1SZNA

The structure of alpha-galactosidase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
417
structure length
417
Chain Sequence
IVMPDGVTGKVPSLGWNSWNAYHCDIDESKFLSAAELIVSSGLLDAGYNYVNIDDCWSMKDGRVDGHIAPNATRFPDGIDGLAKKVHALGLKLGIYSTAGTATCAGYPASLGYEDVDAADFADWGVDYLKYDNCNVPSDWQDEYVACNPDFVKTGPNGTCTTALDPTLAPPGYDWSTSKSAERFGAMRNALAKQSHEIVLSMCIWGQADVFSWGNSTGISWRMSDDISPNWGSVTRILNLNSFKLNSVDFWGHNDADMLEVGNGNLTAAETRTHFALWAAMKSPLLIGTDLAQLSQNNINLLKNKHLLAFNQDSVYGQPATPYKWGINPDWTFNVTYPAEFWAGPSSKGHLVLMVNTLDITATKEAKWNEIPGLSAGHYEVRDVWSDKDLGCLSSYKAAVAAHDTAVILVGKKCQRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of alpha-galactosidase from Trichoderma reesei and its complex with galactose: implications for catalytic mechanism.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords alpha-galactosidase
total genus 139
structure length 417
sequence length 417
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2004-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17801 Melibiase_C Alpha galactosidase C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1sznA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1sznA01
4JIPA 4E2DA 1HWWA 1TPDA 3L2LA 1I2OA 2OSYA 1MW0A 1VGAA 5KINA 1DJNA 1S5WA 4N02A 2BWGA 1PIFA 1CGUA 3I7QA 1YPIA 1YXDA 1G4EA 1KM0A 4O13A 3GIYA 2ZX8A 4AEOA 3GTNA 3S2CA 4MY9A 1TV5A 1FDYA 1PJ9A 2NLIA 5CPMA 3STGA 3UY8A 1FWRA 3ZT6A 3ZOAA 1VFMA 1QI5A 4CCEA 5G2HA 3R8RA 2A0NA 1WV2A 3QW3A 4UQ9A 3GXTA 3BARA 3KRUA 3KVKA 3PWAA 3CZEA 3DFPA 4U31A 1JUBA 3LCGA 5BNKA 2Y61A 1K3UA 3NVTA 4NNBA 5A2AA 1DQWA 4O1CA 4UC5A 3E96A 3P60A 3DFOA 4D2JA 4B5NA 2X1SA 5KITA 4EWND 2ZRWA 4H8HA 3RF9A 2EGZA 4DPPA 2NUYA 1WA3A 4M5PA 1KXHA 2ZFAA 1JR1A 2V9DA 4JCLA 4DO6A 3DH7A 3VM7A 5AHEA 1VLWA 3USBA 5BOOA 3FEMA 1DKWA 1K8YA 3MBDA 4FIRA 4E2BA 1GEQA 3ATYA 1VJIA 3B8DA 4PTNA 3BAKA 3TX9A 3LRMA 4J7RA 2DZSA 2YYTA 4TMCA 1I45A 3EWUA 1JD9A 5G1YA 5BMWA 4H7VA 3G0UA 1DHKA 5I3HA 3DFTA 4O53A 1ZENA 4PEKA 2BHZA 3QH2A 3TCEA 3HG5A 2Y6ZA 3UG4A 1NVMA 1VR6A 2JKPA 2WVVB 2RHGA 3PUOA 3M44A 2YJQA 4XBSA 1LBLA 1YDNA 1IZKA 2QCGA 4FX8A 4GIAA 2ZUWA 1JXJA 2YA1A 4H8UA 1FWTA 4N6EA 3W1PA 4QAIA 2ZUVA 3FIGA 4LXFA 4DO5A 3BGGA 3W2LA 2YIHA 3UZJA 1QAPA 3H54A 4GNJA 4ALDA 5D09A 2VC6A 1H61A 3P61A 3GXMA 4UXDA 1AK5A 4A21A 3UY7A 2XIIA 3DX1A 2VFHA 6TIMA 2R94A 1KM3A 2ZX9A 2QPUA 4MZ8A 4BA0A 2G97A 2G95A 3SW6A 4JTIA 2ZE0A 3DC0A 3IIVA 5F2MA 1G7VA 4WXYA 1CPUA 4J3XA 4E0CA 3SFKA 3LPOA 2RFGA 5TBOA 2AAMA 1ML1A 4JTSA 4N9BA 2V3FA 3L4VA 1FQ0A 2GJRA 1R30A 2YSWA 3LCXA 4UFLA 3I65A 1W5MA 5AC6A 2I9EA 1TPFA 1JCXA 2ZX5A 4U33A 3EKLA 4RCXA 2EABA 1M7XA 2CZFA 3OLIA 3PUDA 4QQ3A 2HMCA 2A1YA 1KM1A 3LHTA 3QPZA 1GVRA 1OJXA 4JYDA 3K1DA 1JULA 1NSJA 2JKEA 2V2CA 1CGXA 2QF7A 3VGEA 4NT0A 3H55A 3EJUA 1QO2A 2WC7A 3UXDA 1QDSA 3GDRA 3NL3A 1WZMA 2EO7A 4FLQA 1ICQA 3G3DA 3GR7A 1XCWA 3N2MA 1OFDA 3VMNA 1Q6OA 3C2VA 3LV6A 2NX3A 5I0DA 3W37A 2E5CA 3IK2A 4IMDA 3WJSA 3W7JA 2Z6JA 2WSQA 3NPVA 4CCDA 2YW4A 1BEUA 2C6QA 3JRKA 1AVAA 5J5RA 3K8MA 1I2RA 4WJEA 3FJ6A 1QHOA 4TR9A 4J3VA 4JY8A 3UWUA 2GPTA 4LVBA 4QM1A 1VS1A 6TAAA 1Q3NA 4IOTA 1GG0A 1TB3A 4GO9A 2ZRUA 5DO8A 4AEEA 1YYAA 4GBUA 5CXPA 4IMFA 2QCHA 2BTMA 4M6VA 1LBMA 1QO5A 4JY9A 5I3GA 4Z1AA 1KFJA 3WNNA 4FLOA 2F1BA 2PWEA 1ZAJA 1F2JA 3EWZA 4RKAA 2DJLA 3L4WA 1F7BA 4MOZA 2WSKA 4UFIA 4KWWA 5I5RA 4GUGA 4I9AA 4PCSA 4W93A 3L0GA 1MXGA 3ECQA 2AGKA 1XSIA 3TSBA 2EACA 1W1ZA 4CN1A 2V2DA 1EUAA 2BHYA 1AQMA 3M47A 2ZZ3A 3A6OA 2OT1A 3DKJA 4KWUA 1LLWA 4JS3A 3BV4A 4O12A 1QI4A 3VCRA 4JFWA 1PEZA 1XSKA 2Y4SA 3BSHA 2JGQA 2XWDA 1D3GA 1HTYA 1N7KA 1X7FA 2ZZ2A 3UNDA 4K37A 1UKSA 4NJGA 4HKPA 3TKFA 3C8FA 1HL8A 4PH6A 5HJLA 1OX5A 4UTMA 3D50A 2ZXBA 1G1YA 1CXKA 4H3DA 5G4EA 3G1AA 3L21A 4J9JA 2DIEA 1G4PA 3EWWA 2TYSA 4X22A 1H1YA 1PVNA 3WFAA 1UD5A 3QGVA 2J24A 1TTJA 3RLVA 2ZA2A 3NM1A 3LXBA 1IZJA 1IGSA 2WOQA 1F74A 2X2IA 1ZJIA 1KXTA 3LTSA 5EL1A 5AB3A 2E1DA 3OVQA 2D0FA 4GWEA 2FTPA 5CPOA 4ATWA 3FA5A 4A2RA 3ZT5A 2ATSA 2QCCA 2ZUUA 1SFLA 4Y6GA 1W5OA 3DX3A 1TQXA 1YTDA 5KZEA 1RPKA 2NXIA 1E40A 1WO2A 1VHCA 2I14A 2V8ZA 3LTYA 1OSEA 4O14A 1KWKA 5U4NA 3TQ0A 3DX4A 1KBBA 1YADA 3NGJA 1Z41A 1ME9A 1W3NA 4G1KA 5DXYA 3WK2A 1OYAA 1IV8A 3TW6A 4N4QA 3LXCA 3C0JA 3O8AA 5EKYA 3G18A 3PSVA 3W1QA 3FJLA 5KTLA 3NAVA 3MBFA 5HMSA 3LXAA 1M7PA 2GVYA 3C61A 3GAYA 2PCQA 4PEEA 1ICPA 4EIVA 2E5BA 4K8HA 3M5ZA 2EHHA 4BR1A 3EX2A 2VRQA 4MLJA 2E8ZA 2VUYA 5G4WA 5E0FA 1SPQA 3QC3A 3BLFA 4UTKA 2DZWA 1GVSA 3NQVA 5F1UA 1KBKA 1WAUA 4S2BA 2H3BA 2WO5A 5F4XA 1JCNA 1P0NA 4J3UA 1W56A 4U2YA 2Y7GA 1NF0A 2ALWA 2ZTKA 1EIXA 3L5AA 3EJRA 1X1ZA 1SO3A 3QSTA 3ZS4A 1K8ZA 1CYGA 3BAXA 5EMUA 1MEIA 1VB9A 5E93A 3VSTA 1JIBA 1V3LA 3SGUA 2B7PA 2C8NA 3PVFA 2YOCA 5EA9A 4GC4A 1NOFA 2WVSA 1TYGA 5CKSA 2CPUA 1OFRA 4HSOA 1TQJA 3M5YA 3W9ZA 2CU0A 1J0KA 3N34A 1Y7VA 3W76A 4CQ9A 5AFDA 4UQBA 1OT2A 1A5SA 1OFEA 4LVAA 2ZX6A 2B7OA 4LT9A 5LHEA 3LTPA 2FH6A 3HG3A 3P74A 3IGUA 3KL3A 2FE0A 1H1ZA 2ISSA 3HPXA 1JI1A 2EEXA 1TRDA 4AH7A 3M16A 4KMQA 2BY3A 5EY5A 5A6LA 5U7SA 3PAJA 4DBEA 3C4UA 4O16A 1XFBA 1LROA 1MW3A 3OLEA 2A7RA 1YTEA 4DELA 4Y96A 1W8SA 5C6MA 1E3ZA 1OG0A 4UQDA 1QR7A 1F05A 3P8JA 1KBIA 4H2CA 1ODUA 3G8EA 1ZNNA 1B0IA 4ZL1A 3L4ZA 1WBJA 