1SZNA

The structure of alpha-galactosidase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
417
structure length
417
Chain Sequence
IVMPDGVTGKVPSLGWNSWNAYHCDIDESKFLSAAELIVSSGLLDAGYNYVNIDDCWSMKDGRVDGHIAPNATRFPDGIDGLAKKVHALGLKLGIYSTAGTATCAGYPASLGYEDVDAADFADWGVDYLKYDNCNVPSDWQDEYVACNPDFVKTGPNGTCTTALDPTLAPPGYDWSTSKSAERFGAMRNALAKQSHEIVLSMCIWGQADVFSWGNSTGISWRMSDDISPNWGSVTRILNLNSFKLNSVDFWGHNDADMLEVGNGNLTAAETRTHFALWAAMKSPLLIGTDLAQLSQNNINLLKNKHLLAFNQDSVYGQPATPYKWGINPDWTFNVTYPAEFWAGPSSKGHLVLMVNTLDITATKEAKWNEIPGLSAGHYEVRDVWSDKDLGCLSSYKAAVAAHDTAVILVGKKCQRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of alpha-galactosidase from Trichoderma reesei and its complex with galactose: implications for catalytic mechanism.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords alpha-galactosidase
total genus 139
structure length 417
sequence length 417
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2004-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17801 Melibiase_C Alpha galactosidase C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1sznA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1sznA01
4W93A 3G24A 1TB3A 1H60A 4NNAA 1FCQA 3OVQA 2R94A 4ONVA 5IBXC 5A8GA 3W87A 5F4XA 4M56A 3DFOA 2B7PA 5KSWA 4UFJA 3BAYA 3GDRA 5HULA 1K03A 3BLFA 2TPSA 2D73A 4ZL1A 4ZMGA 2P10A 1OGSA 2VEMA 3K8KA 5A6LA 4FHAA 2QCHA 4QNWA 3R2GA 3QEZA 4CN6A 2DIEA 3ATZA 2ZRYA 4XTIA 2JKAA 1JJKA 4IMDA 3LTPA 4HNUA 3W7IA 1MW2A 1K8ZA 2E8YA 3P5ZA 2DORA 5BRBA 3NM3A 4O0ZA 4TU1A 1IZKA 1W8SA 5DO8A 5K4XA 2V8ZA 2F1BA 5KTLA 2KZHA 1NAL1 3HZ3A 2OSWA 4UQAA 2NX3A 1V3MA 1OG0A 3B0VC 3LCLA 3KWXA 4AHPA 4N2YA 3SGUA 3GR7A 3OG3A 5DY2A 2GVJA 3C2EA 3LXAA 3YPIA 3LOTA 4UTTC 1TREA 2QV4A 1X1OA 5DLCA 1TCDA 2QCMA 3UWWA 1Q6QA 3PBWA 1MFVA 2XN1A 1UH2A 4IX2A 3M07A 1QDSA 3KXQA 3UPBA 1OFEA 1DBTA 4GE8A 2EABA 3L4VA 4IPJA 4O19A 4WUIA 1UD5A 3GXNA 4LS0A 1KM1A 4GFSA 2GQAA 1NVMA 3HGOA 1H3GA 1SMAA 3W37A 3LHYA 4UNIA 3QMSA 1BVNP 4AEFA 3P8JA 3HIJA 5CXPA 4CCDA 2C14A 5U7SA 3BVVA 1YDNA 4UCGA 4K6AA 1UASA 5TIMA 3QGVA 4Z1DA 1LRTA 2ZDRA 2Y4SA 1JCXA 4LV4A 3O07A 1UB3A 1H7OA 2ISVA 4KFNA 4B9ZA 1TPWA 3KL0A 5G1YA 3VM5A 4EIVA 1G9HA 5KZMA 2BXVA 1MZHA 3VX1A 2I14A 1PIFA 1H7NA 1KGUA 2CPUA 1VS1A 3M9YA 3FAXA 5AOUA 2DZVA 3NR0A 3WEOA 4FNSA 4R33A 1WZAA 3EWZA 3TC6A 4J28A 3ZT7A 4O15A 1UA7A 2ZXDA 3ZFHA 3AMKA 3DFSA 4ICNA 3S1XA 4RX0A 5AHFA 3PR2A 1OB0A 2OX1A 2F7QA 4C1LA 1YXDA 2FH6A 3I7SA 1W5OA 2OYKA 2YR1A 2Y61A 3LV6A 1QAPA 3HPXA 3D0CA 2OCZA 1RPXA 4LVGA 4X2RA 4UTWA 4GJ1A 2Z1KA 5KINA 4JFWA 5BRPA 4A29A 4WY0B 2YYTA 4FX6M 1SW7A 3BPWA 1YLVA 2DH3A 4RK8A 3NQ7A 1JDDA 4FNRA 3N19B 3EDDA 4N9EA 3WDHA 1XL9A 5LNSA 3EX1A 3VGBA 1DHKA 2VXNA 3CIWA 3GVGA 1JRBA 3TCEA 3R89A 4UQEA 2EJ1A 3LCGA 4FO4A 3SFKA 5H91A 3BV4A 2BY0A 4NZJA 2QJIA 3TOPA 4LW7A 2I1OA 4BFAA 1JUBA 2TSYA 4UQDA 2GVLA 1OFBA 4LVBA 4NJJA 1TRIA 1OABA 5CSRA 4NNCA 1DQXA 1MVYA 4H8UA 5E9AA 4DF1A 2TAAA 2WNNA 2YPIA 4LRTA 4NJGA 4I7VA 4N02A 1JI1A 5DFAA 5AYXA 3OLDA 3W76A 3IIVA 3ZWTA 1O5XA 4XKYB 5E0KA 1HG3A 3EJTA 3BW3A 2XIBA 4K8EA 3BLBA 1J0JA 1SO5A 1LROA 3LPPA 2VFFA 3PY2A 5DELA 1WOBA 3K1DA 1AG1O 3DBPA 3W7QA 1TJRA 1CX9A 2CLMA 1Q6OA 5GVJA 5AN7A 5HMSA 3T4CA 1QMLA 1XUZA 5BW6A 3GZ3A 4IJBA 1KFBA 1DKWA 3QYQA 2YIHA 4EOUA 1J2WA 5HINA 1LLZA 2FGZA 6ALDA 4U33A 1G4TA 3CLMA 4NJIA 3UEQA 2HTMA 3IIPA 3K30A 4K38A 1U5JA 1J0HA 3TFXA 2BLEA 3T55A 1B9BA 3DH7A 2H8ZA 2V30A 1XCXA 2FDSA 1TTQA 3WELA 2QCDB 3DAQA 3UY8A 4ADUA 3HOJA 1HVXA 3HG2A 3BARA 4O54A 3W72A 3DZ1A 2ZZ6A 4JTTA 1OFPA 2CLLA 1EPXA 4Z1BA 5AHIA 5I3FA 4E38A 1EUAA 1XI3A 3W70A 4O50A 5A2AA 5F7UA 5I0DA 2E8ZA 1J4EA 4GO8A 4JX4A 3UXDA 3GAKA 1A5BA 3LGEA 2X16A 3TR2A 1KXHA 2VFHA 3GIYA 2VEIA 2ZYFA 2GJLA 2YA1A 1MEHA 5C5YA 1JCMP 4OWGA 2YA0A 1OFAA 3LRLA 1BSIA 4XBSA 4WY0A 3UQNA 1PS9A 4D2JA 1G1YA 3N73A 2NXIA 4BI5A 3CZSA 4HOWA 1QOPA 1TPDA 3N3MA 1J0KA 1CXKA 2EAWA 3EJRA 1HO1A 3HG3A 5LNRA 2DZPA 3NZRA 2OZ0A 3UYCA 1GVOA 1LOQA 5I3JA 2XWEA 4ZQMA 3E96A 4QJ1A 5E6YA 2ZZ7A 4NX5A 1UD3A 1LDCA 1TPUA 3I6RA 2XN2A 1SW3A 4AB4A 4OGZA 1FDZA 4LUIA 3NG3A 4GI9A 3W1AA 3EJPA 1AK5A 1IXOA 4JTEA 4QIUA 4P61A 5EMYA 2TYSA 2QF7A 1EA0A 4MZYA 1TTJA 7CGTA 4XKYA 3NQ2A 4FLQA 3DFPA 3W2UA 4J3VA 3L0KA 3BSGA 4IMFA 2Y63A 4O0KA 1UKTA 4PODA 1QI3A 4QAIA 3LCXA 3QW3A 3UY7A 3DFNA 3GKAA 1Q6LA 4AF0A 4QNEA 2ZBTA 1XH0A 2Y7GA 2P0OA 3I65A 4UTWC 3P67A 4PA8A 4AH7A 3L66A 3ABOA 3W2NA 2E5CA 3VGDA 4O1AA 3IRDA 2VKZG 5C55A 2YXGA 1O7DC 3O15A 1C29A 3L0GA 4O10A 2WNWA 2YW4A 3L5MA 1SR9A 2EPHA 3ZR4A 3GBDA 5MHBA 1L2UA 1KV5A 1K7EA 1RPKA 2CLOA 4JCLA 3WDIA 1LCOA 4LT9A 4AMWA 1GYLA 1OX4B 3WNOA 5E70A 1LRQA 1CXEA 1D3CA 4GC4A 2Y6ZA 2EO7A 2ABBA 3L5AA 3OLIA 3MP3A 3QSTA 1YADA 2WNQA 1K7XA 3KRUA 1Q4NX 1H63A 3WNLA 5I3IA 1ADOA 4UTJA 1THFD 2HS8A 4XQ6A 1CGYA 5K9CA 1JRCA 1LRNA 4K37A 1KA9F 3PSWA 1H7XA 4ZZ9A 3WJWA 4BI7A 2QUTA 3W1NA 1CGUA 1TMHA 3KAOA 1AL7A 3NGJA 1KM3A 2FHBA 2WSRA 4WSKA 4DO5A 4MB1A 3DKLA 4FLOA 2ZXAA 4KWUA 2X1TA 4I7WA 4UQ9A 6TIMA 4AMXA 1QI5A 1W1ZA 1ME8A 5F4SA 3C8FA 3NQMA 2E6AA 2G97A 4HHPA 3W7DA 4A21A 1TQJA 5G2IA 1F2JA 2WSYA 3HGRA 3T78A 2Y62A 2PC4A 3MW7A 3UWYA 1FBAA 1I2QA 4HT3A 3UCQA 5F2IA 3CZGA 3LRKA 3L5LA 1EA9C 3B4UA 3DX4A 3BAIA 