1T03L

Hiv-1 reverse transcriptase crosslinked to tenofovir terminated template-primer (complex p)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
211
structure length
211
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCSASQDISSYLNWYQQKPEGTVKLLIYYTSSLHSGVPSRFSGSGSGTDYSLTISNLEPEDIATYYCQQYSKFPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 RT-DNA complexes before and after incorporation of the anti-AIDS drug tenofovir
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/antibody/dna
molecule keywords Synthetic oligonucleotide template
total genus 39
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2004-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t03L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t03L01
2NR6C 1ZS8B 5ID1A 3RZCA 4MJ4A 5A2FA 4EIZC 4EN3C 1HHHA 3VMPA 3D1MC 1D6EA 2HA1A 4ZUUB 4YPGA 4ZPTB 1KYOK 1LHZA 4MAYB 3STZB 2OM5A 1OAUL 3U9UB 3VI4F 5FYJL 1X5YA 5K9KB 4POYA 4YIQB 4HIHA 4PGBB 3RKPA 3BVNB 3KPRB 4WW2F 3CDGB 2APTA 3ULUF 2RJMA 3ZDYF 3MRJB 4NQXA 3FT2B 3UTQB 4JO2L 2NY3C 3CK0H 4NQUA 2VDPL 2VYRE 4OGAC 1BECA 2R56L 4WWKB 3MLUH 5FM8A 1JBJA 1DUYB 1WBXA 4LSQL 4X5WB 3MREB 1WCQA 3VXSE 2BC4B 2YD3A 3O2VH 4NKMB 4K7PL 4XP1H 5EBMA 2CPCA 5GZNC 1EJOL 4PTUA 1RJZA 5DSCA 5D7LD 4H8WL 4I2XB 3BPOC 3BYTA 2Q20A 4IOFD 1YEGL 1NC2B 1SJXA 2VN7A 2B4CC 2OCFD 3NCFB 1ADQH 4YFLF 5JQ6L 5JZ7C 1HKLH 4WI4A 3THMH 4GBXB 3W9EA 3H6JA 4UNTA 5DEZA 1ND0A 5D7JD 4OLWL 5D2LF 1JYNA 4XC1L 3VRIB 1IILE 5DHVA 2J5LC 3OXRA 2NY5L 5JHLH 4ZFGL 1BJ8A 5AZEH 4BFIB 5EIIA 4L8SA 4PRBA 4X83A 3DVGB 2IALA 2EEBA 3QUZD 5C08D 5IWLA 1FNFA 1FL5B 3EDEA 3T3PF 5HHQB 5DD3L 3ARYA 4UAOC 5I19H 4Z7UF 3T3MF 1QFUL 1JZ5A 2P5WE 4YDLC 4OZIE 3QDAA 1CGUA 3AUVA 1MPAL 5DWUL 3ULSA 5C0CD 1VADA 4S0TD 2VXVL 2BRQA 3PNWB 1NLDL 1S5IL 2FWOB 2MQCA 1Q8MA 4ZUWA 2NLJA 1A14L 3CMGA 1YEFL 4HC1H 4OCRH 4YFDB 1N0LA 1EFXA 3MROA 2APVA 3O3AA 5DEGB 2NYYC 5I1KL 4C57C 1HDMA 5HYEA 3QQ9D 3ZE1F 1JYVA 2MTPA 1IL1A 2FD6H 2GFBA 3VFMA 2VLRA 4PRID 3U2SB 3QJHA 3P11L 4DN4L 2VDRH 4HZAA 3I02A 4F7MA 1G7QA 