4FHAA 3UERA 1G9HA 1KM2A 2R8WA 1XUUA 2OYLA 1Q6QA 3NL2A 5BRQA 1Y0EA 4PSRA 3VE7A 1O5KA 4RZ4A 3NXFA 2FGZA 2PWGA 1CXHA 2VKZG 4AYGA 2FPTA 2NZLA 1GQNA 1TSIA 1J4EA 5FEPA 3L4TA 4P61A 3DDFA 3HGJA 3KRZA 1RV8A 2FB3A 3G0SA 2E09A 3VX1A 2QMKA 2YYUA 5FF0A 1S5VA 3ZWSA 1LBFA 3WN6A 3RMJA 3HO8A 5FI8A 4TMBA 3OVRA 1A5AA 2VFEA 4LW7A 4M8UA 3GZ3A 5KZMA 4R7JA 3WNLA 4ORIA 2XVGA 3NPUA 4O1DA 2EPHA 4MUZA 4CNOA 3W1XA 2FHBA 3DHUA 2WPBA 1L9WA 3QMTA 5AHMA 5DCEA 1ZY9A 1HVXA 4AIEA 2FH8A 4E2OA 2ZZ6A 1QPRA 4MB1A 3HJEA 2VEPA 2BX7A 2DP3A 4WX2A 1JVNA 3SZ8A 3WK1A 4R53A 1EO7A 1PAMA 4O4VA 3C2EA 1N8FA 1BLIA 3UWWA 3VKJA 1D3HA 3A22A 4JX6A 2F7PA 3H53A 3EJQA 3LX9A 5I23A 1QOQA 3TFCA 1RPXA 3A23A 6CGTA 4JTGA 3EWYA 3DENA 5DFAA 3QYQA 4ORMA 1O60A 3Q2DA 4RR4A 1JRBA 4M6PA 1XV8A 1W0MA 5HWMA 1EP1A 1A50A 4AEFA 1KM5A 1QPNA 1G5AA 4H6KA 1T99A 2CW6A 2Y89A 2ZDRA 4U2ZA 2XN1A 1ADOA 3G1XA 4AIOA 3GK0A 2E4TA 3LM7A 2WVVA 1BWLA 1HO1A 4N6FA 4FF7A 4WUIA 2DZVA 4S1FA 2NUWA 5DY3A 2P10A 2VEMA 1UD2A 1VAHA 3NQEA 3HOJA 4GQQA 3D51A 2OJPA 4LC6A 3EDKA 1CGWA 5K4XA 5D38A 3G0XA 4NXKA 1KWGA 3F4WA 3CTTA 3QQ1A 4LUIA 3PBVA 4XTIA 3A9IA 3KXQA 3L67A 1R47A 1O94A 5HR7A 3VGHA 3NPWA 3TJLA 4JICA 4OU1A 3C56A 3FYPA 5C5YA 1PE1A 1OFBA 4HOZA 2BY2A 3WNPA 4O1BA 2RDUA 1TPUA 2ZXDA 3NM3A 3M6YA 3ZFHA 2PURA 3TXZA 1BWKA 2W6RA 3E02A 4FXRA 4OGZA 5BRBA 5E1QA 1FX6A 4DF1A 1AL8A 1K7XA 3DHFA 3W1AA 4ZQRA 3CB8A 4JFVA 2EJ1A 4UTWC 4UUIA 5FEWA 1H7PA 3MP3A 2CWNA 1UH4A 1OYBA 3G1DA 3FLUA 2A7NA 1OX4B 3G1SA 4WF7A 2CXGA 1G7UA 5F2GA 1LOLA 2QJHA 1OK6A 3NQ8A 2QEZA 4IJBA 2ZRYA 4OQVA 3IIOA 4M56A 1QW8A 2CFFA 2JGYA 4KFNA 3W2MA 3AMKA 3EWBX 2J25A 1G6CA 2VFIA 3IJ9A 4JTHA 4ICNA 4O15A 2RDWA 1CXIA 4OKDA 2QDHA 1ZJBA 4MJZA 4UTHA 4AWUA 4HSNA 3W7NA 2X1RA 3AJ7A 3BW3A 4HPJA 3LPPA 3KL5A 3KLLA 2VT0A 3UG5A 1KA9F 5ABTA 2GQ9A 5HUPA 1QHPA 4OJYA 3DKLA 9CGTA 3B04A 1EWDA 3MP5A 3BCFA 3KAOA 3MYOA 2X16A 2XVLA 4JEQA 1CLVA 1KCKA 2E9BA 3SGZA 5LKYA 4FMVA 3BVXA 1THFD 2ZZ4A 3Q37A 4QITA 1Z32X 2VXNA 3IJ8A 5E70A 4BI6A 4L4MA 3EX1A 4UR7A 4K6AA 3KEHA 1TPC1 4UQEA 4MYAA 1KM4A 4LPCA 1UA3A 4O8RA 3TA6A 4RZ5A 4N2YA 2QPSA 2V0TA 3C2FA 3GXNA 2ZIDA 5HUOA 1LCOA 1VLIA 3QSRA 2RH9A 3KHJA 1CXFA 1ICSA 3QW4B 4RXFA 1B57A 4PFMA 4IPJA 2V5LA 3BLEA 3TIMA 3KX6A 1OFOA 3DI1A 4FB7A 1EX5A 2FIQA 2BLEA 3T55A 2WNZA 3OLGA 1WX0A 4FX6M 3FKRA 1G4TA 2UV8G 4CN6A 1WOAA 4GQRA 4YMZA 1WXJA 2CZDA 3FFSA 1GCYA 3R2GA 1XBXA 5BRPA 2FHCA 1GVOA 2DIJA 1W37A 4JFSA 3GDLA 3L2MA 3STCA 3NR0A 1EB3A 4DO4A 3WY2A 1TPWA 3KVLA 5AYXA 1LM1A 3ZR4A 3RLUA 4O57A 1RP8A 1EHAA 2WANA 2CLHA 3NL5A 2OZ0A 4IQLA 2TSYA 2V5BA 1RR2A 2NV1A 3FKKA 4O4WA 1LZOA 4O0KA 2YCEA 2NX1A 5F4SA 3W7HA 2C1HA 3UXAA 2ZBTA 1RD5A 4Y8FA 2VNCA 4X9SA 3P5ZA 3W1NA 2OCZA 1BSIA 1W9XA 1PZ2A 3PBYA 1MW2A 4JTEA 4XQ6A 4UQAA 1KFLA 3VX0A 3MHFA 1OX6A 2PWFA 3P8IA 1TJPA 3GNNA 3MJYA 4FO4A 2BXZA 1Q45A 3TQVA 4UTLA 4OV4A 1H63A 5A8GA 1I2NA 5K4ZA 3W2JA 4Z1BA 2FFCA 3L4YA 3EDFA 3LCHA 2GQ8A 4WY0B 3BLKA 2WKLA 4FNUA 2YKKA 1UOKA 1H7RA 3OBKA 2G3NA 3TJXA 2YPIA 1GWJA 4ONVA 3W2KA 4JX5A 2TMDA 3P84A 1H3GA 1L6WA 4ADSA 3CEPA 4I7VA 4GUJA 5E6YA 2E5DA 3GVGA 2ZRXA 4Y90A 5C2XA 4NJIA 1JCYA 1O95A 4MYXA 4K39A 3HMJG 1DEDA 2OW6A 3WDJA 3GB6A 3NQDA 2V82A 1I8JA 1XDMA 2EAWA 1L2UA 4Y9AA 3S8HA 4K7VA 3AO0A 3TUUA 2QR6A 1TTIA 3BW4A 4Z08A 1VFUA 3DDGA 1ZAIA 1Q6RA 3CGTA 3ELFA 3L65A 3LRKA 1EO5A 1R2TA 1JCMP 2WSPA 2Y5EA 3PS7A 1WQ5A 4JTJA 3MW7A 1MXDA 1TQSA 1GPWA 4YCPA 1W3TA 3A5VA 4CCCA 3BVWA 3AMLA 3WK3A 4HNVA 5MHBA 3VGGA 2O7SA 2V81A 3CV5A 3THAA 4J3SA 1CW2A 1FCBA 2ZICA 4XKYA 4CGTA 1SO4A 2Y70A 1KFEA 4O17A 3S5OA 3M9YA 5DN1A 3W2NA 1SSGA 1EWEA 4ZVJA 1K7FA 1NFBA 4MAZA 3WEMA 3NDOA 1V5XA 1UD4A 1XSJA 2ZUSA 4GXMA 3HJZA 2NX9A 2I1OA 3ANYA 4TO8A 2NT1A 5I3KA 4C1KA 1ME7A 3W88A 1F76A 7TIMA 3VSUA 3B06A 3UPWA 4UTWA 3HZ3A 2H8ZA 3BVVA 4ZQOA 2C3ZA 4KFPA 1DJQA 2QAFA 4MFDA 1SUXA 4FIQA 1V3KA 4LVGA 1A47A 1PCWA 2V2HA 1QOPA 3LHWA 3TR2A 4UCFA 4WD0A 3VU2A 3W74A 3L4UA 2FLIA 5DBUA 3DHDA 3KE0A 2QV4A 3MO7A 5HNRA 3QEZA 3MI3A 3KFTA 3GXPA 1F5ZA 3F1QA 3WNOA 3W22A 2OSWA 1FCUA 3PR2A 1LDCA 2Q8ZA 1VCFA 1SR9A 2CLLA 4HHPA 2GJNA 4A22A 3QRHA 4XZ9A 4AXKA 1PL9A 4NXSA 1ZAHA 1D9EA 3Q94A 1TTQA 3WNMA 3G24A 5CSRA 2NSXA 1B2YA 1VCVA 1JF6A 5IBXC 4XB3A 1LYXA 2FJKA 1K8XA 1Q6LA 4IPIA 4GI6A 3VE9A 4PCTA 4JIQA 3QQ0A 3RK8A 2Y2WA 4FNQA 3LB0A 1W5NA 5G2IA 3O6CA 2P1FA 1V7YA 1VHNA 5LZLA 4TX9A 2ZCGA 1CIUA 5HULA 4U4MA 3WJXA 3WDHA 4JYEA 2DH3A 2GJPA 2WNWA 2BY1A 1EA9C 3ZR6A 3T4CA 3K8LA 3WMSA 5G5IA 5TIMA 4HPHA 3M7WA 4JN6A 2LLEA 4GUFA 3V75A 1XD1A 3GDMA 3BUBA 1UH3A 3U6WA 3OEXA 5F2IA 2OSXA 5CGMA 3LHZA 2A4AA 3G22A 2XWEA 2E6DA 5D32A 7CGTA 5C55A 1W5QA 3LBMA 5KZDA 3TMQA 3L66A 1JG9A 1Q4NX 7TAAA 2OX1A 2JBMA 2Y7EA 2E6FA 3YPIA 3BUQA 3HF3A 3MWAA 1MW1A 3W1LA 1O5XA 1R46A 4PCFA 4AYSA 1TPVA 3NQGA 3CZLA 1ZALA 5AYZA 3VFLA 2ZZ1A 4GUIA 4FNTA 1QWNA 3P80A 1UD6A 1JAEA 3LV5A 3EJPA 3VMOA 5DCBA 3WJZA 1R2SA 3LDVA 3W7IA 2E68A 4X9YA 3NG3A 1G4SA 3BCDA 1T0OA 1X6UA 3P62A 4GRSA 3BLBA 3ZQ9A 5E6ZA 1TQUA 3MHGA 1BG9A 1FBAA 3GX9A 2Y88A 3W7DA 1VJSA 1XH1A 1UH2A 3WY3A 3TK7A 3O6DA 3CZGA 3PG9A 3EXSA 3G1HA 3R12A 4K36A 1CGYA 2YW3A 2ZQ0A 3RNDA 1LWJA 5D05A 1AQHA 1J0IA 2H6RA 1DQXA 2E6AA 4NUWA 3W3OA 1QNVA 1OT1A 2QKFA 5H2ZA 3QF0A 3PUEA 3QMRA 4DEFA 