4YXGA 5F2MA 4N4QA 1TTPA 2RH9A 2GJPA 4BA0A 1YTEA 1ML1A 1VLIA 2QPSA 2V5BA 5G2HA 5C54A 4ZQOA 2R91A 1OT1A 3DX2A 1GVFA 3G0XA 5FEXA 2J24A 2D3NA 2NT0A 3LXBA 4I9AA 4WJEA 3W2LA 5E1QA 3TQKA 1IXQA 4LC8A 4TMBA 3T7VA 3L4TA 2ZA3A 1JFHA 2V2HA 2WKLA 1KFCA 1OSEA 3GDLA 1NF0A 1U33A 2CZFA 2V2CA 1XH1A 1EH9A 1CXFA 4LWWA 4LU0A 4Y6GA 1W3TA 3W75A 3DHFA 4NI3A 3D52A 2VT0A 2YA2A 1E51A 2NXHA 4UFIA 1I2RA 1FUYA 1WBHA 4FXSA 5FI8A 3G0SA 4JN6A 5IM51 3P61A 3TIMA 1KTBA 4MY1A 2OSXA 1KBKA 2B7QA 4JYDA 1WV2A 4QM1A 4YLWA 3DFQA 4WOQA 1OHLA 4PFMA 5EL1A 1KLZA 5CPOA 4RZ6A 3PB0A 4FLRA 2A5HA 1QOQA 3CEPA 2J6XA 1DORA 2ZQ0A 2CFFA 5LHFA 3IVTA 1WYIA 1AQHA 2AAMA 3D4YA 1QPQA 1JGIA 1OFDA 5DXXA 3EXSA 4AXKA 2DP3A 5KEZA 1KTNA 2VEKA 1YPFA 1R2SA 3SR7A 1JR1A 4O4WA 1V3JA 3PC0A 4Z08A 5LHEA 1FWTA 5T26A 2G95A 1QPKA 4GI8A 1VCGA 2WVVA 2BXYA 1OYAA 3O6DA 1HFBA 3BUQA 4LV9A 3W73A 2CHNA 4UTKA 4IXXA 3TSDA 1W5MA 3PBYA 1UD8A 1ZAJA 3VMOA 1JAEA 3WNMA 3HBLA 1OJXA 3E49A 2ZZ5A 3KEHA 3TA6A 1QPRA 4ZVJA 3WNNA 1L0PA 1XDLA 3NPXA 3PUDA 2ZXQA 1KFJA 2ZRXA 2QKFA 1TTIA 1IIGA 3QW4B 5LKYA 4UR8A 3NQVA 3PULA 2BWGA 3KL3A 3NQDA 4XZ9A 2Y24A 4MFDA 3KRZA 3GNNA 1V3KA 2OW7A 1CIUA 1OYCA 3ZO9A 2FIQA 2F7RA 2OT1A 5EBUA 1EP1A 3FA5A 3EX4A 3MUXA 2GUYA 3WNKA 3KVKA 5TQLA 2A2IA 1FY6A 5AB3A 3RLUA 3TROA 3IVUA 3BCDA 4WY0F 3TTSA 1VHNA 3BLIA 2QCLA 1GVRA 3BO9A 1SO4A 1HXKA 3OVPA 4IOTA 2ZXBA 4IQLA 5BMXA 1P5BA 3PBUA 3UXAA 4PCFA 1KXTA 2RDWA 1N7KA 4U31A 7TAAA 4N6EA 5CKSA 2C1HA 3TC7A 3GXIA 3BUIA 3B0PA 4S2CA 2QCNA 1H1ZA 1S5VA 5AFDA 3BUPA 1C8QA 2NT1A 3UWZA 3A6OA 3DI0A 5I23A 3MHFA 3NNTA 5I3KA 1QWUA 4JYFA 1TPH1 2AMGA 1BAGA 2WSPA 3QJAA 4G1KA 1QCWA 1ZENA 4O4VA 3TK7A 3BUDA 1VYRA 3PG9A 1EWDA 1TPVA 2NX9A 3CHVA 4O1CA 2NZLA 4IMCA 3IJ8A 1R34A 4O1DA 3P7YA 3KX6A 1HNYA 2ZX8A 4LS1A 3OBKA 2EHHA 1MW1A 5KZEA 4GO9A 4Y8FA 3LTSA 4J27A 4N9CA 4L4LA 3FKKA 4AWTA 3Q37A 3NQ6A 2BZNA 2A21A 2YX0A 4UZUA 1WDWA 4FB7A 2VFEA 4AF0B 3F4NA 1MSSA 1TPC1 3OHIA 2V0TA 2WOQA 1ICSA 2X1UA 5CZJA 4MZ8A 2EACA 2VFGA 1PE1A 3C52A 4LVFA 2X2HA 1T0OA 3O06A 3FEMA 4E0CA 4BZYA 5CPMA 1GCYA 1DQWA 3LI1A 4CCEA 1G7VA 2ISWA 1K3UA 3B03A 4R7JA 4OJYA 1XFBA 4HOXA 2CZEA 3W7PA 4J3WA 3WY1A 2J9YA 3NXFA 3D50A 3OIXA 3FJ6A 1WPCA 4TR9A 1C9DA 5D30A 3IVSA 2NV2A 5K9DA 1KXVA 3LRMA 1QWGA 3LTYA 2FQIA 4RZ4A 2GOUA 1B4EA 1GQNA 1OX4A 3EJUA 1VLWA 2YGYA 1XCFA 1TV8A 1R46A 1XBXA 4WSJA 2WVTA 3NAVA 5AYYA 1FCVA 3DKJA 4AHOA 1VRDA 3CZKA 4MYAA 4Y9AA 3VGEA 3THQA 4MYXA 4DBEA 2G96A 3CQ0A 4Z1AA 1TRDA 3RU6A 3EJQA 2QDGA 1LBFA 3Q2DA 3AXHA 4OBTA 1WO2A 4ORMA 1MEWA 3CLWA 2ALDA 2ZX9A 4IPIA 3VCRA 3MP5A 3NOEA 2YJQA 4BK9A 4QAWA 1EX5A 4DF0A 3HJEA 4GUJA 2ZIDA 1TCMA 1L6SA 1T96A 2XFWA 3BAWA 4MFEA 3BVTA 2PURA 3W7NA 1CXIA 4HNNA 3W7GA 3QQ1A 4JD4A 2ZRUA 1P1XA 4IXHA 1C8VA 1GG0A 4ATWA 1XSKA 4JFVA 3MHUA 3MO7A 3C4UA 3SECA 4DQWA 3QQ0A 4UQBA 3WK0A 5TBOA 2RDTA 4RJEA 3TXVA 3DHDA 2ZZ4A 1GJWA 1IF2A 3CT7A 3TKFA 3G1FA 2TMDA 4A2RA 1VB9A 3BVUA 4FNQA 1X7FA 1HX0A 2WKJA 1BF2A 1W5QA 2VEPA 2F1AA 3ZSTA 3OA3A 4PH6A 3VI2A 4PEEA 3ZSSA 4RKAA 1WE5A 4O53A 1BG9A 3VGHA 3WEMA 1N8FA 5I3GA 4GKLA 1EWEA 1H62A 4GUHA 2H8XA 1Q45A 3WY4A 1M7PA 3AJXA 5LGZA 4UC5A 5AYZA 2YSWA 4CN1A 2CZDA 2FPTA 3STGA 1R2TA 1FDYA 3L0NA 1DV7A 4PSPA 3LCIA 5F2GA 1HTIA 1LM1A 1G6CA 4M6VA 2CLKA 1XUUA 1CDGA 2EKCA 4YWIA 1ICPA 3FLUA 1I2OA 4TVUA 4JX5A 1CGXA 4CCCA 2JBMA 1VFUA 2CZ5A 3ZT5A 3TUUA 1FXPA 3JRKA 4DF2A 4DPPA 4P2VA 2PWHA 5CLTA 4HOZA 1PZ3A 1VFOA 2FPVA 1GTHA 4JTGA 3G3DA 4MOZA 1OX5A 3VX0A 4MLRA 1AQMA 1H7PA 4UTIA 3W86A 1VZWA 3PF3A 3N9SA 1I4NA 1VQTA 1YXCA 5K7JA 3CZNA 2B4GA 2CWNA 3QSRA 2CLIA 1M53A 3VSTA 1KFKA 2DZTA 2ALWA 3G22A 4M6PA 3TV8A 1BKSA 4HA1A 1SMDA 2H3DA 3D51A 3TQVA 1P0NA 1LZOA 3S8HA 1XD0A 2BTMA 2NSXA 4JDBA 1IZJA 2ZUUA 1SW0A 3HJZA 4KFPA 3BK0A 4JCMA 2FJKA 4UXDA 3WFAA 1HL8A 1W3IA 3L68A 1FWRA 3QC3A 2DJXA 2OYMA 3N9RA 4FIQA 3DX3A 4UOZA 4GUGA 3TAKA 1LTDA 1ZCOA 3GXFA 4GXMA 3TJLA 5FF4A 1ZJAA 1JD9A 2XN0A 3BG3A 1F05A 3C2VA 4H4IA 3RILA 4AWUA 4HSNA 2E1DA 1JXKA 1RV8A 3KE0A 3BAJA 3G1SA 5CGMA 3LCHA 3OLGA 5D32A 3WY3A 4O14A 1JQXA 3CM4A 4N9BA 3FW6A 4YMZA 3M0ZA 5D05A 2QDHA 1JVNA 3ANYA 3TX9A 2BHUA 4POCA 1VCVA 1XDMA 4AIEA 4ORIA 2VELA 3EDJA 4CQAA 3LDVA 5HWJA 1G69A 4XUGA 4UTHA 1D9EA 4GQRA 2E5DA 3TFCA 1UUOA 4LVAA 2Y88A 4MY9A 3M6YA 4MPQA 4CNOA 2VOMA 1H7RA 1XKYA 4JTFA 1LYXA 1B0IA 5HR6A 1SU5A 1H5YA 4LNYA 1G5AA 3ELFA 2FFCA 3W1LA 1LBLA 4QITA 3LLDA 4GINA 5HWMA 2WJZA 3G1VA 4YCOA 2WNZA 2H3BA 1ZAHA 4NT0A 3CWNA 5F1VA 5BRQA 1W37A 1QPOA 4AEOA 3FIGA 1W5PA 3PB2A 4IX0A 2BY3A 1FX6A 3E9AA 2Q3RA 3HMJG 3W38A 3GDTA 3IEBA 3GX9A 2XVGA 3UG4A 5BNKA 1GJUA 1NSJA 4N4PA 4PTNA 2C16A 4Q32A 4ZQPA 1KM5A 3NDOA 2Y7FA 3MI3A 3PSVA 3W84A 1JXJA 1TMQA 2OSYA 2X2JA 1EEPA 3W7OA 2QCGA 4DBDA 1G4PA 2W6RA 4FNPA 2W79A 1MWOA 4Y90A 4JYEA 1I75A 3UWQA 2A6LA 1ZALA 2NX1A 4EWND 3LCWA 1DHPA 3ABQA 2A7NA 2FHCA 3GTNA 1UKQA 4M19A 1ZNNA 3TH6A 3M16A 1AMYA 3M5YA 4QISA 1XM3A 5CZ0A 1K7FA 1JQVA 3W1UA 3P81A 1E40A 5D33A 2JK2A 1LWHA 1H51A 1I2NA 2NUWA 4CQ8A 5CGTA 1QNVA 3S2CA 1GZGA 3EDEA 2AAAA 3DHPA 4O17A 1CPUA 1FWSA 1NF7A 2ZX7A 1KCLA 2GQ8A 3W1TA 3W74A 2WO5A 3W7CA 3PVFA 2Y89A 3PG8A 4OKDA 1JCYA 4CVWA 2QCFA 3DXIA 3LCFA 1O60A 4UMAA 1HO4A 4Z0SA 3KOFA 3STCA 5I24A 1PV8A 1VIWA 4LTSA 2D2OA 1TQXA 