JA 4TMPA 2LAAA 1HOCB 3WLPA 3PUGA 3Q3GB 2PDYA 4PWEA 2YHGA 4PRPD 2J1YA 1CB7B 2BXVA 4ZQPA 2D03L 3D08A 2H3KA 5FF2A 1NIDA 4MHHI 5EFDA 5C07E 5LN8A 3TH2T 2Z8SA 2G5BA 1PDYA 3R94A 2QCLA 1J93A 4M6ML 1KXQA 3FUEA 2AL1A 4QCEA 2PU0A 5HHMB 4G70B 2ZQKA 5DDHA 2G8ZA 5MEQA 4H5SB 4G8AC 2YA1A 1FZKB 1MLCB 2ZTBA 3RZCC 1JDDA 5A6JA 1EP3A 3V0IA 1JI2A 1N4XH 1ZY9A 1NSJA 1C1EL 3MUCA 1ND0A 3F04A 1JUFA 5TD4A 1CLVA 2WLIA 5DT7A 2QDHA 1PZUB 5TDNB 3KHJA 2IF7A 4YHPA 4OD2A 3F2LA 5IB1B 4P8WA 3FULA 4F20A 1QEXA 1SDYA 4NAEA 4RV3A 3B9KA 2CBPA 2RHGA 3UG5A 1FGNL 3CVBA 3PSVA 3L08A 3SPJA 2HVBA 3A13A 3IMTA 3BOLA 1E28A 4JFTA 3WNNA 3RU8X 3NZPA 1EQWA 4MWAD 5LCVL 5REQB 3BPOC 4XNYH 2QVKA 3V4PA 3I4KA 4NKOA 3D3AA 2QKFA 3ATAA 3L9CA 2X0YA 5DVLA 3P9MB 3O7UA 3BLDA 4R88A 5DFVD 5CP3H 5CLZA 1IXOA 2YKLH 3UTZB 3WEXB 5D4HA 4OCLC 4QTFA 4P2RE 1FRBA 3WTXA 3VFLA 1T2JA 2PEVA 1UOZA 4H19A 1XP3A 3CVHA 4HFWB 1FFOA 4I8YA 3RKPA 2C18A 4Z0XA 3RKDC 3WQOA 5EGRA 2FE0A 3U6XA 4UTFA 1AXIB 4DJEC 1M9WA 5C0CB 3LZRA 4CC0A 4N1HB 1R2TA 4JNZA 1GPOL 1QRKA 3QR3A 2HS6A 2GT9A 4CDGC 3ABZA 2EILB 1CG9B 4PW9A 1SBBA 5IHUH 1QSED 4S1RH 2QQNL 4S1DC 3FQTB 1TSHA 3KBFA 3TUUA 2BSEA 1MRDH 2IAMB 4R6UA 1H4PA 3LZLA 4C4BA 2PTUA 4WO4B 1YEJH 4KGJA 5IDIA 3M0YA 4KVCL 3ZYIA 1KFBA 4P04A 1OPGH 1OP5K 3FJNA 4MNJA 4O5LH 2IUZA 3MCKB 5I3JA 5FFOA 3NIFE 3GC5A 3E1ZA 4XVOA 2UZIH 3WLMA 4FSAA 4PMVA 4QYOA 3JW7A 2R0KH 1MSPA 1CF1A 2AGJH 5KSAC 4NJGA 4D0DB 6PCYA 5FSDC 4R4FL 4KJWC 1CK0L 2D7OA 3QXDB 2E9GA 2LTQC 4UM9D 3FC8A 3WDJA 5AW6B 1VKXA 3ET9F 1YJDL 5C7XL 6FABL 3VFPB 2WAHA 4IJ3B 2CH8A 2CXEA 5D7IB 3I50H 4FR1A 3SPHA 3RJXA 2AVGA 3KP1A 5F71A 3U7WL 3B5GA 1F4WL 1XB6A 2QBWA 2DZBA 3RK8A 3SFKA 3AS1A 2Q8ZA 3L4TA 4C6PA 2HTKC 5IWLA 1QBAA 5LG6A 3ATDA 3AT8A 2H9GA 4RMQA 1X1ZA 4MXVE 4XCFL 2IGLA 3JT2A 4HA3A 3GBNL 1OW0A 1YEFL 3IPFA 4OFCA 4KY2A 4OF7A 1DJYA 4LQ1A 4ZEPA 2BVYA 1Q6CA 4XUYA 1TMQA 5JOPD 2B31A 1A22B 1XIWA 1RV6X 2AC0A 1YYML 3BUYB 1G4MA 3GEFA 1WFNA 5KN5B 5LBVA 1QZNA 4RPPA 1GTNA 2AS5M 4LCWD 3ERXA 3ARFB 3CZUB 