1PCKA 1TJRA 1IXOA 4N9CA 2ISVA 3PBWA 1TQWA 4UNIA 2CZ5A 2HTMA 1BAGA 3CZSA 4MJMA 4X3ZA 1A5BA 3CIWA 4MVAA 1DORA 4UIOA 3ZO9A 4HP5A 4UTTC 3DFSA 2EAEA 4NI3A 1V3MA 3WEOA 4RX0A 4A29A 3O6YX 4BF9A 3W7GA 3S0CA 2GUYA 4LNYA 1OF6A 5CPLA 1EUNA 1QPKA 2YR1A 1OF8A 1LRTA 4HOXA 3M0ZA 1SW0A 3W84A 3E49A 5I3IA 4JL1A 1MFUA 3L0NA 4DBDA 1PHQA 1GVFA 1XCXA 1J2WA 3ATZA 1GYNA 3W07A 1SO6A 1SSDA 2WKJA 3ABRA 3T40A 1BVZA 2VFFA 2J9YA 2C15A 1G94A 2HS8A 3KWXA 2GVLA 5DLCA 1KW1A 2Q3OA 1G67A 1KTNA 4UFJA 4YCOA 1EA0A 1VYRA 4IMEA 4AF0A 2J88A 1O7DC 4POCA 3PC0A 2DJXA 3DI0A 2DU2A 3CPRA 2FPVA 1B4EA 1M6JA 1JDDA 2H3DA 4OV9A 4O10A 2ABAA 4C1LA 2NXHA 4QJ1A 1LORA 1GYLA 3DFNA 1XKYA 1IF2A 4GINA 3SECA 2PC4A 4JTTA 3W23A 2WV8A 4R34A 5D2WA 1OX4A 1TRIA 4JNMA 1KV5A 4UNLA 1PZ3A 1TPB1 4UFHA 1I2QA 4NQ1A 1CDGA 3BG3A 1KXVA 1SW7A 5T26A 2ZZ7A 5HINA 3TDFA 4CNPA 2XN0A 1XBVA 1UJPA 5K2ZA 3HQ1A 5HXMA 1MEWA 2QCDA 1XCFA 3TSDA 5TQLA 1JQXA 3QZEA 2ZA1A 3GLCA 3F03K 2ZRVA 4HNTA 3EXTA 3EEGA 3CM4A 4DPQA 1M53A 5A2BA 3NEVA 4UFKA 3V1PA 1UD8A 1QWGA 3VSVA 1JI2A 3R89A 1K7EA 3O63A 2XN2A 2Y62A 1I4NA 3C6CA 3A5FA 3G3MA 5DCDA 2GJLA 3S1WA 3THQA 3W2UA 5D2VA 3M43A 3SR7A 3CU2A 4NJJA 2AQWA 4Z1DA 4BZYA 3NZ1A 1SMAA 3CPUA 1XI3A 1OHLA 2H90A 2J9ZA 1RZMA 3B0PA 3GDTA 3WDIA 3MHUA 1MO0A 1VZWA 1HUVA 1IIHA 5CG7A 2Z6IA 2QCNA 1VC4A 5LNSA 4LUJA 3CZNA 2F7RA 2YFNA 1H5YA 1TIMA 4O50A 5D30A 5L9FA 3S6DA 3R5EA 4AMAA 3PB2A 2IQTA 1U33A 2F18A 2GUUA 3ZR5A 1NM9A 4NJKA 5K9CA 1P5BA 1ZHAA 4QIUA 2PWDA 3U8GA 4YLWA 3OA3A 1AW5A 1C9DA 3D0CA 3KVJA 2QAPA 4WSJA 4HNUA 1J5TA 2TPSA 4M7SA 8CGTA 1BF2A 4EF8A 1JGIA 1YXCA 1YXYA 1BPLB 4LQ1A 4U3CA 2VEKA 5F1VA 5LGZA 3HGOA 1BKSA 1E51A 2D73A 1NF7A 5C54A 1CX9A 5I3JA 4PL2A 4PA8A 3VNYA 1FXQA 4Q32A 4X2RA 1DBTA 3TE9A 3IVSA 4XWUA 1U30A 2A6LA 4CLMA 1QPQA 2Z1BA 4MFEA 2ZWZA 2EKCA 3RFAA 1U83A 2X30A 2OW7A 3IIPA 1VFOA 3UD6A 3W7MA 1B4KA 1UUOA 5F7UA 3CQ0A 1VYPX 4E38A 3R13A 2YDAA 4WOQA 3EX3A 5DXXA 1TO3A 1RQBA 2B4GA 2RKXA 3FS2A 1JUEA 4HNNA 5EPDA 5D02A 1AW1A 3S1UA 4CN4A 1Z42A 1T8XA 3DX2A 4ZZ9A 5KMYA 4NZJA 3IIZA 3KVMA 5CZTA 1VIWA 5HPOA 3P81A 5HWNA 2CLEA 4ZQNA 5HWJA 2A7PA 1YDVA 2PRMA 2VOMA 3I7SA 4IUOA 4LY8A 4TVUA 2WPGA 1TTPA 4EOUA 3EDEA 3EX4A 2DZTA 4EF9A 1KLYA 3DFQA 3MMTA 2Y7DA 3EB2A 1GZGA 2Q8LA 5HR6A 3W1TA 1JXKA 4QISA 3GBEA 3IVTA 1SFJA 5BW6A 4JYFA 4HN4A 2PE4A 2QDGA 2ALDA 4O54A 3IV3A 1F73A 2F84A 4P2VA 1M7OA 3LRLA 4MZ1A 1IXPA 5AOUA 3TROA 1FDJA 3B05A 2CLIA 5BMXA 2OT0A 4YWIA 2E8YA 2C14A 4WOZA 1XGZA 3IIXA 4AB4A 3CLWA 1AMKA 1KBJA 3MYPA 2P0OA 5FF7A 1IXQA 3STEA 4LC8A 3CWOX 3I6RA 5G2WA 3LHUA 5EBUA 2YZRA 1E3XA 1VRDA 3BPWA 2F2HA 5EYWA 2PWHA 4AHPA 2ZXQA 1WZAA 2ZZ5A 5KEZA 3N9RA 4LTSA 1XH2A 4LS2A 5EMYA 1IIGA 1Z48A 3W7KA 3MUXA 1V3JA 4GFSA 2QUTA 1I75A 1RVGA 3TU9A 1PIGA 3D4YA 1MVYA 4N9EA 3KOFA 3EJSA 4UMCA 3O05A 4QAWA 1F6KA 5HDRA 1U5JA 2VFGA 1C29A 4GKLA 4FLRA 2ZUTA 4QNEA 2CLKA 3ZSSA 3NNTA 2H8XA 1LLZA 3LHYA 4BFAA 5AC7A 3W71A 1UKTA 3IVUA 1QW9A 1GOXA 2X2HA 3PG8A 3DU0A 3GKFA 3N19B 3S9YA 2QJGA 2NWSA 3WELA 4JR5A 5D03A 4UR8A 4LS0A 3O15A 2VENA 3L2IA 3BAIA 3HGSA 3IRDA 1EH9A 4HT3A 2WVUA 3UEQA 3W75A 5IM51 1H60A 3RU6A 3TC6A 3C52A 1O4UA 3GNDA 4JTKA 3VI2A 3UPBA 4CVWA 1P6WA 2A2IA 4UCGA 2HS6A 3HB9A 5KSWA 3UWQA 4MY8A 2D3NA 1HFBA 5FEZA 1OFQA 2Y7FA 4S2CA 1U2YA 1K03A 2YA2A 2QJIA 2QUVA 4H8VA 4QNWA 1S3HA 3E12A 5D04C 1CGVA 1W54A 2E0PA 1JL8A 3LCFA 3BVUA 3BK0A 5F4WA 1ALDA 4JX4A 3WENA 3N73A 3BVTA 3TQKA 5LNRA 1FXPA 3EDDA 1D3CA 4FNRA 3WY1A 4LRSA 4XUGA 5D37A 2D0GA 3B4UA 5J5DA 1KFBA 1OABA 4FX7A 4B9YA 4IWWA 4NZFA 4N4PA 3DBPA 4ZQCA 4DQWA 3GXDA 5LNUA 4PODA 4O1AA 1FWWA 5CGQA 2ATMA 4XTDA 3L4XA 2WSYA 4AF0B 1TV7A 3OVPA 2F7FA 3NQFA 3FAXA 1ZCOA 3BUIA 4HIBA 3W1RA 5AC8A 1JCJA 4O0ZA 3W7EA 1W5PA 3DAQA 3T44A 4K7YA 4WSKA 5K3VA 1UA7A 3TMLA 3QPYA 2GVJA 1J0JA 3MI2A 3L68A 3TV8A 1SU5A 3W7OA 3CTLA 3DGRA 1LTDA 1JD7A 3T78A 1XL9A 4AMXA 3N14A 2JK2A 1TV8A 4WXZA 5I24A 4TIMA 5GVJA 1GTEA 2DH2A 3GAKA 2Z2UA 4NVTA 5TD4A 3NL6A 2J6XA 3G1FA 1I2PA 1L6SA 4GI8A 2F7OA 1KM6A 4IX0A 3HGRA 3W87A 3C2OA 2Y85A 1QI3A 1VQTA 3TNOA 4IMGA 3C3NA 1DOSA 1WDWA 2DZUA 3II1A 1HL2A 4RLIA 5AYYA 2NUXA 1RP9A 3TTSA 4RXGA 4Q4KA 3VNDA 1MZHA 3VGBA 4UFMA 4A3UA 3NQ6A 2WSRA 5CSSA 4TU1A 3WJWA 2GVGA 4OWGA 1KXQA 2XFWA 3LOTA 3O16A 1WZKA 2GQAA 1OB0A 3BH4A 4DXVA 4LV9A 2FDSA 1LP6A 4U28A 1RQHA 1GJWA 1XDLA 1R34A 1ZS2A 3MI6A 4WZHA 1KGWA 1DVJA 1H7XA 5H91A 2PRLA 4UQCA 3G1YA 4R33A 2Z0IA 4RZ6A 1UKQA 3HPZA 3LBCA 1SW3A 8TIMA 1P4CA 3EKZA 1T96A 5LGXA 1D7FA 1X8FA 1LOSA 3BW2A 4KFOA 1DL3A 2QLYA 1H7OA 1MSSA 2B7QA 3RILA 3OLDA 1UB3A 1FWSA 2V3EA 1ONRA 4DF0A 5D33A 3PULA 2BHUA 4UZSA 3W70A 2YFOA 2FYVA 3A4AA 2BXVA 4NNAA 1E43A 2ZWYA 3SJ3A 2WJZA 4WY0A 3CHVA 3INPA 1PIIA 4UTIA 2BSLA 1DTUA 3BGJA 1H51A 3EJTA 2E6YA 4IX2A 1KGXA 5A2CA 2CHNA 3P82A 5AHLA 1HG3A 3TAOA 4BWLC 3HPSA 4XBKA 4LS1A 1VH7A 4NX5A 2IGTA 4K8EA 1JQVA 3G1VA 3LI0A 3IEBA 4CNNA 4H4IA 2G5WA 4K38A 1QX1A 1HNYA 1PPIA 3KRSA 2X2GA 1GTHA 3QJAA 4IXXA 4RV8A 4J3WA 4FNPA 2O7QA 5LNWA 1QFEA 5LSMA 2ISWA 2WNNA 2X2JA 2Y63A 3GDKA 4O19A 3BAYA 1TCDA 1L6YA 3NYZA 1OK4A 3CIXA 5G1TA 1GVQA 3TFXA 2FPYA 3B0UX 1OYCA 1UUMA 4LU0A 3VM5A 4UOZA 4MKNA 1TQVA 2W79A 3W7QA 4JCMA 4OT7A 1R33A 3S5ZA 2KZHA 3W7CA 1TPH1 4WLCA 1K02A 1EP3A 3DHPA 