5IBXA 2E4TA 3I7RA 3VSVA 4JY8A 1TQUA 3MBDA 1A5SA 1W56A 4AEEA 2EEXA 4AW7A 4UFKA 1KM0A 4O12A 1WQ5A 3H54A 6CGTA 3L65A 4OE7A 4XWUA 5EY5A 3F4WA 1KB3A 5K4ZA 1IXNA 1CGVA 1XSJA 1AMKA 3A5FA 3P8IA 3W71A 1ICQA 4J3TA 2DZWA 1KFLA 1TJPA 3BC9A 1R2RA 3M47A 3LI0A 4FIRA 5BMWA 2F7FA 3UNDA 1GVSA 1OFRA 1PIGA 4O11A 4O57A 3DDGA 3S1WA 1RP8A 2XVKA 3AO0A 4AHQA 2DZSA 3WDJA 1M5WA 2Q8LA 3MJYA 2ZRWA 4UCFA 3W1XA 3ECQA 4S1FA 1VYPX 2QCCA 2VFIA 4KWVA 3BW2A 5HQEA 3IJ9A 1G94A 2FHFA 4JTSA 4UTTA 3C61A 2A1YA 1GOXA 5E6ZA 1I2PA 2VNCA 1B3OA 3G18A 1A5CA 1TQVA 2WCGA 4HPJA 1RQBA 2V2DA 4JFUA 1CLVA 2QPUA 1B4KA 3O1NA 3NA8A 2ZWYA 4J3UA 4K8HA 2FH8A 1TPFA 3VKJA 5CSSA 2GUUA 3M5XA 4RXGA 2QMJA 4J3SA 1KBIA 4ADSA 3L21A 2R14A 2PWEA 3EKLA 3RNDA 3NQAA 3QFEA 5D2WA 5K2ZA 4Z0JA 2VRQA 4K36A 4JX6A 1KM4A 3E02A 4K39A 1GG1A 3LXCA 1ZJIA 3AJ7A 5C6MA 4BF9A 3EX6A 1OK4A 1YPIA 5DCEA 3W1MA 1M7XA 1BLIA 2D0HA 5BOOA 2V9DA 4M8UA 4CLMA 1Q6RA 2C6QA 1MXGA 3VU2A 4GNJA 3G8EA 1KWGA 4WX2A 2Z1BA 3U6WA 3ZR6A 2PRLA 3LV5A 5L6UA 3MI6A 3LHZA 3E0IA 1A47A 4O16A 1HL9A 3HG4A 1UOKA 1PCKA 3NQGA 1G7UA 3SGZA 1L9WA 3LBMA 4JY9A 3B0UX 3W7JA 2PWFA 5J5RA 1A5AA 3CTLA 3D4ZA 4RLIA 4MIMA 3GB6A 2O7SA 1K02A 5LNWA 2PE4A 3USBA 3DENA 1KW1A 5FF3A 1PAMA 1TQWA 3WJZA 3C3NA 1UD6A 3EX2A 3NM1A 3O05A 4H7VA 3WMSA 3WK1A 5U4NA 1MW3A 3FKRA 3W7KA 5C2XA 3QPZA 4LS2A 2RDUA 3WJXA 1PCWA 1FCBA 3L2IA 4NJHA 4O18A 3ZS4A 4JR5A 3HPZA 1XBVA 1S3HA 1VYSX 2ZWZA 1KWKA 1A50A 1I8JA 4FX7A 1SPQA 1VHCA 5AHMA 3T44A 2G5WA 1UKSA 2HMCA 1KM2A 2CXGA 3B8DA 3UD6A 1JCLA 4J9JA 1MFUA 3STEA 4O1BA 3W2JA 4QSHA 4L4MA 3G1HA 3K8MA 1EB3A 5TD4A 3S0CA 2E0PA 1TYGA 1YDVA 2Z0IA 4MUZA 1HT6A 2E09A 1NFBA 3UERA 4UTUA 4UFHA 4JTLA 3NYZA 3P62A 3P74A 2E5BA 3O6CA 4XB3A 1OFQA 4U2YA 3N34A 1UH4A 2GQ9A 2QLYA 1WOAA 2J25A 3A5VA 5DBTA 3T40A 2ZTKA 4JICA 2FYVA 1M7OA 1EHAA 5J5DA 3LERA 4LQ1A 2ATMA 3L4WA 4A3UA 2OJPA 5D03A 5F4WA 5D38A 3N14A 4K7VA 4DXVA 3NQEA 5LNUA 1OVDA 3W3OA 3GYEA 3P84A 4H8VA 1GEQA 1BTMA 1YXYA 1YTKA 1WZKA 1NEYA 3IIZA 3L2MA 2D0GA 4IMGA 1PZ2A 1QO2A 3STFA 3FS2A 2C19A 2X1SA 4UFLA 1AW1A 1W54A 2C15A 5EPDA 2NLIA 3IV3A 3W9ZA 2YYUA 4X9SA 5CPLA 3TAOA 3VE9A 3KFTA 5DY3A 1JG9A 4A2SA 3VMNA 2H90A 3W1QA 3M43A 3FFSA 3Q94A 1PL9A 1PHQA 4BR1A 2ZRZA 5KITA 3W22A 5K9XA 1IGSA 3GLCA 4CNPA 4IWWA 1KTCA 1OFOA 2E68A 2XVLA 4OV9A 5AC7A 1V7YA 1PIIA 5KMYA 5H2ZA 3W1PA 1WAUA 3M5VA 2RFGA 1VJSA 4LVDA 2WVUA 2E6YA 2VENA 3IIXA 4HPXA 3TNOA 3GAYA 3VM7A 1FQ0A 2WVSA 4YL2A 2F7OA 3SIZA 1EO7A 4X22A 1WZLA 3MBFA 1M6JA 1N55A 5HNRA 3PM6A 4JIPA 2YW3A 1S5WA 1HTYA 9CGTA 1JCJA 1AW5A 3WY2A 1S5TA 2ZUVA 3TW6A 8CGTA 4WF7A 5D02A 3EWBX 3GXPA 4KKXA 2ZZ1A 3GBEA 1U2YA 3UG5A 1ONRA 3G1XA 3U8GA 1MXDA 1ZAIA 3MI2A 1V3LA 3W85A 3WN6A 1T99A 1IV8A 3C6CA 3F1QA 1KFEA 1GVQA 1W9XA 2GVYA 3M5ZA 3W7HA 1CGTA 2ISSA 3PBVA 3EWYA 1OK6A 2C7FA 1WP6A 1JF5A 4JGDA 4BI6A 5SWUA 2FPYA 2BY2A 4HNVA 4XTDA 3W7EA 4UMBA 4UNKA 2FLIA 1LOLA 4TX9A 2GVGA 3ABRA 2A4AA 3BH4A 2X2IA 1UJPA 3W7MA 2WCSA 3EWXA 3G1DA 5DXYA 1XH2A 4H2CA 4LXFA 1JI2A 1OT2A 4UUIA 1DTUA 4WQ6A 1VAHA 2ZX5A 2CLHA 2J9XA 4FEZA 3JS3A 3CTTA 3TTYA 3IJ7A 3O6YX 5EYWA 2DH2A 4GBUA 4LC6A 3R5EA 1SFLA 2C13A 4ZQRA 1TQTA 1F76A 5K3VA 1OX6A 4RCXA 4PSRA 3W7LA 2J9ZA 2E77A 3BVXA 4PCSA 1QO5A 3KL5A 3VGFA 1QPNA 2YFNA 3LBCA 2Z6IA 3CZEA 1ZFJA 2F61A 2ZX6A 4HPHA 1OYBA 3HO8A 3LHWA 1H1YA 2IQTA 2YCEA 3EXTA 4WOZA 1CYGA 3KVJA 5HWNA 2EQDA 1T8XA 1QR7A 4DO6A 3EXRA 4FXRA 6TAAA 5DN1A 1J0IA 2VRKA 1K8YA 1X8FA 2XIIA 4JFSA 2R8WA 3EKZA 3BLKA 2ZUWA 4JXCA 4GRSA 4CKQA 4IMEA 1ZJBA 4TIMA 2V3EA 1PEZA 3I68A 5D2YA 1PVNA 4DO4A 1RD5A 4J7RA 2CU0A 3C0JA 3P80A 3W88A 8TIMA 1MXSA 3W23A 3GXMA 1YDOA 3ZT6A 2YDAA 4JS3A 1VH7A 2AQWA 3DGRA 4O52A 4MJZA 4HN4A 1Z44A 2WVVB 2Q8ZA 5FF2A 2XWDA 2X30A 2E6DA 2PRMA 4X9YA 4H3DA 4FMVA 3B06A 1FCUA 2PCQA 1X1ZA 1O5KA 3S1UA 3E12A 3TSBA 5F1UA 3QRHA 3S9YA 1D3GA 2X1RA 3BLEA 2VR5A 5HUPA 3VE7A 2ZA1A 4LPCA 2GPTA 3OVRA 1H7WA 3KHJA 4MJMA 1TPEA 1XD1A 1AL8A 2FTPA 3ABSA 3A24A 4W9TA 1UBSA 2QR6A 3MYPA 3UZJA 2CLEA 1UA3A 1ZY9A 3M44A 1HL2A 3WK2A 4ZQCA 1RZMA 2C0AA 3L4YA 3V75A 2RHGA 5F2LA 3MYOA 5CG7A 4LOCA 5E93A 4PC8A 3L67A 3BAXA 4A22A 1EUNA 4UOQA 3R13A 5D37A 1RVGA 2E6FA 4AYGA 3A9IA 5D2TA 5FESA 3VNYA 4JL1A 4E2OA 1GPWA 1MO0A 1XSIA 5AHEA 2NXGA 3PWAA 5CLWA 1KV8A 2A6NA 4XBKA 5FEWA 2FE0A 3GXDA 3CWOX 3GNDA 2Y5EA 4Q33A 2WV8A 4CNNA 1SO6A 4S2BA 2F18A 3B04A 3EX3A 2QJHA 1SZEA 1J5TA 1KM6A 1RQEA 4UFMA 1UD2A 3W7RA 3HG5A 1WBJA 3MHGA 3NPWA 2CLFA 3TE9A 1LORA 3KLLA 3TMLA 4HSOA 1GT8A 3RMJA 5DCDA 4M5PA 3WK3A 1ME9A 2ZTJA 1XBZA 4NXSA 3EEGA 3WFZA 3M7WA 2F2HA 3G1AA 4U28A 3JR2A 3L2LA 2JKPA 5HUOA 3EB2A 3LLFA 3UZ5A 3NPVA 2WSKA 2A0NA 3W2MA 4HIBA 2BSLA 4UR7A 3PS7A 4B9YA 1Q3NA 1TO3A 3QPYA 1Z48A 2Z2UA 4QQ3A 1KGWA 3VSUA 2ZFAA 3SZ8A 3MMTA 3FAWA 4KWWA 3LPOA 1TV5A 1P4CA 2Y85A 4JDYA 4CN4A 2EF9A 3NL3A 1LP6A 3TQ0A 3UWUA 3BGGA 1XGZA 2J27A 3CPRA 1FXQA 2H6RA 1SUXA 3B05A 1EP3A 1PPIA 1E3ZA 3CV5A 4AMAA 3A22A 2Q3OA 1UUMA 1KGXA 1Z41A 3H55A 1P0KA 1S46A 4X3ZA 3VNDA 4TO8A 4MVAA 1BWLA 3ZQ9A 4B5NA 1Z32X 1UH3A 4RZ5A 2NUYA 4OIFA 3W6YA 1H61A 4FLSA 3UG3A 2YOCA 1FWWA 3LHVA 3NL5A 3QM3A 3OLEA 2QUUA 1LWJA 1GWJA 3QMTA 3S6DA 1F7BA 1QW8A 1OF8A 1KLYA 2LLEA 1K8XA 2G3NA 2X2GA 1AW2A 5A2BA 4MZ1A 1DL3A 3CB8A 2YZRA 3QZEA 