4HV8A 1H15B 4DKFH 5GS0H 3K8KA 1LLOA 2DYPA 3BKJL 3VI3F 2QLYA 3FTYA 1DBJL 5JXEA 1NWSA 2VENA 3LHUA 2X44D 1QUMA 4N6RB 3N3MA 3FZUC 4BH8A 3DSNA 5D9SA 2DTMH 1JV5A 5EEWA 5BRZA 2NX1A 2QZ5A 4QIRA 4IIBA 1MI5B 2IGFL 3WFBH 2BOCA 4JPWL 1LG2A 1YE6A 2X12A 1HL4A 3ALFA 3DYPA 1GH7A 5LCVA 5K39A 1TMLA 3S3JA 4K15A 4ZBJA 3S0PA 4XN9A 4WIWA 3POCA 3MJ7B 5IIEB 3WKYA 4NJ9L 5KINA 1QLEH 1LK3L 4PEKA 1S5WA 3NQVA 3WS3B 5IHZA 1Q3NA 4G56A 5CCJA 3KPLA 4G7QB 4JM2C 4MAUH 3KP0A 1WFTA 1E5JA 3Q13A 5JH1A 2EXOA 4A2MA 3CDFA 1VYPX 4AENA 5HUPA 1E50A 5J1AA 3PZUA 3ZX1A 1OHLA 4FO4A 4HKBA 5G5DB 3GNNA 1PLGH 4K55A 1H8LA 1F1AA 3BP6B 5CJNA 3GFXA 3MV9E 1Z66A 1DLHA 3BW4A 3ITYA 4E41E 1M7IA 3NRQA 3B8SA 5L4FA 3GSOA 3V10A 3C3NA 1QSFA 4GAYA 3AMGA 4L1HA 4U1GB 4CNPA 5FM5O 4Y8DC 2AXGA 2HZGA 4URIA 4EF8A 3SE4C 2A3EA 4CVXA 4D9QD 4ONHA 4YHKH 3HZVA 1VYRA 2VQTA 3WSQL 2WLJA 4YSDA 1BZQK 4ANKA 4IOSD 3D85D 1HHJA 2B0MA 4I90A 4XGZA 4DVBA 1E6OL 4HZ7A 3Q8CA 4LAZA 4RAUA 2HLAA 4LNRB 2XPZA 4ZFFA 3EHBB 3IFLH 4F37K 3ITOA 3HNTH 2QHAA 5KVMC 5KYYB 4B5EA 1G01A 3DJRA 3TJPA 3SN4A 4H7CA 2DMCA 1F00I 4PRIA 2CU9A 1L9MA 3NACL 5MF5A 4K94C 4Q8BA 5SWSB 2X1QA 1LE5B 3BP4A 3CZNA 3PPGA 3LKSA 4B5NA 4ZNEE 2PCXA 3TWYA 3VFGH 1SVCP 1VADA 3KYNB 3TS8A 1XDMA 4NZUH 5EOCJ 4WI2A 1XS2A 3MMUA 1ORQB 3MO7A 1PW3A 4GIOA 5E8EA 2XZ7A 3B0PA 5SX4H 5DLCA 1RD5A 2VZ3A 2Q87A 1FNEB 4WOZA 4GBUA 1KRCC 3HR5B 3R13A 1A4AA 5KVEL 2FZ9A 3P74A 4GQGA 5MP6L 3VRJB 1B30A 2NNCA 3UGXA 4OFIA 2VL4A 5GRJH 5FAGA 1US2A 2WQAA 3HPJB 1HO4A 1OYCA 5AOZA 1TPEA 3WQVA 2RH9A 4QNEA 1GTFA 3QV9A 1F56A 2ATKA 4CGTA 3KM1A 5A6TC 1RP9A 2ZC1A 1R24A 2OYPA 2NYZA 4EKJA 2FIKA 2NR6D 3NN8A 5AAMA 2AEQL 3RHWF 3OR7B 1W54A 5SWZB 3HURA 3W83A 1Q6FA 2J12B 2ZUSA 2WSKA 1XRVA 2N56A 2WXGA 3VI4A 4MMWA 1EEZB 3OQRA 3R10A 2A3HA 1P48A 4REQB 4JKMA 4G42B 1SQMA 4QEHA 4CL7A 1UKOA 1LO2L 1W8GA 2RJHA 1Q0EA 4AC7C 4PS7A 2EXSA 4XNMA 5BROA 4RVBA 3K6FA 2A83B 4O4YH 1KNWA 1UIPA 4GA8A 4MMZC 3KPPB 3P6LA 2YDQA 4Q4SA 1SN2A 1B4KA 1W2PA 5IQ7H 4JCMA 3BZ4B 1UXSB 1EF2A 