1WE5A 3PSWA 3BUPA 1LRNA 3BLIA 3IGSA 1XD0A 3UWVA 2Z1KA 4AW7A 3DX0A 3HBLA 3LCIA 3SSJA 1ZFJA 2WKGA 1FY6A 3W72A 3UWZA 1GVIA 2QCFA 4M19A 5K9XA 3P67A 4EVZA 1UASA 4OBTA 3S42A 2V3DA 4IMCA 2QCEA 5CZ0A 4Z0JA 1A5CA 1EPXA 4MLRA 1DV7A 4MIMA 4JGDA 3AXHA 3A21A 5E9AA 1UBSA 1OFPA 3L5MA 3PB0A 2CLFA 2QUUA 1JCLA 1WYIA 4OIFA 2NT0A 3A47A 1JJKA 3N9SA 4FEZA 1KCLA 3EWXA 3TH6A 2VRKA 1WZLA 3W38A 1GT8A 1MFVA 3N3MA 5SWUA 4PSPA 4AWSA 2J27A 2HSAA 1C8VA 4JTUA 2D3LA 3K8KA 2RDTA 4NU7A 2BXYA 3LCLA 4BWLA 3B0VC 5CLTA 3EXRA 4WY0F 3BAJA 1KTBA 4IGHA 3S1XA 4LRTA 1TREA 3EX6A 4Z0SA 1XM3A 4RJEA 2A21A 1WOBA 4JTFA 2QCLA 4PL1A 1SZEA 3QMSA 4ZQMA 3UG3A 2A85A 5CZSA 4CQAA 3W7LA 4UTTA 1KV8A 1W3IA 3CT7A 4HOWA 2W0UA 3BVJA 4GI9A 3P5YA 4LV4A 1HXKA 4NX0A 2C19A 3M5VA 4AMWA 3GYEA 3DZ1A 4BK9A 1MXSA 4DF2A 2V30A 2AAAA 3BC9A 4JFUA 3WFZA 3S5NA 2QCMA 2C18A 3HIJA 2OYKA 1H50A 1JFHA 1OGSA 1Z44A 3BMVA 3AXIA 2YXGA 5E0KA 1PV8A 4KKXA 1LRQA 4LVDA 1HL9A 1S5TA 2NXGA 3BG9A 1JDAA 4KWVA 4W9TA 1SO5A 3LCWA 4LVFA 3NQAA 4JD4A 1GJPA 1PS3A 1KTCA 4FNSA 3AJXA 3NQCA 3WY4A 2CLOA 2VFDA 1GJUA 3CC1A 4O52A 2Y24A 3OHIA 2XIBA 2A6NA 2WNQA 4ML9A 3ZWTA 2TRSA 1HX0A 4ADTA 3JR2A 4I7UA 1BVNP 2QMJA 2ZXAA 3VMPA 2G3MA 3ABSA 3UQNA 1YLVA 2OYMA 1XUZA 1M5WA 3CLMA 2WVTA 2R91A 1PHWA 1N55A 1XC4A 1YDOA 4O11A 2C16A 2NV2A 3W83A 3FYOA 3IGXA 3S5YA 1AMYA 4CKQA 3UWYA 2EQDA 3N2XA 3W1MA 5L6UA 4IXHA 3W85A 5AN7A 5K9DA 1TMQA 1UCWA 4WQ6A 1XH0A 2AMGA 1QPOA 4GE8A 1CI1A 1SZNA 5D2TA 5DY2A 4I7WA 2XVKA 1GG1A 3HG4A 2TAAA 2DZXA 3I68A 2ABBA 4MY1A 4GO8A 1QCWA 5AHNA 3K30A 2CZEA 1XBYA 1JF5A 1J0HA 4RK8A 3O06A 3ZSTA 4PC8A 1B9BA 3LHVA 4O28A 3HG2A 2YA0A 1CXEA 3SI9A 3P7YA 3M5XA 2Q3RA 1SZFA 3VNZA 2ZTJA 5CZJA 5DELA 3GBDA 2B7NA 3I7RA 4JFTA 2G96A 1S46A 1A53A 1CGTA 1YTKA 3G8RA 3LI1A 4Q33A 3TONA 1BTMA 3SIZA 1JRCA 4ADUA 1PS9A 3LGEA 4XKYB 3BAWA 2R14A 3WJYA 2FB2A 1WPCA 2QCDB 5I3FA 1X1OA 2ZYFA 3UYCA 1VCGA 4CQ8A 5A6MA 4M7TA 3BMWA 3IJ7A 2C0AA 1EP2A 1RQEA 2FQIA 2CLMA 3STFA 3FW6A 1SQ7A 2JKAA 5CGTA 3OG3A 3TC7A 1C8QA 2VELA 2X1UA 3LERA 3VGFA 3TAKA 3KL0A 1H7NA 2C13A 4OE7A 3NO5A 2VR5A 3TW7A 1IXNA 4UTJA 3TXVA 4FLSA 1WP6A 3BUDA 4UMBA 1MWOA 4JXCA 3PF3A 3M41A 1UD3A 4NNCA 5FF4A 3WNKA 3LLFA 3M07A 1FUYA 5FF3A 2F1AA 1H62A 3NZRA 4HPXA 1R75A 3DXIA 4UZUA 3W6YA 5LHFA 4JTLA 2GOUA 2DZPA 4L4LA 5K7JA 3W73A 4B9ZA 3VGDA 4AHOA 2FHFA 5HQEA 1OVDA 3BG5A 4Z1CA 3GKAA 3PY2A 1XBZA 1KFKA 1R2RA 4GJ1A 5F2LA 3WK0A 3LLDA 4N9DA 4JDYA 4LWWA 4BI5A 1DHPA 4OHQA 1HT6A 3E9AA 3JS3A 2YGYA 5AHIA 4YL2A 4UNKA 6ALDA 3CZKA 2D2OA 1TMHA 1FWNA 3UCQA 3S1VA 3BLPX 4JL2A 1HTIA 5DBTA 5D2XA 5FESA 2F7QA 3F4NA 3BO9A 4ZQPA 1FDZA 1TCMA 3CWNA 1YPFA 1KB3A 3GR8A 3BSGA 5FF2A 3B03A 3L5LA 3TTYA 3FOKA 5CLWA 1JUKA 4M6QA 4GUHA 3NA8A 3NQ2A 1AW2A 3ZT7A 3C2RA 1TPEA 4FXSA 3U2OA 1FCQA 3VO0A 1NEYA 2WQPA 4QSHA 1HO4A 3T7VA 2BZNA 1OFAA 3UZ5A 1JDCA 2F61A 3FAWA 5FEXA 3QFEA 1QWUA 3O1NA 3EDJA 3QM3A 2ZX7A 4J27A 3NQMA 3Q58A 2WCSA 4YXGA 1ME8A 2BY0A 1SZGA 3GXFA 3NQ7A 4O18A 2J9XA 2YX0A 2NWRA 5A5WA 1F6PA 1VYSX 3D52A 4AHQA 5LNVA 5D2YA 4AWTA 1CXLA 2E77A 1MEHA 4AVFA 1W31A 2EF9A 4MZYA 2DORA 3GXIA 1WBHA 1KFCA 4AAJA 2OMAA 3NOEA 4LOCA 1AG1O 3W86A 1L0PA 2VEIA 3O07A 5AHFA 2EADA 3PBUA 2D0HA 3ABQA 1SMDA 5IBXA 4UMAA 4ZMGA 2ZA3A 3ABOA 1G69A 5CPNA 1P0KA 4UOQA 4NJHA 3W1UA 1KGUA 3KLKA 4HA1A 1QMLA 3L9CA 2WCGA 4J3TA 4J28A 3MP4A 2ZRZA 3OIXA 1ZJAA 4BI7A 1LOQA 3L0KA 1XXXA 3RIKA 3NPXA 4X0NA 1NAL1 1P1XA 3TOPA 3CEUA 3SY5A 4MPQA 1H7WA 2B0MA 4A2SA 2A5HA 4JDBA 1AL7A 1VPXA 1EEPA 2C7FA 3TSMA 1LWHA 1B3OA 2X1TA 3A24A 3D4ZA 1TQTA 1KLZA 3E0IA 3M1ZA 3PM6A 3W7RA 4UTUA 1FCVA 2PRHA 3W7PA
chains in the Genus database with same CATH superfamily
4Z7VB 2JB5L 1W8OA 3DRQB 2QADC 4JGJA 4DJDA 5HHOB 3RZCD 3PWJA 1I2OA 4A2MA 1TFPA 2K6ZA 5T8GA 4YDLB 3DV4B 3HE6B 3IFOB 4ABVA 4XBEH 4ZMPA 2R6OA 4RDWA 4Z3TA 3VFCA 2WLZA 1VGAA 4HHMA 3WH9A 3ESMA 3BRDA 2QDVA 2BWGA 4OVUA 1JDEA 1HDMA 4CVUA 4E9YA 1YPIA 1G4EA 1KM0A 3K72A 2X1PA 3MBWA 2OQJA 4G11A 4XC1H 4E5XB 1M65A 1KBGH 1SDDB 3HZKA 4PJGF 1Q6CA 5A8PA 4UT6L 3QFJA 4FI6A 2GJZB 2WWDA 3ZXAC 1V6TA 4JLRB 2NLIA 3STGA 5KVDE 2J8FA 4A55A 4AENB 1SQMA 2J6VA 3N2TA 4LGPB 3E80A 5E7FA 1QI5A 1MI3A 5C8BB 5G2HA 2EYRB 2YCLB 2O6FA 4UBDC 1AHWA 5JMOC 2CXEA 2CBOA 3OKNB 1GOMA 2YD9A 1XDJA 1HESA 5BXFA 3LZRA 1MRCL 4LAMA 4YHIB 1VFAB 3FFCA 4DJMA 1BBJA 3IU3A 3GXTA 3MACL 1UPPA 3ZYOA 1E8YA 4XOEA 3U0PA 2B8OT 3KRUA 4HAKA 1A66A 3Q2LA 1JUBA 4RE2A 1TCRB 3MCKA 4YL4A 1KJMA 2K7QA 5E94A 2VDKL 1O7AA 3K2UH 1IEWA 1FRGH 1PJWA 1P9MC 4S3GA 3UTSD 3VRJA 2X6VA 1VFBA 4F91B 4LKCA 1EOKA 5D6CA 1BVWA 4R5XA 5DJ2B 4R3SB 5GRVK 5L0QB 3N25A 1SM9A 5KITA 3OQRA 2IG2L 1WAAF 5F96H 2VH5H 1VRSA 2GAZB 4H8HA 1GXEA 2JTDA 3RHGA 3ILDA 4LSRL 3ZHLA 4OR1A 1KXHA 3OHXC 3QA3B 2ZFAA 2A0LC 3MLZL 4DO6A 2C3XA 3VM7A 4WFHE 3V9EA 1YE4A 3FT2A 1F97A 3BYTA 4KQ3L 3USBA 1RLDA 1BYNA 1CVRA 4RFEB 3QEQB 4QEGA 5J8LA 4FIRA 1Q0XH 3Q13A 4ORZC 5C0RH 5IVOA 2PD5A 3GT6A 3IRPX 2MRYA 4B3ZA 3JV6B 3ATYA 1VJIA 1FWXA 3CZJA 3BAKA 1OEZW 3PS6A 3DETD 5IMOB 2DZSA 2I17A 4Y5YC 5G1YA 2R27A 5LGHL 3GINA 1E73M 1DHKA 3DFTA 1A6UL 1ZENA 4PEKA 2VXVL 1B4JH 3H6AA 1A1MA 1A64A 5IHUH 2Y6ZA 5PAZA 3HE6C 4RZCA 4W9DC 2RHGA 3CWHA 3PUOA 4IQDA 3HC2A 3ZXWA 1I1CA 4JE4B 2YJQA 2HISA 4GW4A 