4GQQA 3CU2A 4NU7A 1DOSA 1L6YA 4WZHA 2DZUA 4X0NA 4AVFA 1E3XA 3DX0A 3SJ3A 2DZXA 1EO5A 4N6FA 3CZLA 3WJYA 4DEFA 3FYOA 2QCDA 3DDFA 4LY8A 5HPOA 1F5ZA 5L9FA 4U3CA 3SW6A 2F84A 5FEZA 2ZA2A 3GDMA 5I5RA 4U4MA 3CC1A 4OHQA 2YFOA 2WPGA 3DX1A 2W0UA 5G1TA 1KXQA 1QWNA 4NX0A 3BW4A 3GR8A 4JNMA 3AXIA 1KBJA 2JKEA 4AWSA 3S5ZA 1R75A 3WNPA 1ALDA 1W3NA 1QHPA 2QCEA 3HF3A 2V5LA 1IIHA 2HSAA 1QX1A 3UWVA 3BMVA 4PCTA 3W1RA 3NQ8A 3BG9A 3G0UA 3KRSA 4JTJA 3L4ZA 3FJLA 5AC6A 5D2XA 1ZHAA 3RFAA 2TRSA 3W2KA 4IUOA 3IGUA 4PL2A 1IXPA 4ZQNA 4M7SA 3O63A 1L6WA 3TJXA 4O28A 3N2MA 3R8RA 1VJIA 4PEKA 1XCWA 4EVZA 1SZFA 2NV1A 2OMAA 4NVTA 2WANA 5E0FA 1GJPA 4UQCA 3SSJA 5FF0A 5A5WA 3L9CA 1RP9A 4BWLC 2B0MA 4BWLA 3BGJA 1MW0A 4GIAA 1YTDA 3SY5A 1JF6A 3S1VA 1PS3A 2ZUSA 1KBBA 2GJNA 1W0MA 4GWEA 1F6KA 2AGKA 2EGZA 3R12A 1KCKA 2QEZA 1VC4A 3P82A 5AHLA 1R30A 2DJLA 4NUWA 2BXZA 1G67A 3EDKA 3LHUA 4FF7A 1TIMA 3MWAA 2ABAA 3S5NA 3BVJA 3BUBA 3Q58A 3QF0A 3VMPA 1JDAA 3TU9A 4KMQA 4OT7A 4N9DA 3S42A 3PAJA 3DI1A 2ZZ2A 5G5IA 2HS6A 3O8AA 4FX8A 1DJNA 4M7TA 1X6UA 3I7QA 5FF7A 3IIOA 5LNVA 3OEXA 1JIBA 3A4AA 1VFMA 5EA9A 3IK2A 5A6MA 4O8RA 1WA3A 1VGAA 3UPWA 5I3HA 5FEPA 1XBYA 4AAJA 1SZNA 4K7YA 2DIJA 4JTKA 2BY1A 3S5YA 4MKNA 1TQSA 3V1PA 2FB3A 4LUJA 3BAKA 1O4UA 1I45A 3BSHA 3M41A 2F7PA 4EF9A 1EP2A 4R53A 2WQPA 2QUVA 1O94A 2WPBA 4OV4A 1U30A 3G8RA 1QFEA 3TDFA 1B57A 2BX7A 3EWUA 3INPA 1ME7A 3GK0A 1CI1A 2ZE0A 1SZGA 5G4WA 4KFOA 2QMKA 4I7UA 3WENA 4NJKA 3ATYA 1E43A 3EJSA 4JTIA 3SI9A 1SQ7A 1BPLB 3NQFA 4NQ1A 1UCWA 3NO5A 1OF6A 2D0FA 3A47A 1CXLA 1QW9A 3HGJA 1BVZA 3GXTA 2OYLA 3CGTA 2EAEA 4NZFA 1U83A 3G3MA 3NL6A 3NVTA 4UTMA 1PJ9A 1VR6A 1XV8A 3L4XA 3O16A 1R33A 5G4EA 4TMCA 1D7FA 1LBMA 3RF9A 5AHNA 5D2VA 1R47A 4MY8A 3HB9A 1D3HA 3VFLA 2ATSA 3HGSA 3EDFA 4R34A 2ZCGA 3HPSA 1H50A 2VC6A 3QMRA 3KVMA 1QHOA 3CPUA 4FNTA 4UZSA 1GTEA 4JFTA 3A21A 4RXFA 3TSMA 3K8LA 3IGSA 4IGHA 3LM7A 4AYSA 3N2XA 2PWGA 2NWRA 1O95A 1HUVA 3FYPA 3II1A 4UNLA 3THAA 1DVJA 1TPB1 2QAFA 2JGQA 3C56A 1UD4A 3BVWA 2VFDA 5EMUA 5HDRA 4M6QA 2RKXA 3BCFA 2C8NA 3FOKA 4JTHA 1DJQA 1CXHA 4EF8A 2VUYA 2BHZA 4H8HA 4MAZA 2ZUTA 1JUKA 2ZZ3A 2UV8G 5CZTA 3NL2A 5DCBA 4PL1A 3NQCA 4E2BA 1Y7VA 2GJRA 4YCPA 3W83A 1DEDA 2B7NA 4NNBA 4NXKA 2QAPA 3BG5A 4ML9A 4UIOA 2A85A 3F03K 1TV7A 3TW7A 1AVAA 4ALDA 4JEQA 1NOFA 4AIOA 1V5XA 3RLVA 3EWWA 2WKGA 2B7OA 4UTLA 3ZWSA 1NM9A 2FB2A 4DELA 4JL2A 3BLPX 1JCNA 3H53A 4OU1A 1FWNA 2Y2WA 3GDKA 3A23A 3C2FA 1ODUA 2I9EA 4C1KA 1CW2A 1TSIA 3L4UA 3NEVA 5D04C 3PUEA 5CPNA 2Y70A 3P60A 3VNZA 3S5OA 3C2OA 1ZS2A 3TXZA 1MEIA 1W5NA 2WSQA 2BHYA 2V82A 3PUOA 1A53A 4E2DA 3HQ1A 2P1FA 1XC4A 4CGTA 4WXZA 2G3MA 5DBUA 2PRHA 2O7QA 2D3LA 1YYAA 1VPXA 4JIQA 1Y0EA 4WXYA 3KVLA 1W31A 1RQHA 2Z6JA 5HXMA 2QJGA 4H6KA 4UMCA 4FNUA 4RR4A 3TMQA 1SFJA 1B2YA 4O13A 5D09A 2V3DA 4GUIA 1LLWA 4OQVA 4GI6A 3NPUA 5A2CA 1BEUA 7TIMA 2YKKA 2DU2A 5AC8A 4LRSA 3DC0A 5LZLA 2OW6A 3LHTA 1JL8A 3LB0A 4WLCA 1JDCA 5EKYA 3U2OA 4RV8A 4JTUA 1G4SA 5HJLA 3BMWA 3C2RA 2PWDA 2ZICA 2A7RA 1BWKA 1RR2A 3NZ1A 1PHWA 2IGTA 1EIXA 5ABTA 3ZR5A 1SO3A 4ADTA 3RK8A 1JD7A 3P5YA 2NWSA 2J88A 1F74A 3DU0A 3DFTA 1CGWA 3VO0A 3KLKA 2C3ZA 1GYNA 2A7PA 3M1ZA 2WC7A 3CEUA 5G2WA 2E9BA 1GVIA 2EADA 4Z1CA 4CQ9A 5CZSA 4HKPA 2JGYA 1FDJA 1G4EA 4Q4KA 3W07A 3MP4A 5CGQA 5LGXA 1SSDA 2CW6A 2V81A 3TONA 1SSGA 2Y7EA 3ZOAA 3AMLA 3IGXA 4GUFA 2OT0A 4WD0A 4HP5A 3CIXA 5HR7A 1WXJA 4U2ZA 1LOSA 1F73A 3WJSA 1P6WA 3DHUA 4J3XA 4HNTA 1XXXA 1HWWA 3LX9A 2Y7DA 3GKFA 1JUEA 1F6PA 1VCFA 1JULA 1WZMA 3RIKA 4Y96A 5KZDA 1QI4A 1WX0A 5LSMA 3VGGA 2V3FA 1Z42A 3QH2A 2NUXA 3G1YA 2C18A 2ZRVA 4DPQA 4MLJA
chains in the Genus database with same CATH superfamily
5FOJA 1NICA 1BG4A 1XICA 2IV8A 3G24A 1W0WA 2UXGA 3PL6B 4KX8A 3E38A 3NEEA 1T20A 1TZGH 2PPCA 1F1DA 5FA4B 4X4MA 2CCWA 3FCGA 5A8GA 3A67L 4ZAKC 5F97E 4TTGA 3TO4C 5F4XA 1CF1A 2FR4A 5BPPA 2V67A 3DFOA 2B7PA 5IXEA 1E5ZA 1RY7B 3I9GL 5KVDL 2J75A 3N9KA 4UFJA 5HULA 1MAKA 2EXTA 2FKPA 3S46A 5MF5A 2YCLA 3I9PA 4WRLA 5I18L 1CFBA 4ZL1A 2P10A 4TX6A 1MIEH 2VEMA 5A6LA 1H3UA 2FIKA 1G6RB 1RK1A 3FZUC 4AKOA 2QCHA 5IB3A 4RWHA 4XO4A 4WEBL 4J5VA 1HHJA 4PRRA 3ATZA 2ZRYA 5DVOA 4PUDA 3DX8A 3IKCB 4HJWA 4NKOA 3U36A 3WHXB 4PTWA 4AMCA 1P43A 4CNIA 3QC0A 4XWOD 4JO4L 4YSCA 3P5ZA 1MHCB 2DLTA 3FB5B 4NZTH 3VFOB 2QULA 4O0ZA 4M03A 3B7YA 1SFTA 1M57B 1PFCA 3DIVA 3GSXA 4FQHA 4PS8A 1W8SA 3UPCA 1X7SA 3DTXA 3HRZC 5I1JH 2DLFL 1NIFA 2R1KA 4YGAB 3N25A 1II4E 3UR8A 2PBOA 3H42L 1BYBA 1NAL1 2RCSH 1QOKA 3B2VL 3HZ3A 4ZMLA 4P9HC 4CVXA 4UFMA 3NG5A 1N70A 1WDAA 4UQAA 2YD4A 4Y2OA 2OSWA 2DYRB 1OG0A 4AHPA 3OYZA 1QRNB 3UTPD 3SGUA 1O6VA 2ED9A 2ZWSA 3STLB 1AA1B 5DJCA 4ENZA 4GMEA 3IFOB 5B39B 4BF7A 3C2EA 2XC8A 3MUUA 4GRWH 1TREA 1UZ8B 3H7LA 4F2TA 1L5GB 1A5UA 1AH3A 4M0XA 2NMSA 3HPLB 3SDYL 3TYDA 3RX4A 1Q6QA 3ESVF 3IDMB 1CE1H 1MFVA 4JFXA 5A6AA 3SKNB 4MAYB 5BOPA 1QDSA 4F48A 4ODUB 5DC2A 4V2CB 4YDKL 3T0EB 2XQYK 1IC0A 4IPJA 3RY4A 2MTPA 1FUNA 1W8NA 2Q76B 3O9WA 4QXTA 4Q9RH 2OMUA 4FAMA 1OAZL 4YTUA 2E56A 4DNMA 2DY3A 2V17H 1T21B 4LCWD 1J48A 1DN0B 1VFAB 2VWEC 4UNIA 3VXUD 5IRPA 3KGSA 5KBKA 4XP1L 5CXPA 4C83B 3OGCB 3MRCB 3QDGE 1NQBA 5EULV 4Y19E 5JYLA 4ERAA 4YYFA 1ZDSA 4UCGA 2WMPB 2JXMB 3CU1A 4NAQA 5TIMA 1TWIA 5FJJA 4YHOL 