5DJ0B 1V7AA 1ZTXL 4B92A 3V4LA 4Y5YC 2FX8L 3AYRA 3BSZH 2ZUWA 5F9JB 3FH8A 2VDQL 3O6FD 1QI3A 3OAWA 4P8QA 3GBMH 3W0WE 3S9ZA 3RO6A 1GRWA 3WDRA 2OQJA 5H35B 1LO0H 4TULL 3NXFA 3RIFF 5EIIA 2Z24A 4ZSUA 1BQRA 1AGFB 3SOBH 1X5MA 2XN0A 1S3TC 1GVOA 4S3BA 3FUHA 2GVJA 4INFA 2FCBA 1AQHA 4PUKA 3W9DA 3DVNB 2R2EA 4AEFA 2P48B 4ZUWB 4QAMB 2F54E 2DT2A 4PRRA 3I6EA 4TPRH 1R3WA 4YIQA 3VWJB 2CKBA 1N59B 4AKOA 4AEIL 2A3CA 4KO6A 3O6LH 4H6EA 2EH8H 2JQZA 3EYPA 4LF2A 3HG1A 2EYTA 1VBUA 2HTLD 5ENWB 2PC4A 4QNPE 3UYPA 1WX0A 1GS6X 5BS0D 3P62A 3GMPB 1M7DA 3T4YA 1RZKC 3MUUA 5TAOA 1OQXA 2R23B 5FO8B 5DZLA 3F3HA 3AUJA 3R89A 4J3OC 3V0DA 4YIWA 3DOPA 3WK3A 5B3JF 3FHEA 3CBWA 1L9RA 4OBRA 3MBFA 2K1MA 1DJZA 2D73A 4WK0B 3R8HA 1V3MA 2Z31C 2B9BA 1A5BA 2ZCKH 2E56A 2DDXA 4UNLA 1POJA 2D2CC 3GMRA 5DO8A 4EN3D 4G7VH 1AZVA 1CD8A 4GIRA 2EG8A 3PL6C 1EFXB 3TH4T 3VOGA 1WRFA 2WN2A 4JIIX 4TU1A 1ZEAL 3AVEA 1S9XB 1K2DB 4GEJA 1OTSD 4XO4A 4PRDB 2C3XA 4RW3A 2FATH 4UBPC 5BYWA 3H4GA 1FV1B 4LB8A 2XVKA 1RBLA 5T33L 4UT7H 5D04C 3KBWA 4GOAA 3NR0A 1QTSA 2XFYA 4PVBA 3GSXA 4MB5A 4Y9FA 3QVQA 2XTJB 1WH0A 4I18B 3VXSD 4XC3H 3I65A 3AB0B 4ZRGA 4FNLH 3NDZE 1HUVA 3L4VA 1GOQA 4FOKA 4MLIA 4JGNA 1EPXA 1MLBA 1CDUA 5KWYC 4V1XA 1TWWA 6XIMA 5EIQA 4S0TD 2YXOA 4N6EA 1Q5MA 1FRGH 3FNDA 4L1GA 3ASNB 3N2CA 1KC7A 1YY9D 3R06B 5IBXC 5IMKB 4M4PA 4WNQB 3C87A 4MY9A 1V6UA 4I7VA 3CHVA 4XZWA 1ZJHA 1Q7ZA 2L7EA 1EIXA 3QJFB 3BG9A 2CHOA 1A49A 1TQXA 4X7SH 1CXLA 2IBBA 4DJFA 2B9AA 1M6JA 2KLSA 3KOZA 1IYXA 5ESQB 3I6GA 3E6FA 3HF3A 3RFZC 3T65B 5TPWH 3IN0A 2GJNA 5I8EB 4EWND 5ADPL 2WP3O 3K5SA 5DRIA 1OAXH 2C79A 2BP5M 5AW3B 4AEOA 4RE3A 3CZFA 5MENE 3ARBB 1OK8A 2OW7A 2X9XA 4C90A 3SCMC 2IBZY 2PTTB 5ABDE 8XIAA 2OSYA 2ZRYA 3EJTA 4LVAA 4ODUB 4MHHG 3SE3A 4KI1A 3LPFA 4HNCA 5AHFA 2EADA 1E70M 3AQDA 4RWYL 2X1SA 3CQIA 3GKWH 4P46D 3GY1A 1ZVSA 4GISA 3G6JE 4IFRA 2F08A 2K45A 2RA1A 3RX5A 2OODA 3MLZH 1IJ9A 4K5NA 1B4EA 2G30A 3GF8A 3MODL 3A5FA 3EO9H 2IANA 1LRNA 3PAUA 1SOQA 5AC5A 4K0OA 5F1KC 3MGOB 3ECUA 1OFDA 