3REWB 1JPTL 4NNYA 1KR1A 4LKCB 1KF9B 4FXGB 3M17A 4FG0A 1BAWA 2HTLD 4Q89A 2ZUWA 3VI4A 5JOFA 4XRCB 1DSYA 3U1PA 1AQ0A 5BZZA 5EBLA 1ISYA 2V5TA 2VDOL 2R29H 4YBHA 3IXAA 1A6WL 1WIUA 5D5MA 3ULVL 1FWTA 4MUPA 5EIIA 3SRFA 4PV9A 4YHPB 5TE6L 1Z3RA 4QAIA 4UB9A 4R8WL 2NNAB 5IGXH 3S35H 4AZ7A 4PJXB 4D6DA 1NDGB 3QEQD 5CWSA 5DMGD 3MGOA 2YMXL 1Q13A 1R38A 1QAPA 1YIXA 3JT2A 1ROCA 4ABQA 3WTXA 3UP8A 4ALDA 3MRGA 4RMTA 1PY0A 4IT1A 4LLVA 4HPOL 1CDUA 1O6VA 2BW5A 3GXMA 1AC0A 1J8SA 2W5PA 4EIZC 3ZHDA 4LDEB 4OKVB 1J9TA 3OA5A 3ETBF 1OP5K 4KJPD 3ASOB 4NQTA 3UY7A 3L6FB 4A2HA 3G2GA 3DX1A 4ES4A 6TIMA 5DFVC 2VHLA 4PJAA 2ZX9A 2XNAA 3MBEB 4LVHC 3H7UA 2G95A 3DBXA 2E6QA 4JB9L 4IP7A 4MZ8A 2WO4A 4N2FA 4ERSH 2ZE0A 2GDUA 4UT9A 3N4EA 3N06B 3DFYA 2DVXA 5EC1A 5LIXX 3W6LA 1JVOA 1RZIA 2XKNB 3O81A 4K94H 5D6DA 1TA3A 4YK4C 4XPGL 4JIRA 4RISL 5JNYA 1G7VA 1RCXB 3RDTB 2V7HA 3LPOA 5E6IB 1D5RA 1NAMA 4QY8B 3D4GA 4JTSA 4TXEA 2VZOA 2PF0A 1H8NA 1AGEB 5B39A 2AEOA 5D2NE 4D9PA 1BWWA 2IGFH 3KCPA 4Y5YB 3V7AE 1FQ0A 2GJRA 4BQ8A 3IYLW 4MD5A 5HYIA 1R30A 2BDQA 2PPEA 4XZNX 2YSWA 4LAQH 4NFBA 4UFLA 5I19H 4ES8A 4MZ3A 3G6AB 3D7PA 2I24N 4GT0A 4JN1L 4PJEE 4PRHD 5IJBC 3NZ8B 4K3JH 5IVXA 2D9QB 2IPGA 3W6MA 4OGYH 3VDHA 2CZFA 3U3HA 5G2NA 3VNKA 3SKNB 4RMBA 5JQ9A 2GIXA 4K7PL 1BP3B 1KM1A 3SDOA 4G7SB 2JQMA 5AB1A 4YPJA 2PODA 1MY7A 2N4IA 3IFNH 1TPXC 1CGXA 1M6OB 3RVVC 3H55A 3F5JA 1DQTA 2WC7A 4GP5B 4MCZB 4OZFH 4XGZA 5JIIA 5KANI 1QDSA 3U7VA 1OXYA 5G55A 4FLQA 3CIAA 2OI9B 1IFHH 2C1OA 1V51A 4P5SA 3PWIA 3R06A 4P23C 4YHOL 2Y7NA 5C92A 2A6IB 1U6AL 3FTXA 5FA3A 3C2VA 3MGTA 4A3HA 5CEZE 5I0DA 5EEUA 2ICEA 2PYFB 3W37A 1J93A 3S6OA 2E5CA 5DD3L 3GLAA 4XXWA 5CZVL 4X63A 5EV7A 3W7JA 1UR8A 3NPVA 2B08A 3N40P 1D5XA 2FEEL 4PJIA 4ABUA 2FDMA 3QOMA 3JRKA 3VYLA 3N3TA 2EH7L 3VGAB 1AY1H 3HUJB 3NJXA 4Y4KD 2O5XH 1IM9A 3G5ZB 5D2NA 5DT1H 5EC2B 4AM0Q 3PDGA 1KULA 4BHUI 1ZE3C 4HWEH 2I7GA 1KYDA 5H37G 2X0WA 2C34A 2HROA 1GYUA 4MD0B 3ROLB 1ITBB 3QPKA 3HB3D 4WI7A 1QMUA 3RWHA 1GG0A 4XCFH 4XPAL 2ZRUA 1SFDA 5ACZA 3P77B 2MIZA 4X6DE 2P5EE 1KCZA 1YYAA 1AP2A 5T5FH 3MRLA 1ZHKB 1FWDC 4MS8C 2DM7A 4BWTA 2I5QA 3L12A 4GBUA 4HUNB 2BTMA 3RJYA 2ZP0T 3GBMH 5DJYB 3DGGB 5EZOH 1RPUA 5BNXD 1LBMA 1XTLA 2DV0A 5GGQH 4HPYL 4LWWA 3UJJL 3TF4A 3EGDB 2Z29A 2DQIH 2O72A 3DO4A 3MBEC 1INQA 5E00B 2OYPA 1CFNA 3H3PH 2YQGA 1DZBA 4FLOA 3VH8A 1E0OB 1TZHB 3BQUB 1F2JA 3LY0A 3IFLH 1LO0H 1TTRA 3S1GA 4LOUC 4ZODA 4Q3MA 3DROA 4PJ5A 1DWJM 1AG0A 4UFIA 4KWWA 3R6IA 2A1WL 3MRQB 5JPNB 4R9HA 5C3TA 1US0A 1HDMB 4PCSA 5HHQA 1C93A 4ONOA 1S3KH 1ZT7B 3JZYA 3KPQB 4B95C 1WWWX 1XG3A 3BLOA 3LNFA 3EYSL 1EUAA 4PN2A 2ZONA 5AAMC 1RQ5A 2ZAIA 5BVPL 4G82A 1AQMA 2X6BA 1H1NA 5HYFA 2YB4A 4FZ8L 4AZCB 4KO7A 4JFWA 1BQCA 4ZFOB 5HTSA 2IV8A 1FL3B 2D7QA 1CIDA 2QQLL 4OGAC 1HTYA 1NMAH 1D3GA 3IMRA 3MRRB 2IVFC 2OMWA 1TKWA 5DD5L 2NYKA 3CVHL 1UKSA 1RSYA 4PIBA 4BSJA 3E0WA 3EH5B 5HATA 1HL8A 1GPOH 5I1HL 1Z9NA 5IB1B 3ZIZA 2NW2B 1MVUA 2CO6A 3D50A 4UTMA 4F8OA 5FSDC 1S7RB 4PWEA 2AEWA 2AGJL 3OAWA 4PLOB 2DIEA 3O6KL 4R5TA 5GS0H 3SDYH 1RALA 2DM4A 4B92A 1GHSA 5BU9A 2HVJB 2H0EA 4G9FE 3GMOB 4DP9X 5I77A 2V5CA 5KVFE 5EBGA 3TBBA 2J24A 4WK4B 4AUBA 1HH9A 4KTYA 1BFOB 1R3JA 3RLVA 2ZA2A 5M5DA 1K4CA 5HNNA 2QVFB 3PNWA 4XC1L 4NC2B 3LXBA 1AZRA 4UYQA 1L5GB 1JGUH 1GYCA 1GAFH 1H0DB 1OCWL 3FQTA 5DHEA 1F74A 3OO2A 1K5NB 2VO5A 4V2CB 4P9MH 3G6MA 4JZNA 4NWTL 2EDJA 5EL1A 3GVRA 4KI5D 2D0FA 3QY8A 4YHKH 3KPPA 2FTPA 3WH8A 3C6LA 3U4EB 5ELIA 1AACA 2MCPL 2EDFA 1A3RH 3EIFA 3KG5A 2ATSA 3USZA 3QZ6A 1X3DA 3QPQD 4M0XA 5KZEA 4ZQKB 4J3OF 4PS4H 3STBA 2YEVB 1YTDA 3AG4B 4MA7L 4TM9A 1OSEA 3D9AH 2EPLX 5CSGA 5CCJA 2OXHB 4REQA 1KWKA 4U5KA 1QNOA 4CNSA 1D9KB 1YYML 2IMNA 3U1QA 4DLFA 2ADFH 4UOW0 2EEFA 4XC3H 4MWAD 5BZAA 4FOJA 3MCG1 2Z0BA 1B2WL 2WQUA 4TULL 4NAEB 1ILUA 5IEHB 4OLXH 1MJ8H 4P9HC 2JFCA 5LAXA 3QJFB 5DXYA 4GUQA 5BYWA 5B21A 2VDKH 1IV8A 5TQ0H 4N4QA 1N5AA 1MJ7L 4MCYA 3O8AA 1XYBA 1E6OH 2BIPA 3BP6A 3MLTA 2XH0A 3VOCA 4PJHF 4CJ0A 1ASPA 4G9DA 1IKNC 4EKJA 5HPMA 2F6KA 2CA4A 4M1CC 4QSFA 5KTLA 1J2BA 3TBYA 3RYSA 1R3VA 3UH8A 4C5ZA 1XEUA 4J1UB 3M88A 4ZD3L 5IMMB 5EZJB 2NUTA 2E5BA 2FVNA 3DBXB 1TCRA 3ELQA 3QIWB 2J79A 1SQ2N 3EX2A 2UZXA 4F8LA 4LAUA 1LMIA 2WZAA 4MLJA 7PCYA 2MTPA 1F5WA 2QR0B 1CD0A 3NCJH 1SPQA 3P1VA 3HMCA 5G4WA 3WQ4A 4KAQL 4C1NB 1A0QL 5FGCE 2DZWA 5EU6A 3ORWA 2NW0A 3LK6A 3ZRSA 3EUDA 4UILL 1GZ1A 3OBAA 1KBKA 1CICB 5GGTH 5KZ6A 4ACTA 3QGKC 2F5BH 4ZS6D 2DW7A 2YPLD 5I1EH 2BP3A 1LO3L 3JTTB 4KVCL 2EIJB 3DG7A 2Z35A 4M8VA 1A6UH 2WMIB 1CBVL 3QQ9C 2J47A 3U79A 3FSTA 4DJDC 2WYZA 3LV3A 4XXWC 3S4SA 1EL3A 1NCAH 3KNBB 4AVJA 1SPDA 1HKWA 1NF0A 1P6BA 1W2PA 3L5AA 2JQXA 1NY1A 3TLLA 1X9QA 3TEWA 4HCRH 4POZC 1FWGC 1K8ZA 3AHVA 1EZVY 3N6YA 1UXSB 2XN9B 3P54A 2GY5A 4YN5A 2E74C 1MEIA 4AYEC 4FA8A 3VSTA 3SOBH 1M03A 1V3LA 4WUUE 4OD2B 3GSVA 4WEBH 4X8GA 1GW6A 3OKDB 4FG6C 1LL1A 1OHZA 2ACRA 4XP4L 2OWXA 1OKEA 4D0BA 4AGPA 4W87A 1A7NL 3T81A 3PVFA 1E2ZA 1NOFA 1TYGA 5I8OL 1QI0A 1R1CA 1UCTA 3F64A 4RE0A 1QZ1A 2ZOTA 3MRBB 4CW1A 3S5LA 4HSOA 4DWSB 3MRMB 4HWBL 3ZZ1A 4XO8A 5AOJA 3ZE1B 3ZKND 5I17B 3QORA 1AJ7L 4UQBA 3ANUA 1OT2A 4OI7A 1HHIA 2W63A 4QJ5B 4LVAA 1I8UA 4TNWK 4P2AA 3TBTB 1P1VA 3B9AA 2FH6A 3O11A 1B0RB 1XIFA 4JUTA 3KL3A 