4Z3GA 1LRTA 1BREA 1JCXA 1SEQH 1IEVA 4GAGH 1IILE 4HUUA 1ZA3A 3APNA 3ARUA 1XZ0B 1VACB 4M7LH 4ETQB 4P49A 5C3IA 2BOFX 1TPWA 4HHAB 1MFCL 2VSKB 2PYEB 2YWZA 4A68A 1I3GL 4AK1A 4AVHA 5BVJB 2NR6C 3UMNA 3QFDB 1EZSA 1SFDA 1JN6B 1NOLA 3G3LA 1NTDA 3PWNA 2I14A 1E67A 1PIFA 4ZX5A 2A7BA 2DWSA 1P7HL 3KCJA 2F54A 3KNBB 5DUJA 3PAYA 4GMSH 2NLYA 3U9IA 1FH2A 1NANH 4KJQC 1A4KB 3ATEA 4F58L 5EEXA 4J1OA 2DQMA 4QRNA 4ECLA 2NRDA 3O41A 3E9TA 4OZFA 4PW9A 1KYOJ 1C5DB 1X6NA 3HBGA 1WZAA 4PJEA 1F1AA 3DG3A 2EIMB 2P46B 1NSNH 5BRZA 4Q7BA 3SBFA 3WS3B 3TC6A 3ZT7A 4EPBC 4W88A 2HH0L 1JWMB 1JVLA 2ZXDA 1ED3A 3AMKA 5JLZB 2EXOA 1B0RA 1CU4H 3E6FA 4N0YH 3WFEH 1IO4C 3MQTA 2V2WB 3S1XA 3ZVIA 2FYYA 2Q02A 1LDPL 2MH4A 3MOQA 2XA3A 1LO4L 2X70B 5DD6B 5C0GB 1VD6A 3PR2A 4LS1A 3QUHA 1PYWA 3NFSH 1WV7T 3KLAA 4HKJB 4PVNA 5IJCC 3SCOA 2GEQA 3V75A 1RUAL 1UFUA 2DPEA 1I9RL 2CGYA 2DQCL 3RDTA 3RL1A 3V0GA 2YR1A 1BMWA 1XPYA 4KXCA 1VFBB 2CKBB 3U48A 2JJWA 5T3ZD 3RU8L 2OCZA 4RGNE 2CKNA 3MFFA 5JW4N 4GG6A 3WD3A 2B7DT 4WY7H 1P4IH 4FXGB 2IV9A 4B92A 2HG5A 4WSGA 4BH7A 1WAPA 1LF1A 1SW7A 5C3TA 3T3ME 3OKOB 4REQA 4H44C 2GGGA 4UOW1 3CU7A 4IRSA 4RK8A 1JDDA 1QAWA 1VRXA 4LGSB 4BM7A 3EX1A 1DVZA 4OD3L 2AXFA 2C91A 1UWYA 2IH3B 5HI3D 3GVGA 3RP1A 4NO5A 4ZMPA 1WGVA 1RJLA 3MRPA 1HZLA 4N4YB 2WZIA 3EA3A 3LCGA 4XHJD 2NXYB 1F8TL 4RNFA 2QJIA 1WWCA 1NLBL 3EYFB 5I8KL 4RGMC 3BIAX 1YKWA 2YO3A 1MI5A 4V1DA 3X14B 4LVBA 4KWOA 3QPQD 2EUVA 5CSRA 1AZCA 2V7HA 1PG7X 1URIA 4JPWL 5HPMB 3IFOA 5B39A 4I0CC 3WMPA 4BK8A 4P59H 2C9SA 5MEQB 2OLHA 1IGJB 4C7FA 3O6FA 4AQ8C 1YEGL 4TQIA 3JWDL 4ZMAT 2TODA 4DP4X 1CURA 5DFAA 5ABGA 3SCTA 5DFTA 3CQIA 6XIAA 4X0KA 3BJTA 3I85A 4G7VH 4JKPH 2PW2A 1O5XA 2DN7A 4MAYC 3FUDA 2QGHA 3QG6A 3VGAB 2W80C 1HG3A 4H8PA 2H6PA 2VCCA 1JHTA 4P4KD 4AQOA 4MB5A 2GG1A 4Y4FD 1DN0A 1VFAA 1E42A 4CW1B 1QNOA 1L0XA 3ESMA 5F7KC 1SO5A 4H1ZA 2CCRA 3PY2A 3LPPA 4JAMA 1A3WA 2BO0A 3DBPA 2CLMA 2J4WL 2JEQA 3S48A 4DYEA 2HZGA 1NFDE 2JJTC 5HMSA 5B7EA 2CG9X 3D3VD 2ZNWA 3GZ3A 3QCVL 1RULH 4OBSA 2BVPA 4LLVA 1JWUB 3HUJB 3LIUA 1W3KA 2R6OA 3FT2A 3CLMA 3D47A 3EOSA 1H0DA 2YGNA 3OHXC 4NJIA 1IGWA 2R0ZL 1MNUL 4K38A 2HRGA 3MJ8B 2R1WA 1ZLSH 3WG6A 1OO2A 4N1HB 3EOUA 1NY1A 4ZE4A 2G4JA 4M5YH 2R29L 3QV7A 3TFXA 5EORH 2P8LB 2O5NA 3B34A 1INQA 2W65A 3AS2A 5DRZA 5ITBL 1J01A 3QDJA 1J9CT 1KRAC 3B8UA 3M8OL 2CH8A 5D7SL 3DMMC 4G9DB 2VXQH 1YHPA 1XCXA 3MLSL 1P7KB 1E6SM 1TTQA 1TFVA 3WELA 3JYCA 2QCDB 4JRXD 5GNZA 2XQBL 3QULA 1NDVA 3UY8A 4ADUA 3HOJA 4WU7B 1WKYA 1EXUB 1IGCH 4YTRA 3QR3A 4I8YA 4O54A 1SBBA 3HZVB 4MNQB 1KLUA 3P3UA 2QV2A 1XLAA 2QW5A 2IDTA 3ZKXC 3BQUA 1AZBA 4H9TA 2R1XA 1A21A 3TURA 1EPXA 1ZLVH 3VWJD 3V0VB 2VDML 4QDPA 3DETC 4W86A 4E38A 3W70A 1ASQA 5A2AA 2VSCA 1U1JA 4PRDB 2CU9A 1J4EA 4OUIA 3IJLA 1KXTB 1Z7JA 4GO8A 3TBTB 3IJSB 1R0AL 3E8VA 3N0AA 4Q8NA 4XNMB 3RZCD 4OZIF 4E5XB 4YSPA 1M65A 4C91A 3HR5B 1H3WM 5K9KB 5J13B 2VEIA 5MKGB 1XRVA 1SUJA 1WBYA 2XG4B 2ZYFA 3MA9H 5F0JB 2GJLA 5C0GA 1I8IA 3QUXC 4LLMA 3R8HA 1TLKA 1XGQB 3ITGA 4D1JA 3MN8A 1BSIA 4XBSA 4H0IA 2EO9A 3UQNA 4X9FA 3W56A 4K9JA 1PS9A 4D2JA 2OFQA 5D2LB 5DUML 1E6JH 4ZMVA 3N73A 4KCWA 15C8L 3OR6B 4HOWA 3SUTA 1X96A 5I6XC 1MQ8A 4JFED 3UROR 1IQDB 1EF2A 4KKAD 4RAHA 4LKCA 3TL5A 1UWTA 3WE6A 3FTZA 2GJ6D 2PFHA 4EK7A 3OKOA 4PGBA 3C0QA 2OZ0A 1A6VL 1GVOA 2Q3ZA 1LOQA 1K3ZA 2APFA 3PWPA 5DX7A 5I3JA 4OCNC 5CINL 4ZQMA 5FO8A 3E96A 3FUEA 2V5DA 4LLUB 2ZZ7A 5CEZD 3AG1B 3S4SG 4NX5A 1KPVA 2ZVRA 1IB5A 2D7TH 1C8XA 1V79A 4B9IA 1SW3A 1GZPB 3P77B 4EZKA 2Z4GA 2H32H 4ZUVB 3S5LG 2X0YA 4EDXA 1T1XB 3IXTB 4S3DA 4GSDL 1TA3A 2BP3A 3BP4A 5IDZA 2VDQH 1KCSH 2ITCB 3WE1A 3V9EA 5KVGH 4GG6E 4YL4A 2TYSA 1GPOL 3QUMB 3TC9A 2DUAA 2OJZL 1IQWH 5F70A 1TTJA 7CGTA 1GKEA 2ESVD 5I6PA 5IMOB 4G9FE 2DW7A 4J3VA 2PDUA 3SCMB 1QFWH 5D5ME 3WBAA 4MNGB 1A7QL 4W6XB 1UKTA 4YHNB 4PODA 3RNQB 3U0WL 1XZWA 5IR1B 3HV8A 3DFNA 4DUVA 3LCXA 5CSYA 1XIJA 2W81C 1DCEA 2ZBTA 1GNXA 3UOAB 5E03A 3AGWA 1FDLH 5C0FB 2RDXA 1TJHL 3B1UA 3P67A 4DPRA 4PA8A 3KLQA 4IBYA 3W6MA 4WNSA 4JTQA 4QAIA 4Y4KC 5MENA 3R1ZA 2VZOA 3FB8A 4QOKD 1UC6A 1MDAA 1Z0MA 1HNFA 1VJZA 1G43A 1CR9H 1NC4A 4JO1H 4U1HA 1MI5E 4MNKA 2YPLE 3VXNA 3O15A 4JQXC 2F53B 1U8QA 2UZIH 2WNWA 3P73B 5GRYA 2YW4A 4NRXA 3E8UL 2GABA 1EHNA 1KCBA 3AABA 3PP3K 4U6YB 2EDNA 4ZX6A 4LLVB 3VKCA 3ZR4A 3GBDA 3A6CH 3TIDA 2QVTA 3Q8CA 1NA8A 2P47B 2RFXB 5DEJA 1KV5A 2CLOA 1P7QD 3RHWK 1J1OL 4N8PA 3HBPA 4D7BA 3WNOA 2DV0A 5F88B 3RTQD 3AADB 3DXAB 4RDZA 4Z2KA 4M81A 1DN2A 5I15H 3MP3A 3QSTA 1NOAA 1IARB 5K1JA 4FJ6A 1V7NL 5EF2A 2NY1B 1YADA 3DJZA 4U3SA 2WNQA 4JZ5A 2IPUG 3WNLA 2R51A 1E70M 1WAEA 3EFFB 5I18H 3X2QB 1THFD 2ACRA 5K9CA 2YMTA 3ULVC 1FNLA 4QXTB 4B4FA 1KA9F 2Y5TA 1NINA 4AK2A 5IT2L 2IQDA 2DM7A 4W1TA 5AW8B 3WJWA 5D1QD 5HHQA 5F7WC 4PW4A 2UVEA 1UZ4A 1IFRA 4WHTB 3I6GB 3W1NA 3Q8BA 5CBEB 3O6LL 3WHE0 1KM3A 3CQQA 3QJFA 3G04A 4HS6B 4WSKA 5MHSE 3D9AH 4O2EA 5MI0C 1BVKA 2MHAA 4OQ1A 3U1QA 4PMFA 5CBAB 3EPMA 3I4EA 1QI5A 1W1ZA 2P5EA 3HNSH 2WUBH 4GRLD 5CGYD 5I16A 1MG3C 2GIXA 4JREB 1ME8A 4NERA 2PB1A 2MRYA 2RACA 3H42H 4U4BA 4BRJA 5JIPA 2E6AA 3NDZE 4BFGA 3NQMA 5G2IA 4B97A 4HWBA 1F2JA 3BZJA 3S83A 2WBGA 1XR8A 1XH3B 2IFFL 4JZNB 1HCFX 4PJCE 2PC4A 3CQKA 1T6WA 3EF4A 3O8XD 4HT3A 2OL3H 2B1HL 5EOCJ 