4ZXBB 3WUWG 1MN4A 4OQTL 4AM0A 2VC2L 1EXGA 2PLCA 4H40A 4WVRA 4F92B 3WNKA 5GGQH 1VHNA 1I3GL 2R6OA 2VN3A 4D0BB 4ZUUB 3TC7A 3UWZA 5A69A 3EO0B 4IX2A 4D8AA 1TTRA 5FF6B 1KCRH 4LSSL 1JVLA 4N0UE 3RNQA 3A4WA 4PU2A 4R5EA 5FYLE 2V9QA 4UMAA 2EG6A 3VFNA 2GWNA 1UUSA 3ESMA 2CBOA 5EU3A 3ETSA 1KCSL 4BA8A 4GP8B 5D2YA 4FA7B 1MSSA 2FL5B 1QD0A 4N0RA 3CPLA 1HJQA 1YG9A 1L9SA 2YCJA 2MCMA 5DMNA 3CXFA 4HEPG 1EJSC 1W91A 4QLKA 5D5MF 2QQNH 1ZALA 3AGVA 1UM6H 1DTUA 5I19L 4N86A 3ZBMA 1RZ8A 3VXRA 2VLJD 2VKZG 1T83A 4G5DA 3RZCA 2EQDA 3R0MA 5JNYB 3LHPL 4ML9A 1T40A 2X70B 5FOJA 4E4UA 4AV5A 4ABWA 5B3SB 4WGXA 4PGJA 2UWFA 2NXHA 4MZ1A 3D9AH 3MV11 5EUKA 1LEKA 1J88A 3R6IA 4JTEA 4PBWD 4MXQC 1F97A 3DG3A 2BNUA 5HGHA 1JXJA 3TXVA 1DN0A 4KRUA 4TSCL 3QHZH 4JQAA 5DSCA 3HNVH 1A6TA 4R4FH 4K2UH 4UDUB 3A22A 4ALDA 4PJBA 4D3CH 4TS6A 4Q7BA 4PCFA 3SYCA 1RH9A 5CBEA 3VCLB 2ZE3A 5DCEA 5JIPA 1T0PB 4RJEA 5AW2B 5T5FH 1NCCH 3N2TA 2OQLA 4NQDE 3M0ZA 1VBRA 3UBFA 4BFOA 4M61B 4JIHA 5T1MB 1Q0YL 3WF4A 5EZIL 1ROCA 3KCPA 4S1FA 3BCJA 3UR2A 3QEHB 4BE6A 4ANXA 4CADA 2W38A 2IXUA 5I6KA 5CM1A 3KM2A 2NY0D 1XLCA 1DQQA 5E9DB 2ZOLB 3BFOA 1AVAA 3BUDA 3CDGB 5B8CB 4TSAH 4J8QA 4NT6B 3EADA 4YSCA 1TA3B 5M1TA 5CO1A 2Z1XA 3GTHA 3GBNH 1GEQA 3QRFM 4ZQNA 4PREB 1EZVX 3AM8C 4U5KA 2OLAA 5GRXG 1HXKA 3FN3A 4YFDB 4IPNB 43CAB 4QRRA 2RD0A 4AUBA 2R83A 1YE4A 1PDKB 1FH2A 5CZJA 4WI0A 1W3NA 1YPXA 3EGDA 3IXTB 4PUJA 2GUOA 1OFPA 1U8QB 2DY2A 5FOBB 4AHQA 2KBGA 1DVFC 2F9BT 3NEOA 3PWLA 4RMSA 5IM7A 4MB3A 3TV8A 4Y9BA 2D31A 3PQYD 2NQJA 3Q2LA 4N7QA 4IKKA 4QRTA 3PNZA 3OKKB 4L6HA 1M5WA 2IGFH 1AGCA 3EB4A 5BU9A 4UI2A 4N24A 4BQ2A 4RX4A 2V9UA 4ENLA 4QXUL 3VFMB 3QULA 4LOCA 2OX5B 4JG5A 4KQNA 4OQTA 2K4WA 4F9PC 3CHOA 3MBEB 1ETJA 2YBRB 2VX5A 3QEQB 1YMMD 1G94A 2WOYA 3LCIA 4Z7NE 3RWGA 1XIMA 2BP1A 1VHPA 3IDIB 1YEEH 1FNAA 4ABVA 2XG5A 1EXPA 4M93C 2ITCA 4U1HB 1FO0B 3WKPA 4W70A 5D7JB 3WKMH 3L3KA 2NVAA 4NN6C 1O60A 5C9KA 3LGEA 4DPAX 5LYRA 3NIGB 5KZCD 4UNTA 3CU1A 5C0AE 4A29A 4P07A 2DKUA 4RZKA 1DANT 2G5BB 4ERSH