3RA7L 2ZXEB 3P74A 3RRAA 5I0ZA 3WUFA 5H2BB 4HT1H 4R0LB 2OX5B 3HPXA 4OD1L 4O02L 1M3UA 1PG7H 2APXA 2G75A 4QRUA 4DP1X 1TRDA 3IV8A 3M16A 4KMQA 2BY3A 3BH8B 1CI5A 1AXTH 1FDLH 2ORBL 3VI4F 3WO4C 4HJWA 2NQJA 5D7IB 5TF1L 3R8HA 4DBEA 1UFGA 2ODIA 1LROA 3OAYK 3BPNB 4XVJH 1V4YA 4FA3A 3RDKA 3MPGA 6ENLA 3GR4A 1OGTB 4DELA 4Y96A 4TLKA 4P46A 3QUYA 2AXHA 4MBRA 2VDOB 3F7VB 4OKVA 3VXSB 3SDXE 4HCLA 1OG0A 4MG4A 2W92A 5DVOA 2GGHA 2DQUL 4G7YH 4XCEB 3QHFL 3L1OL 4I0PA 2ZOXA 5AOZA 2OZ8A 2QSTA 3DYOA 1FP8A 4BKLA 1ZCCA 2VC2B 2XPZA 4P5KB 2PDCA 3RDJA 7REQA 2H6UA 3MN8A 4ZL1A 3RWIA 4OGYL 1YJDL 1ZV5A 4FHAA 3APNA 4XZBA 4P59H 4LCCB 5D7EA 5KG9A 4FCHA 2FBOJ 3ECVA 2PDYA 2R8WA 5DEFB 4OTXL 1Y0EA 2G0KA 3KPOA 2CRMA 4JRYE 3RUGE 4KPLA 2W66A 5I1GL 1U1HA 1FV1A 3RBSA 2PWGA 4PTUB 2VKZG 5IESL 4D7PA 1GQNA 4YLCA 2IWKA 1TSIA 1J4EA 3CSYB 4MQ7A 1KUMA 3TEVA 1IT7A 3IDYC 3PWLA 2E09A 2FB3A 3G0SA 2YWZA 3X1FA 2YYUA 3B9OA 1QBAA 2M8XA 5G4OA 4YJ5A 1OLZA 1LBFA 3ZWSA 3L5HA 3HNTH 1KTLB 3KCPB 2WJ7A 1MJUL 2XZAH 4G43A 4MXWH 1D5BA 1GGBL 2BNRB 4WFGE 2PGWA 3H2OA 2WLLA 2WB1A 3K0YA 4BH8B 4TMBA 1RK0B 3C8DA 4XSLA 2IBZY 4M8UA 4NZUL 3RNQA 3RNKA 1BF5A 4YTTA 2XVGA 3T8XB 4ELDA 5DDHA 4BZ2L 1NBZB 3QJQB 4R8WH 4HWBA 1IE5A 3DHUA 5G1MA 2EVIA 3W1XA 4EXAA 1HVXA 2H2SD 3CAFA 5E0QA 4BE5A 5FECB 2VYRE 4CBPA 4XB8A 4E2OA 3CXFA 3LKQA 4YHYB 2OI9C 2NVCA 3N9GL 4XP9L 1EHLL 3LNHA 1GZPA 2DP3A 3HM7A 3SZ8A 4H41A 3OGCA 2HBXA 1N3NA 3SQOL 1XISA 4HA0A 1LDPL 1EO7A 4QO1B 4U1LB 3C2EA 1RLBA 1OAJA 3ZKXC 3IRCA 3UWWA 5FDYA 1GOKA 2VLJD 4W9ZA 4AEIH 2F7PA 1M56B 3EJQA 3H53A 3LX9A 4BGDA 3VD0A 1D7KA 1S8DB 3K4DA 2OELA 3WLNA 2R4RH 3C9NB 2ZPKL 4L05A 3FSOA 3O4LD 4DPBX 1XEDA 1MSPA 4AZ5A 4B5VA 2CCRA 1TVDA 4LLDB 3EYVA 1NCHA 1CU4L 3G5VB 1E9PB 4GW5B 4JG0L 4MMZA 1ROWA 1WZ1L 2R1WA 4HSQA 2XFXB 3HS0A 5DFAA 3HS8A 3ZIYA 5IEKB 3B2VL 1U8MA 2BOGX 3V5OA 2X7WA 4P5TB 3KJ4B 3Q2DA 2DSUA 3HC3L 1TEFA 4OLZH 3CG8A 5GRJL 1A50A 4QD2E 1N8ZB 1X9LA 1QPNA 8XIAA 3OKNA 4R7XA 4QHKI 1O6SB 4H6KA 2YAHA 4WHYG 2XN1A 3FTWA 5J1AA 3G1XA 5DRNB 2X0VA 2X38A 3LM7A 2CALA 1Q5MA 1BWLA 3ALGA 2DQJL 4JN2A 4N6FA 3RVWC 1V27A 1W0WA 2K78A 3LGDA 5TIMA 1D5XB 3Q2VA 1M2VB 5F96L 1X5MA 3PCYA 1NWTA 2AQNA 3HHRB 3NQEA 3HOJA 3STLB 1E5JA 3TJHC 4HJSA 3IFNL 1FNFA 2P8MB 3N42F 4NRXA 4OZIB 4I6VA 3NVQA 1YY8A 1W6WA 3CTTA 4C7FA 4J8RB 3UJSA 1EFXA 1I9JL 2HT4D 4B5XA 4LEXH 3SDXA 1MDRA 2HFGL 4Q8QA 4WSHA 3V18A 2DQEL 1OANA 3FRPG 1RURH 4ZX6A 3TO4C 3DJZA 4ZFGH 2EPNA 4YIQA 2EO9A 5ANMB 1JHTB 3DERA 1EYEA 3QS3A 3SN1A 3HNSL 5HGAB 3TJLA 5KYUB 1F4XH 1S9WA 1U8KB 2D31A 3QA3A 4OU1A 4M7JH 4PPTA 4Q6IB 4D0CA 4QQUA 2E76C 3AIQA 4JREC 2ZADA 2ZOLA 3PXLA 3M0JA 1CT8B 2BY2A 4AZCA 2RDUA 3RI5K 3WE1A 1TPUA 4AZ6A 3V4VA 3O9WA 2H0PA 2NLJA 5FYJD 4EUPB 3ZFHA 5KJ7E 1FFOB 2KHAA 2HG5B 1IAIL 3BKCL 1N6QL 2ACSA 3W11C 3OZPA 4XCFL 4XPAH 3VIMA 5BRBA 4ZFZA 4HC1L 1FX6A 3AIVA 3ENEA 3M1BB 2Z6FA 2V7NB 5T5FL 3RDTA 2LFEA 3GKWH 2JEQA 3RUGF 2HA1A 5I16A 4X83A 5KJRL 5AYQA 1YO4A 4D71A 1PZCA 2BVTA 3STLA 4OLXL 4RIRB 1GSMA 2FT7A 4S0SD 3BZEB 3CB8A 4UUIA 2ICWA 5FEWA 1DBBH 1OD8A 1HK6A 2OZ3A 2G60H 3L16A 1EXHA 1T8QA 2RMNA 4S11A 3ZHNA 1A3WA 1DXFA 3G1DA 4W8AA 3M0LA 5EU7C 2UWEB 4JFFE 4G83A 1NL0L 4HPOH 2UWEE 4JFFB 2KZ1B 2HWZH 3QXBA 4G8FA 4U1GB 2W9EH 2A1WH 2RFXA 3V95A 1IBHA 3S88H 2VISB 4IJBA 3MV7E 3M47A 5DJDB 4FQCL 2CMRH 1A9VA 4M56A 4ABWA 4D6EA 2B5IB 4NN5C 3H2MA 4LCCC 4KFNA 5DMLA 1UYWH 2ZKHH 2BCKA 1SJCA 1SVZA 4OZHB 5E6ID 4PGDB 1Y6KR 1G6CA 3APFA 3NAAH 3AM8C 1UR9A 4L5ZA 3UBPC 4HV8B 3L1FA 4ICNA 4AY7A 4N9GA 4WKZB 1F07A 4Z5RB 5FA4B 2IDSA 1KEGH 1IEAB 1S9YA 5CAYB 2PLMA 3IUHA 2QZ5A 3EGJA 2QDHA 3VI4E 1ZJBA 1ZXKA 1HZHL 1BRLB 2EBNA 1RZ7H 1ZRUA 3F7VA 5EZPA 2XYBA 3W7NA 5A6BA 1MFNA 1DANT 3II2A 4FX5A 4AGMA 3BW3A 1REIA 3QIBD 4FP1A 2DSKA 4HCDA 3CK0H 4C58B 3K2MC 4XMPL 4QKXB 3KLLA 1ADSA 2VT0A 3M7SA 4TUJB 4Z7UF 3ATEA 4HG4J 2I60L 4OJYA 3B04A 4DGVL 1EWDA 5JXED 3F7JA 3MP5A 3EYOA 5CILL 4Q6XA 3UW6A 3BCFA 3G6JB 1MWAA 2VDGA 2WKOF 1FL5A 1YEWA 1J88A 2ZUQB 3QRBA 4FMVA 3BRFA 2N01B 5DJ8B 1THFD 5MKGB 5AAWA 1YLBB 1QVOB 4GRMB 3OPSA 2HPIA 2CIIB 1JF1A 1Z32X 1NCWH 4A7GA 2ONEA 4KRUA 1BVNT 3EX1A 2GEEA 3MODL 4KX9A 3G6AA 5EOTB 4A7QA 3H4XA 1XO8A 3KEHA 1JCTA 2WBGA 4K6AA 4AIBA 1DBJH 3QO0B 4RZ5A 4L4VB 4HJ1A 4HZ1A 2QPSA 1YY9C 3KDNA 4QE4A 2V0TA 4ISVA 4ROQA 1MCWW 3NCCB 5DHMC 2CHXA 1TVHA 4KZDH 3MA7A 1EEXA 2J4WL 3QSRA 2NY4C 1WRFA 5HYSB 1ICSA 3W5MA 1UWSA 3N12A 1C9WA 2UXGA 1TX2A 4A8IA 1A7QH 3GB7A 3TIMA 4PMNA 1UMLA 4FXGC 5C0IB 3DI1A 4FB7A 1XW8A 3VXTA 1OV8A 1UWTA 1I7RA 3BUYA 3IDMA 3P2DA 4ENED 1B3WA 1DWAM 4UINH 2E3ZA 3QGAC 4ZZKA 1XRTA 4V15A 4W7WA 2WNZA 1GJIA 2AXJA 5DJ6A 3UEZA 4FX6M 5E2TH 3L6FA 3BVDB 4GQRA 4YMZA 2CZDA 2V5JA 1Z9PA 1GCYA 2YD2A 1CL7L 3GBML 2A3LA 3FFSA 3KP1A 5PTDA 2FJHA 4UB0L 4UBPC 2FO4B 1KLUB 4IYKA 4KWSA 2WINB 1I1FB 4LBSA 3DJTA 4ZX4A 3SCVA 1G01A 1A14L 3KCLA 2L5HA 2CHRA 3AU1A 3DI3B 1PZUB 1RERA 5ITFB 4A39A 5C0NC 2ICCA 4JQ1A 3CDYA 5MF5A 4PTDA 4DK6A 1FPTL 2XWRA 4KO9A 4IRSA 5FSEC 4O57A 3NCJL 3I4KA 1SYSB 2WANA 1NJJA 5FECA 3GG0A 2OP4H 4IQLA 2H9GA 3JUYA 1L9TA 1VCAA 4OFQA 4ESKA 2NV1A 2V5BA 2N7AA 4O4WA 2G75B 1IT0A 2HJFA 1M7DA 2V17L 2NX1A 4P8QA 1KYOK 4A6GA 4X9SA 5EO9B 4W5ZA 4DWSA 1F90L 4F7EB 2PDLA 3SQLA 2IF7A 3D1MC 