4C6EA 1CZ8H 5E8OB 3LRKA 4LAQH 1XXFC 2BB0A 1T6BX 1SJXA 3L5LA 2H5UA 3SE9L 4YXGA 3DIDA 2Z8SA 1A9EB 1WUFA 4N4QA 2GJPA 3D30A 4ZS7H 3FYYA 5K9QI 5DQDL 1EO8H 1G0YR 2IAAC 3QUYA 1ML1A 4DZBA 1UVQA 1WIUA 1LHZA 5G2HA 1KRCC 5TQ2L 1F8IA 5C54A 1KD0A 4L61A 5DMNA 1WH0A 2X4TA 1E4XH 4QWWD 5DRWA 5EB9A 1TQCB 2OZ4L 2X70A 4HEPA 1F02I 1OT1A 4S3KA 3WLSA 2LVEA 4AV0A 4Z7WF 3G0XA 1I3RA 2P44B 5M7QA 2ZKWA 3ULVH 2J24A 2AEWA 2DJMA 4FZIA 4XSMA 2D3NA 2NY3D 3EFOA 5I1CL 5SV4A 4PVBA 1VZHA 2C3XA 1OEZW 3QI9C 5BOJA 5E1QA 1UROA 3W2LA 3IETA 4TMBA 1U3HB 3CHSA 1GZ1A 4YHOH 5TPWL 4GQGA 3KBHE 4FP8H 3S34L 3HLAA 1OSEA 2CZFA 3VXOB 1LE9A 2PO6D 5BMFH 4JGNA 1XCQA 2VDOB 1CXFA 1WFTA 3RE0A 5MP6L 4Z7IA 4LWWA 5AFAA 4IIGA 4JFDE 1ZTVA 3F6LA 2IPUK 3VFMB 3LSCA 1JK8A 2BSBA 4DP7X 1JHLH 3ARDB 3D52A 1X5ZA 2OGYA 3QCUH 4UDTA 2R9RA 1YNKH 5HHPA 3UW6A 1FUYA 4FXSA 1K4HA 2IGLA 4ZZKA 4MDPA 4AMKL 1SRDA 3KHDA 2ALAA 3KPQB 1KTBA 3TIMA 5BXTA 4DP1X 4B9CA 3EGJA 2OSXA 1KBKA 1ET7A 4GLRI 4K3DH 4WK4B 2NNFA 1P0EA 3UXKA 1ZK5A 2ICEB 2G50A 3CSGA 4N5EC 4LJ3A 2A5HA 4Y2DD 2J6XA 3SKOA 2HH0H 2WXDM 1KXVC 1WITA 3MSDA 1UZGA 2FNWA 1DORA 3UTZA 1EJ8A 1FF5A 2VZUA 1QFPA 4M1CC 2CFFA 1INEL 2WQVA 5FDWB 1AQHA 1HEJC 1UXMA 1IGJA 3D4YA 5EFIB 4F9PC 5DXXA 4IOSD 3PHOA 1PYFA 2OWCA 4NP4H 3NFSL 1AJ7L 1FA2A 3QVAA 4Y1AE 2VEKA 5I0VA 3B5HA 3WLKX 2G5BB 1KV3A 2YWYA 1BD2B 4PRIB 4XCCH 5I30H 1R2SA 1V3JA 2KZ1B 3OQRA 4WW2C 5EO1B 4PUJA 5CKGA 7PAZA 5L9DH 2CERA 2JALA 2PLJA 1CTOA 4F7EA 2X41A 3BW9B 2ZDSA 5EO1A 1V02A 2G95A 4GI8A 3Q8EA 2WVVA 2BXYA 3L3KB 4P23C 4WY7L 5JPMA 1VCGA 4Q4PA 1YEDB 5IF0A 1HFBA 1BAFL 3RWCA 4ZB5A 3LD8C 1ZE3C 2GI7A 3BFOA 2CALA 4EIZC 1W5MA 3I6EA 1R3JB 1QT1A 2XACC 3LV3A 3OJDA 3HBLA 1OJXA 4JR9L 4N8VB 3NEOA 1J86A 4UNVA 1QPRA 4V28A 4CU7A 3WNNA 5L0QB 4HUKB 1HL4A 2PF6A 4HEME 5BZDB 5KS9E 3TJIA 3F7RA 1ZQ5A 3NPXA 3PUDA 1KFJA 4N0FA 3SZKC 2DPKA 2K0RA 2QKFA 1NCAH 2PYEA 1KQZA 5TGBB 3K6IA 3OAYH 5K9JL 3QW4B 2J6VA 5HJYA 5LKYA 5F7YC 3WIIL 1F3JA 4HGWB 5EBGA 5HVFB 2BWGA 2NXZD 5FYKL 4LF2A 1JE6A 2X4RA 4RUBA 3LY6A 3GNNA 1A4JA 2R4SL 2G75A 4HUXA 2JQAA 1CIUA 4O2FA 4U3HA 4WWKC 2GOKA 4FXLA 3ZO9A 2FIQA 5EC1B 1MFMA 3LH8A 3SYCA 1RIVH 3DUUA 5EBUA 1ADDA 2BWDA 2H3XC 3IMRA 3G5WA 4U3AA 5D1XC 5D71L 4KJWD 5DUBB 4AD1A 4B4HA 5FYJD 4HWZA 2BOBA 4H6EA 4IHOB 4MQ7B 3OGSA 2GUYA 1AI1L 4NNPL 2YLKA 4WW1B 3QULB 5SWSD 3ROLB 3WNKA 5TQLA 3U2CA 5CJ8A 1UOVA 4Z0XA 3RLUA 2IH8A 3TROA 4LVHB 1S7XA 3W82A 3FMGH 4MKTA 3TTSA 1VHNA 5EUOE 2E5EA 3H70A 4G1EA 1E6OH 3BO9A 2BNQA 4U0RB 3WTVA 2J74A 3R0DA 4ZGYA 2B4CL 2JQMA 4AUYA 1SO4A 1BVKB 3M0LA 3OVPA 4IOTA 2F6AA 1RIUL 3HE7C 4J4PD 3MV8A 1UZDA 2EXYD 3PL6A 4M82A 1ANUA 2XIQA 3US1A 4ROPA 3ASOB 3RFZB 2X10A 2QBWA 3IFPA 1RBAA 1S7SA 1FPTH 1OCNA 1DBKH 4EN3C 3AUJA 5K9OA 1EBHA 4U1MA 3D08A 5B38A 4OVVA 5GSVB 2PPDA 1MNUH 1YEJL 3ALGA 2CLVA 4S2CA 1XB3A 3I2CH 4QJ3B 4S2SA 1E27A 1NGQL 5AW0B 6PAZA 4JPVH 1L4IA 4G6FD 2Q0ZX 2W9EH 3I9AA 1GKPA 3AXLB 1V5JA 2ENSA 3O3DA 2ROYA 3PV6A 4H88H 4S2SB 4DOHB 4GBXC 3IPWA 5AAWC 1M3UA 2VXQL 1QWUA 2IIJA 3MLSH 4YHLH 2AOSA 1BAGA 3QJAA 5KZCB 4G1KA 4JIIX 2J7FA 1NWPA 2VLKD 3TK7A 2G0KA 3BUDA 4PAZA 3FU7A 1EJVC 4F2EA 1VYRA 3PG9A 1KYFA 3PIQA 3IE9A 4UDTB 1EWDA 4CNIB 3CHVA 4GW1B 5G4NA 3MJWA 2VOTA 3GINA 4EF3A 1IM3B 5DJXA 2NZLA 3IJ8A 3AHZA 3TCSA 4L3CB 1C1EL 5L2JA 3VIMA 3KX6A 4CSTA 1UQSB 4V1DB 3X14A 2J7CA 3OBKA 3T1WA 4UF7C 2K8QA 5DFVC 1M04A 4CEUC 3ZRCC 2PP8A 1UKOA 4PJCA 4YSTA 3UPAA 2EHHA 4F2MB 1R0AH 1QLFB 4HWUA 4GO9A 3LQAL 2EKJA 4NOBA 1J1XL 4BGDA 6PTDA 2NNXA 3LKSB 1DIEA 3G2GA 3UP6A 1JZ8A 1E71M 3UPMA 4L4LA 5L8JB 3PGCB 1PO9A 4MVBC 1B4JH 1ZHLA 2JI1A 4QHLA 4AENA 2A21A 2YX0A 4UZUA 1TJ2A 4IRJD 2MNWA 4FB7A 2VFEA 3OHIA 1XPGA 3OAUH 4HJ0C 1TVNA 5CSZA 3RTLA 4A38A 1XG4A 2EACA 4LGXA 2ZKHH 3O2LA 1CD1A 1NGWB 3LNGA 4ES9A 3TCLA 5DUMH 4M93C 3CMJA 3H9HA 4CADB 4EI6A 5HDQL 4LVFA 4U1JA 3ZKXB 4YXLL 1N7ML 2L4OA 2IXUA 5F9OL 4XOBA 1SHXA 1RBOB 2NY4B 2PLTA 3VXTA 3EOLA 1N8OE 3L3HA 3NFPB 4MDJA 5CEYA 1G7VA 3WF1A 3DYPA 2ISWA 3AREA 1O75A 5E6SB 4G71B 1HE8A 4OJYA 2PDJA 3CN3A 1XFBA 4BV1A 3TN3A 3WY1A 2OULB 1A1MA 2A6KB 1E55A 4ZSOA 3UAEA 4FX5A 4US6A 4GS7C 1AKJA 3OX8A 4TR9A 4IGMA 1FG2A 3MKGA 3NA9H 1DE6A 3TZNA 3HAEG 5JORA 4ERIA 1DSFL 2A3LA 3U9UA 3DRQB 2JKNA 2VDQL 4RZ4A 3V36A 3QXVA 1VADA 5B1AB 3GB7B 5B4MD 3GLZA 3VIHA 2XG5A 2YGYA 1XCFA 4O5LL 1R46A 1U8CB 4WSJA 1XBXA 1P5VB 3H9ZA 4QXUH 2AKMA 3WH9A 4R85A 3BGMA 1OP3K 3B8TA 1P5UC 3GTXA 2NTSP 1U8MB 4DBEA 2G96A 3V79C 2AXGA 1G9ML 1TTRA 5CG0A 2PTWA 3EJQA 1U3NA 5L2KA 1EJUC 4YWSA 2WHKA 3D39B 1L8PA 3AXHA 3RR1A 1WO2A 4AM0Q 2JJTA 5GSRB 4ORMA 4S1DC 3B7SA 4LBEA 3TJPA 1SN0A 3F58L 1M7DA 4JO1L 1JRHI 4XWOC 3VXSE 4G7EA 2WO3B 1IL1A 1F45A 3LN4A 5J9PA 1YPZE 3ECUA 2ADFL 2YJQA 1O7AA 4BK9A 5LXEA 2HTLD 3VA8A 4DF0A 3HJEA 1J12A 2ZIDA 4DP8X 5E08L 4GCAA 2PU1A 1ZLDA 1VZGA 1T96A 2IDSA 1QQDB 4FQ2H 4XMLL 1NBCA 2PGRA 3WD4A 3BAWA 2EH8H 4LZKA 1LG2A 1J1OH 4QE1A 4B5SA 1PKQE 2IMNA 1ZA6B 2PURA 4HNNA 3W7NA 2QSCH 3W7GA 4L1HA 5FM8A 1F8MA 1H6UA 4IXHA 5AW2B 3N9GL 2INEA 2VMEA 4C47A 1V7NH 3DUSB 4YHYC 2QJJA 3KXFD 3MCOA 4GKTA 4OQTA 4ATWA 1Y6NR 3G77A 4I4WA 4JFVA 1P7TA 3MOAL 4GXFA 4ATDA 2J7HA 1PG7W 3SECA 5C0EA 1PDZA 3QIWB 4YTQA 1JN6A 4DLFA 3M1OA 3WE6B 4G7YH 2NUPB 4QKXB 4Y7MA 3WK0A 2VM3A 3ZZQA 1E9IA 3LAFA 4YR6A 3PJWA 2OZ4A 4CEXC 1KJVB 4RISH 3TKFA 5T5NG 5LWYL 4G8IB 5C09B 1VB9A 5IQ7H 3BVUA 1E9QB 4DZBB 3VB9A 5CAYB 4FNQA 1RZGA 5B3NA 3BUTA 2FSDA 3MACH 5FI8A 4DVRH 5CSGA 1U58A 2F1AA 1XIWB 4GRLA 4RX4D 2X9YA 3JWOL 5ABDE 3VYLA 5JR1L 4Z2HA 1DJGA 2HE8A 3FRPB 5MEOB 4O53A 3WEMA 3RAJL 2ZCKL 5IW3A 1V7AA 3S36X 5CGBA 4FEIA 5DZVA 4C6NA 4WI4A 4X0KB 1P69B 1M7PA 2W92A 3GSQB 5LGZA 1IAIH 4ZRGA 3T3PB 2G5RA 2GDUA 3KWSA 4CN1A 5IMMB 1SFHA 1QRND 2CZDA 5LBSA 2FIKB 5ID0A 1H6TA 4HH8A 4FQXB 4XBMA 3PS6A 5GPRA 1FDYA 1DV7A 3L0NA 1MQQA 3LCIA 4M6VA 4QG6A 1QA9B 2Y6SD 3KPSD 1RHHA 1TDQA 4KKQA 1FA4A 2CLKA 2EKCA 4XSLA 1C5BL 5DMJB 5AKSA 4D8OA 4LSUL 3RZCA 1W6TA 1FLRL 4JK0D 3MRGB 3KBMA 4JX5A 9XIMA 3D4CA 2JBMA 1VFUA 3KPLA 3ZT5A 5IGXH 3B40A 1QYGL 4RMSA 3WL9B 4I9WD 1S8DB 3JRKA 3WLWC 4DPPA 2BVPB 3HI1A 3TW9A 3M0HA 1MFNA 4FA3A 2E7HA 1BAWA 2DQUH 4GS7B 2COQA 5AYIA 4DZ8B 2CM5A 4LT7A 4WO4C 1AQMA 3VFVA 2XIDA 1NTHA 3L9BA 1H7PA 9XIAA 2V37A 2I85A 4V27A 3GSNA 4N3UA 3ULVL 4A2LA 1YXCA 1NQ6A 3CZNA 5E8DL 5A6SA 2WBJC 2CWNA 4NGHL 3QSRA 4RMRA 5EMMA 1M53A 3VSTA 5D1ZI 2Y22A 3WIFA 2W07B 4FZEH 4FTVA 5JXAH 2IKJA 3BLOA 5L6YL 3QG6B 5TPWH 2ALWA 3DURA 4M6PA 4F33A 2YAHA 4KJYA 3HS0C 4OW6A 4HNLA 3L3DB 4TLKA 3D51A 3RDJA 4PYSA 1BQRA 5FGCB 1CFSA 3FJ4A 3SGDH 1J05B 3S8HA 4L9LC 5DQJB 4B7IA 2IADB 3ARQA 3HPJB 4LLWA 4F93B 4HNOA 3GHEH 4RE4A 3SJNA 4K3GA 4BK5C 2BTMA 4U1LB 2NSXA 2ZUUA 1YDPA 3H9SD 3R43A 1FFRA 3MCG1 5T3ZE 3FXGA 2H0PA 2YR3A 3I50L 3C6SA 1AO7D 4QXVA 4XR8C 2QVKA 2DJXA 3AIEA 3N9RA 1GOGA 1DTNA 3VTAA 3AW5A 1Y65A 4JM2C 1TU2A 4JEGB 4M9OA 1LTDA 1ZCOA 2F8VA 3I02A 5H8DA 3N44F 4LVOB 2P8LA 3NQBA 3TJLA 3CSBA 5FF4A 3TA9A 4NCC2 1CFTA 5KVEL 1NBQA 3MROB 1RUPH 1B3XA 4HSNA 2PR9A 3SCWA 5HYSA 3AYTA 1ZWIA 1M4KA 4RFEA 1E4WH 2GDQA 3BAJA 3SD5A 3UP1A 5LDSA 2X4PB 3LNMA 3A13A 3MGAA 2X89D 3KPTA 4HJUA 4IDJL 4HEPG 4XCCL 1ZMYA 3EAKA 3G6JF 4Y1AB 1CDBA 3VUPA 2RH0A 4X98A 3TFKC 4ZFFA 1PD0A 2YPLB 2BIOA 2FX7L 2E6QA 4ORZC 2H0JA 2VLJD 1PX4A 2QDHA 4Y9NA 3FU6A 1SXZA 1MYRA 1UR3M 3ANYA 5B80A 3CFTA 3U25A 3D39A 5EFFA 4Y2NA 2W66A 3AT9A 3QEUA 1VCVA 5C07B 1KPVB 3RIAK 4AIEA 2BFGA 5D7IE 1HXMB 2NZ1A 3EDJA 3G1RA 1G69A 2X4QB 4PJAB 3G6AB 4PRWA 2OX4A 4GQRA 4YXHL 1E28B 2CETA 4P2QA 1HKLH 4Y0GA 2E5DA 1UUOA 5C2CA 3RL1B 2Z9TA 4ABVA 4JFQB 4K15A 4DFIA 4JANB 4JHMA 2YL6A 4MY9A 2A0LC 2XXGA 3MNWA 2XQ0A 4JVWA 2FVKA 1LYXA 2ZXWB 3QSKB 2XA8L 2ZF9A 1HL5A 2O1AA 3BH8A 3KW7A 1SU5A 1LJMA 3ELFA 4RAUA 1NCAL 2FFCA 3LQZB 4G8FB 4D6DA 1FYTA 3IFNH 2FLMA 3VFMA 4GH3A 1F6AA 2FJFB 1LWIA 3G1VA 1MCDA 1EPFA 4HZAA 4DP9X 1BA9A 1ZAHA 4X7EC 3EOTH 4QPEA 5T1LB 1OIMA 1OQFA 4H25A 2OQYA 3NGFA 4QAMB 3A6BH 4PWHA 4KKZA 5IBLC 3OIHA 1KG0B 4N7QA 1MH5B 1I7ZB 3PB2A 4MXQD 3HG0A 3DSFH 3CVIH 4R8WH 1FX6A 1HSBB 1AI1H 4NNPH 2XVGA 3GX9A 2R1YA 4BJHA 1HJXA 1UQSA 3GT6A 3NJIA 2MOVA 2QPXA 3QN3A 4DBUA 4N4PA 3ARPA 2C16A 4AYBA 1A5LC 4PTNA 3WUBA 3MV9E 5DK2B 3MUHL 5AG9A 3MI3A 1C5CL 3MA7B 5L0QC 4HALA 1U8NA 1IFHL 2QUNA 1EEPA 2QCGA 2Z4QA 4YEEA 3K4ZA 4DBDA 3V6FA 2ITCA 1N26A 2GI0A 3ETTA 4HCRH 2W6RA 3KTCA 2J78A 1I1AC 3BKYH 4PMVA 5IBUB 5DDHB 1DHPA 3ABQA 2FHCA 5AWNH 3O8XC 4ALAL 4KXZH 4PG2A 3DBXB 4HVXA 3CFCH 5FA3A 3M5YA 2FEDC 4V1DE 4U5KA 1XM3A 1RZ8A 4PJXA 5AYUH 1UQZA 3O0FA 2W9MA 4IGNA 5E09A 4F0SA 4UOJA 5AOIA 5HBBA 2Y7QA 1IJNA 2YXWA 1LWHA 1Y07A 2PCFB 1QK0A 2E9JA 1I2NA 2NUWA 4JPVL 1NGPL 1PZ5A 2N7AA 4HPYL 4OLEA 2NUTA 3KCOA 1T3FB 4NZTL 2FBRA 4XPBH 2JKWA 3KCLA 1CPUA 2VZSA 1RPUA 3BD3A 1PZ5B 2JKTM 3OWEA 5ENWB 2ZX7A 3O4OC 5CCKH 1EZWA 3MRJB 1NF7A 3XIMA 3D5HA 4GZEA 1OAYH 1KCLA 4XZUA 2XV3A 3KGUA 5BQ7A 1Y1UA 5A16A 4ZQKA 2TSAA 4M00A 4HGKC 3W7CA 1MPAL 3KPLB 4F9DA 1O9VA 4CVWA 2QCFA 1JPTL 3RUBL 3NVQA 2OMZB 4HJTA 5K39B 1ZT7B 3RX9A 3RZCC 1HO4A 2H6OA 3K2GA 3KOFA 5KETA 3Q3GB 3S4SB 4M7KH 4N0CD 1KJMA 1QSFA 2D2OA 1XEUA 3HUJA 2OU4A 1T80A 3P0VL 3UO8B 1TQUA 1Z0NA 4K71C 1NMCC 3IGFA 3SDYH 3U6RA 4RW3A 4GFTB 1S7UA 4Z95H 1UC5A 4JTCA 4PMJA 2EKGA 1U8PB 1A5FL 5EF0A 2UWEB 1DWAM 1S7UB 6CGTA 1XIDA 3L65A 2OLSA 1Q9KB 1KB3A 4PJGF 3QDJE 4Z7OF 5GNYA 2QGYA 1AC6A 1AMKA 4IHCA 1OAZH 1AGCA 2YAMA 3AZRA 3SDAC 1Z5LA 3A5FA 4NQTA 1ICQA 4HAKA 3V5OA 1FV1A 1FIGH 1KFLA 2OMUB 2G2RA 4H1LB 5E9DD 3NRQA 3O6ML 3N43F 4ONGL 4QRQA 3TNMB 1GL4B 2DT1A 5BU9A 1HOCB 3WG7B 1GC1H 1XYLA 2GJXA 3T0VA 2OMXB 2Z91A 1A6ZB 3LKQA 3OXSA 5F3BA 3HKZA 2OX5B 1XYAA 4FLHA 1PIGA 3MCNA 3DDGA 1V10A 2XVKA 5D8JH 3C3UA 3OZ9L 2DZSA 3SUSA 2L7EA 4L8SA 4FABH 1M5WA 4Q7NA 3V0SA 3CVDA 1A3QA 4PPTA 2ZRWA 4LDCA 4Z9KB 4OJDH 4D7PA 2X4OA 3MJYA 3NSMA 4S1FA 4B5EA 4KWVA 2QCCA 1AMXA 3L7EB 5HQEA 2ACQA 4A7TA 1D7BA 4BEIA 1R7OA 3ETBF 3CO4A 1VERA 3E0GA 2NY0C 1K8DA 3N44B 4WDIA 3HM7A 2R0WH 3DVFA 1VFLA 3F83A 4PR5B 3ULUF 1TQVA 1KBWA 3TS8A 3VI3E 1RZKH 3NA8A 5B8CB 2IOOA 1HGYA 2ZWYA 4J3UA 3R7RA 1E9OA 3B3BA 2WBXA 3H2EA 2PU0A 1BBJB 4O5LH 3P3TA 4BF5A 3VKJA 4N2HA 2F54D 1L3NA 2GTZA 3MNZA 4MMYA 3VIKA 4QXUL 4JVPA 4DN3H 2CKBL 3AC0A 3SD2A 3UBFA 2XU9A 2R14A 1ML0A 3L21A 2PTYA 4NBXB 3ECBB 3GD6A 2ODOA 5K2ZA 1CU4L 4L3AA 3CSFA 3QDGD 5G5DA 3ZDXE 1UG6A 4Z0JA 4X5LA 1KELL 1KM4A 2QVMA 2I17A 3E02A 1T1WB 3CAVA 3AJ7A 5DTFA 4E6MA 4XG1A 4XV0A 4DPCX 2DQCH 1I8KA 4JY6B 1BQSA 4QHLB 3NYDA 3F58H 3W1MA 1M7XA 5BOOA 4PP1C 1R24A 3T4AC 