3OKEA 5LB1A 4XQ6A 5D7HA 3I10A 4XZMX 3SQBA 2OCCB 3BRGC 4FFWC 3WKML 2WB7A 4X6CE 3VX0A 5HYQB 1NWUA 1W3LA 2OKMA 5LDUA 1BF6A 2QXWA 5DJ6B 4GFTB 3QFWA 4F0SA 5XIAA 4REQB 4LSUL 4BFOA 4UTLA 4M6NL 2XIQA 4OV4A 1BMGA 3O3AB 1H63A 1I2NA 4A2FA 4ZMXA 1N4XL 1X9RA 5AZUA 4NQDB 2QGCA 3AU2A 2DW6A 3MRDB 3LMYA 2A9DA 3EDFA 4S0TD 3ZW3A 4PRID 4ADIA 3FDKA 2CH8A 2NMSA 3WLWC 3LCHA 1PY4A 5IHLB 4G7EB 3SDXB 4GJIA 1UIOA 1DFXA 1KTKE 3JT0A 2VOTA 3UXAA 4FNUA 3ITXA 3GRWA 4XMTA 4GZJA 4XP9H 3TFKC 4J2XA 1H7RA 2UXTA 1DQJB 3CWGA 5I8KL 3VKKA 5KVGE 1A5NC 1MNZA 1GWJA 1JZFA 2PSNA 3LEVH 4R96B 1SXCA 3W2KA 1QEWA 4XNZC 3DUGA 4JKNA 1IC4L 1Y5XA 4OECA 4ACZB 3U4BH 3KD4A 4OD1H 5CJQL 1XLHA 3KYOA 4OM1L 4X6EA 3QDAA 4MS6A 1I9CB 4ML4A 5HYJE 1POJA 3B8VA 5C2XA 4WFFE 3KDOA 4WU5B 1JCYA 1U92B 4MQXD 4KQ4H 1A4BA 4L8DB 2MPVA 3LN4A 3QB7C 4TRPH 4XAKE 3VA6A 3IWUA 1DBKL 3P0VL 5GZOA 1PY9A 3DJ9A 5KTEL 1ODZA 3NQDA 2P53A 1YYMH 4QRNA 4PMEA 3EFOA 4I2XA 5GNXA 5DURD 3WBWA 1JZJA 2OTWA 1CICC 3BZ4A 5LGJA 4FAAB 1PKLA 3MTWA 4XX1G 3BW4A 3H1ZA 1OC7A 4Z08A 1H4PA 3EO1B 3AI0A 3CJPA 4XNMB 1TTBA 4FF9A 4XMUA 1BWMA 3CGTA 3TVMB 3I50H 5BS0D 5AD0B 2A73A 3LRKA 1JZ6A 4YSRA 1YMME 3SYAA 2LFGA 2EDOA 1HHIB 2W59A 3C2AL 1PD6A 3CC5A 3KW7A 4UIKL 3IDGA 2WMFA 1GPWA 4YCPA 1W3TA 1IQDA 5ISZE 2BVUA 1WA2X 4B4HA 3I6GB 1ASQA 3OJ2C 3K74B 3N41B 3V6FA 2KX9A 1CFSA 4OZHA 1JK9B 5TH2B 4CGTA 5KS9E 2AL1A 5E4EB 1Q9KA 4XKYA 1KFEA 2VLKD 1U8NB 4FQ2L 3CQQA 1F3JA 3S5OA 4KAQH 1NKGA 3M9YA 3U57A 4CILA 4PRAA 3S34H 2VAAB 4TNVK 1YEDB 5K9KB 2LTQB 2DAVA 5I5IA 1X9UA 2XBTA 2WWKT 4FXJA 1JK8A 3F6JA 4E41A 2VDLB 5CPSA 2B4CC 1V5XA 4XPBL 3SDAB 2HJLB 4GXMA 3H42H 2WLIB 5CBJA 4F92B 1KGIA 4RBPH 1XL4A 1T89C 3MCLH 4H0IA 2FYMA 2ZD0A 1JERA 4L8SA 2H2SC 2X42A 3W88A 1RHHB 1IAIH 3VSUA 4BFNA 1NOWA 4AUJA 4XP1H 3HHSA 1YMMA 3T71A 3KR3L 2H8ZA 5C0AB 1IC0A 1KPRB 4NFDA 1WKYA 1TVBB 3GSUA 3MSDA 4E4UA 2KS0A 2NQ5A 4FI4A 3NP4A 2CAKA 4AD5A 3WAJA 2IC2A 1UFUA 2FEDC 4MWFA 2NW2A 2YEQA 1E2WA 1KC5L 1V3KA 2PTTA 4MSSA 1M05A 1P7TB 2BSSA 1CT8A 2LQRA 4KJYB 3VDGA 4Z18A 3OJDB 5GRYA 1PCWA 1QOPA 3LHWA 2HLAB 4WD0A 4LIQE 4LDOB 5FUZH 1D6EB 3K2UL 4QTHA 5J1AB 4P5KA 2PETA 3FHEA 2DY3A 4W9FC 4DYKA 2FIKA 4Y9FA 4Y9CA 2Q87A 4JK0D 3DHDA 4PRAB 3MO7A 4R3UA 2QQNL 3ARFC 3C60D 4G1MB 4YOKA 3WZ0E 5BV7C 1XYLA 2K70A 5DHYB 3PP3K 2CUIA 4TNFA 1F5ZA 3VFPB 3RN6A 5FF6B 3CPGA 1H3VA 5I82A 5I76B 2ITDA 1FCUA 4J4KA 4NO2A 2Q8ZA 4HCFA 4Z76B 1WBYA 2FMNA 2CLLA 4HHPA 2GJNA 3D34A 2NTFA 3PABA 4BKNA 1WBXB 2DT3A 2XHNA 4KXZI 1T2QH 3PAZA 1O75A 5L7XH 1Q6FA 4I18B 4WAFA 3Q94A 3ZJ7A 2YCJA 3BUVA 4JNYA 1RZ7L 3FF8A 4I9WD 3NCFB 4NM4H 5DEGB 1A0DA 1VCVA 3T2NL 3LMZA 3CX2A 3P0WA 4TLSA 1FH2A 4XB3A 5EZLA 4MAVA 4GI6A 3GUGA 3NEEA 5A1AA 4PCTA 2CESA 5ID0B 1OPOA 1OAQL 4IS6B 4FNQA 5J4MA 3D39B 2JWYA 1BZOA 4KJQC 3P77A 1W5NA 3PG2A 3PGFH 4QXWA 4XE5B 1G1OA 5CMAB 2V5YA 4ANKA 1V7YA 1UKPA 5FO9B 1FH5L 3VNMA 4C6NA 1IEBB 4XAWL 4TX9A 4C6EA 1E9PA 4QRBA 2PCPA 5J9PA 4J4PA 2NV9A 3SE4A 4M7KH 3WDHA 3B6SB 4ZENA 3VKAA 5EUOB 2GJPA 1RK1A 2WNWA 1J5CA 2AAVA 2XXMB 3P3RA 5K93A 1EA9C 5T3ZH 3ZR6A 5JW4Q 1ADDA 4F48A 5F7FA 5TGBB 3VRIA 3DI2B 3K8LA 5IXEA 1U2CA 1N82A 1RUQH 3GLDA 4TTGA 1E0VA 3W81A 3ECBA 1GC1L 2HTKD 4V28A 1DANU 1XHGA 3N15A 1XD1A 3D85B 2JSFA 4ZUSA 3GDMA 2QJJA 3V16A 3V75A 4AWJC 2KH2B 4HHWA 1E67A 3L5XH 2WZPD 2VH5L 2AQQA 3UBXG 5CGMA 5DA4A 5T9CE 2VAJA 1XLAA 3G22A 3BKCH 1N6QH 4GYBA 1OAZL 3GHTA 3PBGA 1RHFA 2PLKA 1W5QA 6REQB 4M61A 3LBMA 2VABA 3FH8A 4MXWL 4HC1H 1GGBH 4FHBD 4UIMB 3UBXB 1XYMA 4Z95H 1EGJA 5IVNA 1LJMA 1XF1A 4JKMA 3YPIA 3QEHA 2WXLA 3UADA 3BUQA 3QP3A 3D05A 1DJSA 3HF3A 3CFCH 3EJJX 1HH6B 4MQXC 4NN7B 3MWAA 3N1PC 5IREA 3W1LA 3CZLA 5BZWB 3SDDA 4Q7BA 2QVTA 1DE6A 5H6HA 1I7ZB 2ALRA 2H32H 4FNTA 4LE8A 1ML0A 2EXYD 1HAUA 2Y7QB 4I9TA 1LE5A 3OKEB 3RTLA 4I9WE 1J05A 3I2CH 3LV5A 3PE9A 3SQBB 3VMOA 4C6FA 3G77A 5I2IB 5DCBA 5B7MA 4RUBA 4QTIH 5HVGB 1XIEA 2BVQB 4H8PA 2Q8BH 3EZ8A 3IU4H 4HJIA 3VI3F 3F4CA 5B1KA 3NSNA 2KUTA 3MB9A 1X6UA 1MI5A 4D6HA 4YUEL 2JF1A 2NY3C 3OZ9H 4N2KA 2E6JA 1CTOA 4TQ8A 4WI0A 5E6ZA 5FKPA 4LH8A 4P2OA 3MHGA 4X5LA 1JFQL 3MV9D 4MNGA 4AL8L 2Y88A 2GZXA 3ZL4H 1GQJA 1RH9A 3GX9A 3W11D 2VDIA 1XH1A 1UH2A 3V7MA 4HKZB 4YJZL 2OXGB 5DJCA 3O41B 1NEZA 5EULV 4EI0A 1X4YA 4EXBA 4LDCA 1B5TA 5KBPA 3KBPA 3R12A 3C0SA 4YXHL 1CGYA 3BEVA 3RJOA 5CIPA 1U8JA 2FJHB 2ZQ0A 3BICA 2JCCF 2VC2H 1LM8V 4CC1A 5D05A 1J0IA 4JRXB 3FOMA 3UBHA 4NUWA 4MRBA 4OCXL 3W3OA 4WIWA 2PO6B 1WICA 4TMPA 3PUEA 1SLUA 4K71C 4DEFA 1QNQA 1TJRA 2ISVA 3IMTA 3LNMA 2FZNA 1FAIL 2DLTA 2MHAB 4APQC 3VWKD 4F2MB 5JXAH 3CZSA 1M6UA 3THCA 5IB5B 4XVUD 4MJIB 5E8NB 5EO1B 3CIWA 5H4ZA 2D3JA 2DKMA 1Q1JL 2ZJSL 3ZO9A 4YS1A 4UTTC 3GMLB 1IEVA 5IM7A 1I1WA 3B8IA 3O6YX 1NCIA 1F1AA 4EZLA 3SPVB 1CE6A 3W7GA 3BANA 4K68A 3KS0H 4AT6B 1OF6A 4WW2F 1EUNA 3SDAD 5E8DH 4BZ1L 1US2A 4L2YA 3PWNB 3D8MA 3BKJL 3NO3A 4EIUA 5I3IA 3H22A 5C1MB 4TUOB 1P7QD 1FSKB 1HU8A 3L0NA 2A9CA 1FWJC 1OC6A 3QIBA 1GVFA 4ZZFA 3ZHFA 4BSVB 3ATZA 1GYNA 2HX7A 4G6JL 4K1WA 2P8PB 3BGFC 2OQYA 1L0QA 2RQ8A 2WKJA 3ABRA 1AK5A 3PPGA 3KTSA 3T40A 3V0HA 1E30A 1S7QA 3ZE0B 2J9YA 4NYLA 2VFFA 3UIYA 3P9LA 2K4WA 1R0AH 1YRRA 4FQQA 3H24A 2KLRA 1MZZA 2WWMC 4TRPL 2QHLA 3FJTA 3DHMA 1EQWA 5FO7B 4EK7A 3BE1H 1G67A 1OGPA 