1L6ZA 4QD2E 1MDLA 3CK0L 4U0QB 3E7JA 4AYDC 4GNJA 5IFTA 1DR9A 5TQ0L 1KB5B 4PBXA 1KWGA 3U6WA 3ZR6A 4WWOA 4OD1H 4DK3A 3SCPA 2CAKA 4ATTA 1IBHA 1DVTA 1YEKH 2A77H 3IBOA 1V0MA 3LV5A 3P3BA 5DT5A 3WX7A 4HT1H 1GYVA 3UJTH 1A7BA 3E0IA 1N0XH 2IALB 1JZ5A 1T7YA 4YBLC 1PCKA 4S0TD 4RPPA 1JMZA 2CHZA 2XWJB 3SGZA 4REQB 3TTQA 5I77A 2FJHB 2AW2A 3B83A 3N9GH 4MM1A 1GGCL 1GSMA 3ZJKA 1ZE3H 1KGYE 3QBTB 4FQ1H 4JY9A 5D7LB 2XN9B 2ETWA 1KBLA 2GQ3A 3FRUB 1A5AA 1CL7L 1PTAA 2XFGB 2NSOA 2YXOA 4W9LC 3CTLA 2WLNA 5I8KH 4K7PH 5HVWA 3S8FB 5T3XD 5B3JF 2DF3A 4FR6A 3ZTNH 1K02A 4W6YB 4HPGA 4Q6IC 3P11H 4N6QA 1SHSA 4Z77B 3MPGA 3WLJA 2PCYA 4B5ZA 5LNWA 4Y2WA 1VA9A 2CDFB 4LRIC 4P59L 2J4GA 1UWAA 3LH9A 3H7VA 4A8RA 3GRWH 2AK4D 3GZOA 4OSUL 1P6BA 3DENA 4HCHA 1PAMA 5D9OA 3RUGE 1AHWC 4N2LA 2BSED 3Q43A 3RWHB 3SCMC 4FP1A 3QNFA 4JFXB 1GGTA 4KDVA 3WMSA 2CXEA 1UWFA 2C4FU 2HA1A 3IU4L 2EPOA 5U4NA 3WK1A 3MCLH 2OTPA 4UB9A 2OPCA 2IH1A 2FJGB 1E4IA 4G8GE 3LMJH 2VD9A 4FKEA 3GB7A 3QG7L 4FI7A 3V6OE 4M02A 2Y0FA 3WJXA 1R19A 3HC0A 2IH1B 4WI3A 1Y5VA 1FCBA 1BX2B 2RDUA 3L2IA 3SKNA 4A8NA 1Z3RA 3P3YA 4PVLA 3OZKA 4J23A 4LEXH 5G4MA 1VYSX 1Q6DA 3UF9A 3WF4A 2J2ZA 2ZWZA 1KWKA 1M68A 5K9KA 3PBMA 5IROD 3UADA 3TJEH 2VGFA 5HHQB 2LR4A 3BIKB 3PXHA 3T44A 2LGNA 5EMLA 3IPBA 3TBTA 4NY2A 1JWUA 3JZYA 1KM2A 4NNXA 1QR4A 4BFBD 1PD6A 4YHZL 3OTRA 2IWGA 4PRPB 4JJ5A 1ZHBA 2YPVA 4IGBC 4RWYL 1ZVNA 4E9QA 5HNUA 2Y1HA 2QSVA 4HJJL 5ITBH 4EXKA 3F65A 4BYHA 1M9WA 2Y7NA 3FFCA 4HGWA 4JLRB 2QKIB 4NBZB 5TE4H 5H37H 4ZMNA 4L4MA 4QSHA 4P9MH 3O9WD 3CQPA 4Y2DC 1IZCA 3L5JA 1YDVA 5C0BB 1HT6A 3U0PB 1A4LA 5H37A 1XH3A 1CGSL 3UERA 1SYSA 2H1PH 4UFHA 3BISA 1H09A 4NGHH 1Q6GA 3NYZA 3P62A 4N8CL 1RL1A 2E5BA 5LAPA 3CHOA 2X3AA 3JV6A 3NCCB 4FZEL 2FGWH 4WWNA 1MWAB 3S37X 1UH4A 4Q58C 5BZZA 2WMKA 2GQ9A 3OAYK 3QR1A 3RVVD 4O1EA 4FQXC 1XHHA 5GJTH 2J25A 2OZTA 3H2MA 4RW5A 2P24A 1KJVA 1BPVA 4IK7A 3GG0A 3NIFF 4MJ4A 3T40A 1SXCA 8RUCA 4OCSL 2AL2B 3VH8A 2DQHH 4APXA 4JICA 4KS0A 4JIRA 5DQPA 5A3HA 4L6HA 4KITB 3ZBMA 1J11A 4TTDC 3LIZA 2YAEA 3IN2A 3WH7A 1DJXA 3LDBC 4XMWA 3CL8A 3H4XA 4U6HB 2ED8A 4L8DB 1A02N 2OJPA 2OPJA 5D38A 4DXVA 2VP8A 4ZO8A 4BRVA 4R3UA 4L8SC 3UETA 5CN2A 1OVDA 3N12A 2LFEA 3T6VA 2QADC 3S0PA 4JANA 2PP0A 2XY2A 2AEOA 5EG6C 4KV5E 4XODA 3QZWA 3DI3B 4HK3J 1I9JH 1MUWA 2J57A 4PLKC 3JYBA 4OTXH 3N11A 1D6VL 4DYJA 1DE4B 1NEYA 4NQCD 4MA1C 4W7VA 1IAII 5IB4A 2R8SH 1A6VH 3FB7A 4QO1B 4U6XB 2EE3A 1QO2A 3CNKA 1JF1B 1E4WL 1AHMA 4QG9A 2DGAA 2X1SA 1QTYT 4R9OA 5EPDA 5EBWA 1U8QB 2J8GA 2NLIA 4D72A 3Q9QA 4LV4A 4KXZI 1XR9B 2DTSA 1FAKT 2EH7H 2XTJC 3FC8A 5FO8B 2FX7H 1Q8JA 3COTA 5DMLA 3EOOA 4HDIB 4B91A 5CAHA 5D4HA 3KFTA 3KR3L 4A2SA 1JG9A 2E86A 4NNYA 2CMRH 1JCVA 5E8EA 3UEZA 4OI8A 1PQZA 3H2FA 3UGRA 1KCRL 1KCSL 1P2CA 1S5HA 2CHDA 3QA3B 4V11A 3VXSB 4EE2A 5JIIA 3V0UA 1FNFA 1IQWL 1PHQA 3TBVB 4PD4J 2ZRZA 2YD0A 4F15B 1ETZA 1HJVA 2ZSVA 4ZOCA 1YLBB 3B2PA 4PRIE 1IGSA 3GLCA 2AJUL 3GW0A 4QCFA 4CNPA 3NIDE 1QFWL 3K2KA 3RGVD 1UXWB 5T1DL 2CBJA 4AJ0A 3KBJA 3BZFB 2OMBA 1GMIA 1LE5B 3WFDH 1V7YA 1RK5A 4LUTA 3RURA 1XWYA 2WQWA 3W1PA 2D31A 3CHCA 2IOIA 1WAUA 1Z3GL 1VKXA 2QQNH 4JPIA 1SOKA 3BP6A 3GTHA 4WV1B 5EU4B 5IUCA 2FSEA 3GU1A 1QSEA 2WVUA 4WEMB 2E6YA 1I4FB 2YJLA 2VDMB 3EFFA 1PZDA 3T3PF 3TO4D 1V0KA 4HPXA 3DG6A 4U1KA 4LEQA 1Z9LA 4XPHH 2IAMA 4PZVA 3GMQA 1T1YA 5CJOH 1KJ3L 2WVSA 2F7OA 3K2UL 3SGDI 3HHSA 1P1MA 1BQLL 3KYOA 1QNPA 3BANA 4X22A 1CD1B 3BUYA 4U1KB 3T4WA 3EADA 1L6GA 1N55A 2GK1A 5JNYA 1JPIA 3E8UH 3PM6A 1HVQA 4ZAKD 3FCBA 2WMPA 1S5WA 3DX9B 5EU6A 5HGBA 4LLDB 1GJIA 1U8HA 1FWXA 4KKLC 4H8WC 2FCBA 3WUEA 1MEXH 3U2ZA 3LN9A 4BSJA 1TVDA 2CD0A 3EH1A 3TWCH 5I15L 4KO5A 4WO0A 1IV8A 3CSTA 3F1QA 4RVBA 2PR4L 2R2HB 3GNPA 4A66A 3N6YA 3BICA 1MRDH 1GVQA 2Z92B 4JHOA 4KDWA 5A3IC 4FG6D 5EOCL 2WBJA 4XAFA 4UINH 1R0MA 1FNAA 3T6ZA 5BVJA 3R94A 3EYOB 3HW7A 3PBVA 1OK6A 2K3TA 4GG8B 4JGDA 1A3RL 1S78D 2FPYA 5SWUA 4HNVA 4QTFA 4OLVH 4HS3B 4OI7A 4LALA 4UNKA 2FLIA 3X13A 1NGPH 1A8ZA 2Y6SC 4HPYH 4KNUA 2EE9A 2J88L 2KZWA 2CIKA 4MJ5A 4P5TB 5FHBL 4RA0C 1C8PA 2VN6A 4O9HH 2A4AA 3N2OA 1AG6A 3W7MA 2AV7B 4KKRA 3JTTA 2EJAA 3I4KA 3HNSL 3KPNB 3M0MA 2YMXL 1M7JA 4NNXB 1OAYL 1OT2A 4ODTL 3FU3A 1KJ2L 3ARBC 5ESQA 1DTUA 4DGVL 1YMHA 4FFZA 4ZUVA 4WEEA 1MPAH 3WN5B 2A4ZA 4I87A 4U1MB 4IKIA 3MT1A 2J9XA 3O9NA 3JS3A 3QYMA 1PUDA 3CTTA 3L48A 2DL9A 3VXPA 4G80A 1YEHH 3NAAL 1GYCA 1F11B 1IGYA 3IJ7A 3TTYA 2DH2A 4G1MB 1DSYA 4EIGB 5BS0A 1DBAH 1ORQA 2OP4H 2Y36H 5KS9A 3O8XB 1A5NC 3S1GA 3RHWF 3P0VH 1R38A 5GS1B 1F76A 2WQDA 4KMTH 5LXGH 2B31A 3IJHB 5BOZG 1XW8A 5K3VA 2HX9A 4BXSV 4DAGH 1OX6A 4PSRA 3S2MA 4PBVC 2YB4A 1CICC 3CDGB 1A5FH 4DGIL 3C60D 5D7JA 1H1NA 2IEPA 1OZMA 2YFNA 1XIEA 3FV9A 4IIFA 3CDGA 1QZNA 3V0JA 2TMDA 2EE0A 3FF7A 2NW3A 1UWIA 1RZJC 4OZIE 2IQTA 3PP3H 1TYRA 2JKXA 3N1GC 1VKFA 1VFTA 3PP7A 4I4WB 2XPYA 4WOZA 2WM1A 3BZGA 3STLA 3LNPA 1HCZA 1KIRB 4X6CF 1EJRC 3CUJA 4Z7AA 4NO5B 1T8XA 1GC1L 4DO6A 2JK5A 1K4CA 1WCBB 2HT3C 1XYMA 4PUEA 4FHBD 4GP8B 1CDUA 1IEBA 2V5RA 1X8FA 5EUOA 2JQZA 2EDWA 3QUZD 4JFSA 4OLUL 4OZHE 3VNMA 4EDWL 4KK5D 4YIQA 3LJ3A 5BRZD 5BZWB 4G1NA 3QK0A 5DRXA 3S34H 3BE1H 1OP4A 1UATA 1ZJBA 4N26A 1UUNA 1TA3B 3UDWA 2WC3A 4TIMA 3VKBA 1YZZA 1PEZA 1XBDA 2AC0A 4D0CA 2Q6WB