1MG3C 5EUKB 4XNXH 1N59B 1VZGA 1I1YA 3G08A 4I3SL 3CVIH 4MB4A 1PD0A 1JNEA 4IIGA 1YMMD 2RA1A 3SO5A 4AF0A 1DE5A 1CLCA 1TZOA 4FQJH 2QSCL 1MQQA 2C71A 2J88A 4GYJA 4J1OA 5F70A 1P1ZB 4IGBA 2VQTA 3GQFA 4PREA 2DJXA 2WZIA 4PHZA 1SJBA 4X7SH 3TIEB 2W0FA 4L4TA 2JIXD 5DURB 3X3GL 3ZTDC 4BCYA 3EOYG 2OG9A 4U1NA 2AERT 5IK3A 4OZIF 2C26A 2J1WA 4FTVD 5AG8A 2H3DA 4WVXA 2Q9OA 2BSCA 2ABAA 2NNFA 1XGEA 3V7PA 3DKHA 3UETA 4AXWB 5LJYH 4QJ1A 1FFPA 5GS1B 1TV3A 2P88A 3SBFA 4LLYB 2YOAA 1EJSC 1XKYA 3SUSA 2VDMH 4GINA 4BRJA 4O2EB 3AS2A 4GS7B 4LLWB 4LEQA 4LUSA 2PC4A 1JPSH 2FO1A 3B9KC 4WUKH 2BP0A 3QJOA 4PVMA 1MEXL 1Z66A 5EPMA 1PYMA 4AYID 4M5TA 1LQSR 1BOYA 3DRTA 4L8DA 5JPNA 1OX4A 4G8FB 1JPDX 5D2WA 4H9VA 4D8AA 3F7LA 4QOKA 1INDL 2BX5A 3G9VA 2G9HA 4DP7X 4KDVA 1E4MM 4NQ1A 1T20A 1E3FA 2XTJC 1DLFL 3EJZD 2NXZB 5T26A 3H3PL 5I6LA 1KV3A 3OBEA 1DO6A 3FQWA 1FP9A 1Z6KA 4K4KA 1FG2B 1XVSA 4PRIB 2ADYA 1RJZA 2BOLA 1XGRA 1DVFC 1EO8L 2YK1H 4PRIE 2X4OB 3VXNA 3QDGD 4YHKL 4L8BA 5MENA 1RY8A 2YUWA 4FQHB 4YR6A 5F9JA 2OGYA 1XC6A 3K71B 3VCNA 3MC5A 1OB1B 4Z7WE 4XO5A 4KHXH 3QZEA 3KLQA 4N87A 1EC7A 4DOHE 1EEQA 1I1RA 4PLJC 5JQ6L 1R17A 3VYOA 4KEMA 5HY9A 4O9HH 3EXTA 4AEHH 1M53A 4UT6H 2WXFA 2X05A 1U42A 3KYAA 3GSWB 4BXVA 1ZLSL 5BCAA 4DEPB 1H3WM 5FDWB 2PPGA 3VIKA 1JI2A 3MODH 5EU7E 3T0XA 2YCKX 5DRIA 4QE5A 1IQWL 2XN2A 1A1NA 2PBGA 1NMAL 5LDSA 1ENUA 4PG9A 3U4BL 3MLRL 4KK6D 4B3KA 3VUPA 1KJ2B 4PTXA 4ASTA 5F7MC 5T3ZD 3CZ8A 2D03L 1MRCH 3KVPA 5CKGA 5DO2D 1M1BA 1QOXA 3HN8A 3DIFA 1ACCA 3LNGA 2AQWA 1J1PL 1NLBH 5DR5L 3OVUB 3RL1B 1E9IA 1OW0A 2Y2YA 5DS1A 2VXUL 3FXGA 1ILSA 4BFKA 1S7TA 3CPUA 4GAYB 1HKLL 2OTPA 5C08E 1FG2A 4PRIA 5E08H 1YNYA 3PV6A 2D9CA 4PRDA 3SPGA 5HI5D 3OPZL 4KRZA 3ZRCC 2HLFD 4JM0A 1UB6A 5CC7A 3QUYD 1WFNA 1BZEA 1CDYA 2XWBB 1VZWA 4Q58C 1O7VA 4Z2HA 3FFCB 1MNUH 3S3JA 1WAEA 5FYKD 3T2QA 2XPGB 4F20A 5CG7A 3RG6A 1JUFB 5AOMA 4IFKB 3CZNA 1JK8B 2YFNA 4LCIH 2WQSA 4O50A 5D30A 4NPJA 4YHLH 5FYJL 3S36L 5K5YA 4U4IA 4Y8DC 3VXPA 1U33A 3OJDA 2FX8H 2WXNA 2Y69B 3FFCE 3Q6FB 1NM9A 1XB3A 1EJ6A 4U1GC 4ZW7A 1P5BA 1TJ1A 1UEMA 1MIEH 3SIKA 1BGAA 5TK4A 3K2IA 4J4PC 4BF5A 1XYFA 1EXGA 4P0DA 2QVHA 4LFYA 3G6DL 4A38A 1Q0YH 1FNGB 1FZJA 1A6ZA 3KVJA 3WLQA 3W5NA 2WMHA 5RUBA 3OXRB 3VFUB 1Z3GL 3C09C 1ZHLA 4XR8C 4IEFB 5D71L 4M7SA 4R97B 4AYFB 3PDDA 2R9RA 3PNRB 2WN3A 1YXCA 4LZKA 1F8TH 1CR9L 1WS8A 3CQPA 4PUBL 3JVGA 3QAZC 4U3CA 5LGHH 3WX7A 3HGOA 5IHZB 2WYIA 1E51A 2Y8UA 2VXVH 4AY8A 1DTNA 5C54A 3JUZA 3TT1H 1S3TC 4X2RA 4HWBH 2MMXA 3VNYA 4PA8A 3WBXA 3KOXA 3ULVC 3UVAA 4TNWF 3BP5A 3PZ9A 3TE9A 4RMSA 3IVSA 2FEDD 2UWFA 2DSVA 4I1NB 4PTMA 2ZWZA 4CVXA 5EOTA 3CCHB 4W9CC 4AGQA 4QRPB 2OW7A 5D72L 1LG2A 1VFOA 1A6WH 1UB5B 3T1WA 4NHCL 4JDVA 3V5KA 5F7UA 5JYLA 1VYPX 3CAWA 3CQ0A 5J8OA 3U0WH 1XLKA 1AKJA 1UHVA 3ZE2F 1NDZA 2XPYA 3CB3A 1BLNB 4NZCA 3LKPB 3SE9L 1D6VL 1U3HD 5HYQA 5TE4H 5I17A 1QSEE 1LO3H 3G6JA 3INOA 1QUNB 4KVCH 4QGYA 3E8UL 5EFFA 4LEOA 4LIQL 5IWLA 1JUEA 43CAB 4HIQA 1AW1A 2JH2A 1CLOL 3QDHA 4QTIL 3QUMH 5D70H 4CN4A 1UQYA 3NYDA 3PL6B 3DX2A 2IOOA 4YL9A 3W29A 2JJTC 4MA1C 3KTCA 4ZZ9A 5C0FB 3QBUA 3VIPA 2VDNB 3EYFB 4GRWH 4OCLC 1W1TA 3EO9L 3F83A 4L3CA 5AW6B 1R3SA 2NY1C 4RDQG 2NSMA 2A7PA 2VOMA 4LB4A 5I00A 2VR3A 3CIVA 2XDHA 2IQAB 2DS4A 3MRKB 2ADGB 3NDYE 4FQPA 4EF9A 3KDMA 1URIA 4LPXA 4CNUA 2CNYA 1CL7I 2Y7DA 1A7OH 1NC4B 3ZLQC 1M68A 2ZOWA 4WDIB 3PFRA 4LASH 4HUVA 4QISA 2VW7A 5J6HB 2FLRT 3S6CA 1NTHA 4FQXA 2O5YH 5CCKH 4IGBB 1SFJA 4JFPB 4I77L 2QDGA 3MX0A 3PLYA 5ETUB 4HN4A 3ZJ8A 1A4KB 4GKNB 4H20L 3VOFA 4E0RA 3GMRA 3RZCA 1V0KA 4GCXA 5C8JB 1SEQL 3TZVB 3RA7H 4K3JL 5C07A 1FAIH 3BO8B 2JJUA 1QNSA 1CO1A 1NWRA 3CL8A 5AOUA 4AV4A 3KGUA 3PWVA 4XAWH 5EDXA 5D7IF 3E2RA 4HKZA 4M48L 4IICA 4AB4A 2ICWB 3BHBA 2HFEA 4A7TA 1AMKA 1KBJA 3DX5A 4G5AA 3NZHL 4TPRL 2P0OA 3MYPA 1S7VA 2YDRA 4BDVA 1IXQA 3SEPA 3IJEB 4J40A 1KRAC 2VLME 3NIFE 4TVPD 3TF7C 4M6UA 2KT6A 4AHPA 4IDLA 4JKWA 1CDBA 1VRDA 3TV3H 3CQKA 4YYCA 3JWDC 3M4HA 1WZAA 2ZZ5A 1FCCA 1V0NA 5FM5M 4ZGYA 4PE8A 3MLTB 4I18A 4LANA 4WFHD 4HAFA 4LTSA 1KGYE 1FIGH 1XH2A 4O51B 4NGHH 4LS2A 4MD4A 4PP1C 3PWJB 1TUFA 1AANA 3K1KC 5I2IA 1N68A 4UAOB 5LGYA 3SDCB 1IGWA 2PTYA 3M7OA 2C9QA 3RR4A 2QUTA 5JIMA 1UWXH 5DZ9A 1DZ0A 1G9EA 1GZJA 3D4YA 1MVYA 4GZEA 4PB0H 2XINA 2HK1A 2FJGA 1C5CH 3H2EA 3EJSA 3WD1A 3M1OA 4HCRA 4JJOA 4FG6D 5HDRA 1LP9A 4L61A 2BO0A 3QZLA 4AT6A 1JPGB 3NWRA 4ZFFB 3STPA 4FLRA 5FYKL 4QNEA 3L95A 2JE8A 3REWA 1QWKA 1BXUA 1YEKL 2E86A 4K5LA 4Q0XL 3PG8A 1AIFB 2AEIT 4O00A 3GKFA 3QV8A 5IESH 2R1YB 3QRLA 1O12A 2NWSA 4KX8A 1C90A 4JHMA 2F19L 4LS0A 2YRBA 1Q9WA 3ZX1A 5GRJH 3O15A 4R7OA 3WUBA 3HRZA 1K9EA 1P5VB 4HIIA 4ELMF 5F0MB 1HZYA 3GMQA 3NH7H 2PO6A 2FNWA 4L1TA 4MNQD 3IRDA 4DZ5A 3UEQA 2Y36L 3W75A 5IM51 3RU6A 4GZ7A 1TTAA 3MRGB 3UCRA 4AG4L 5CF3A 2ZG1A 2WZHA 3A6BL 2ANUA 3C52A 3HURA 3BD4A 4L4OA 4EUPG 3H9YA 1O5QA 1RMFL 2MFNA 4P07A 3B6SA 4MHHI 5SV4A 3U82B 1WITA 3PWUA 5I0XA 5IMKB 2A2IA 4TXVB 2HS6A 3KPMA 2QT3A 4MY8A 2X4PA 3EYSH 3QXDB 5E6RB 5I1LA 4Q4RA 1MHCB 1THAA 2W07B 2NW3A 4GPNA 4S2CA 4KH2A 3FVMA 4NKDB 1T5KA 3KVQA 2CO7B 1USQA 3RFZA 5AVUB 1S3HA 2J5WA 4QNWA 2IALB 3LKOA 3DO7B 1MCNA 3V0TA 1CGVA 1SY6L 2Q09A 3KP0A 2E0PA 4IKJA 5IJKC 3LCFA 3JWNE 3DMMC 2QHRH 1Z5LB 4ZPTB