5AAMA 3OPZL 2WLZA 1LE5B 3IDYB 3OJDA 4L8SC 1ED3A 3TJEH 3IFPB 4KI5E 1RZIA 1YECL 4JZOA 5DMIH 5FHBL 1FN4A 2C3XA 4HK0B 1U8MB 4P2OC 1A02N 3NFPB 3DIFB 2IC2A 1YECH 3D0LA 5DXWA 2LQRA 4GRLD 3HNVH 5F9WC 5B39G 2MMXA 3RA7L 2V2TA 5I1JH 2D0GA 3CSGA 3D85B 1IM9A 4K7PY 4O2EA 4KJPC 2DDQH 5I8CA 1LMKA 2ZSWA 1T0NA 1UQSA 3EJZD 1HZHH 4FZ8H 4WTXA 4F7PA 3EDJA 1YQVL 2DM7A 1AKJD 1S7VA 3QG6A 2FX9H 3L9RA 4QRPB 3DUUB 3LQAL 1KLUA 3CU7A 1I3GL 2W38A 4OZFH 3F6IA 4XPFL 4JRYA 3BOVA 4KRLB 1FG2A 1MAMH 1TJGH 1RFDH 4NBZB 1UYWL 3IDIA 2VXTL 4H0HB 4DW2L 4IDJL 2FLRT 2HJKB 1KTDA 1TJGL 5CJBA 5ICYB 3NCMA 4PJFE 2NX5B 2AGJH 4KRPD 5E5MB 5E1HB 5IM7B 1B4RA 2K7PA 4PJ7B 1DQDL 3QUYB 3PL6C 3PWJA 2D7PA 4OZ4B 1G7QB 5T1DH 2BVTA 2ZNXA 2DMKA 1MLBB 1MCSA 5CEZD 2F54A 3KPSD 5A3ID 1R3IL 4CU7A 5SWQB 1IGMH 1TLKA 3RVWC 4X6FA 1FV1A 1DBMH 4QRRE 1P4LB 4HULB 2XA3A 2PYEB 3I6GA 2PYED 1H5BA 4BQ6A 1B2WL 4AEFA 1LNUA 2Y6SC 3WKNA 5E5RB 1XGPB 1G9NH 4HX1A 3IVKB 3WS3B 2D4DA 1QLRB 4R4FH 1B2WH 2X70B 3WFEH 4M1CC 4N0FA 1DBBL 5CCKH 2C3VB 4U1MB 3MFFA 3S5LA 5LGKA 1FCCA 1FVEA 4ZS7L 5BO1H 4HKXA 4FABL 3O6LH 1EXUB 5CILH 5JO5A 1BQLL 4KUZH 2Q7YA 2D7TL 1TIUA 4PJ8C 4I5BB 4BH8A 5I71B 4PRPE 5D4QA 4E9LA 4NNXA 2D7TH 5I16A 3KLAB 4GQ9H 1RUQL 1A3RH 1S9XA 3V4UL 4P23D 5JR1L 5HJ3A 3V0WL 1P4LA 3OKOA 5D7KD 1YDPA 4CGTA 5DR5L 3PGCA 1VEPA 1N59B 2VZVA 2OLDA 2E27H 3VFOA 2D4FA 4WTWA 3HR5A 3UDWA 4IIQC 4PJGB 2GY7B 4HIEA 5ENWB 5CKGA 2J4WL 3OKYA 4YDJB 5EU6A 1X6LA 2ADIA 5D1XD 3FB7B 1H5BC 3CSYA 3CZJA 4Y2DB 4M1DH 1MWAA 2ICWJ 3TNMA 4GRLB 2DQHH 2A2QT 4BJLA 3D2UB 4WEBH 2VLJD 1IJ9A 1H3PL 3QWOA 3LEVL 4UOJA 2IANB 3GMRB 5DVKA 3CSYB 4OV5A 2XPGA 2CXGA 1OTTD 3LZFL 4F7EA 3FQTA 1SJVA 5DJAB 4FNLL 4JY5L 3KPRA 2DQTL 2A83B 1DP0A 1S7VB 3QG6B 3ROOA 5F6IC 2JB5L 4WI3A 2MCG1 1D5BA 3JV6B 5D1ZC 2PTTA 3PIQA 4JY5H 4RFNB 2G5RA 1A47A 1Z5LB 1O7SA 1JMZA 3T0WA 4PRNB 3H0TA 4X6BA 4Y1AA 3QFDA 2X1XR 2PCPA 3GIZH 4WWID 3BW9B 3SE4C 4PP1C 2EIZA 3LAFA 2AK4B 2Z35A 3W39B 5GIRA 2BX5A 2YD8A 4GAJH 1C08A 3S88L 2Y25A 4TVPL 2E6PA 1OTSD 3NFNA 4JR9L 4PJ7A 3RWDA 2AXJA 4G7VH 2OP4L 4TSAL 3TO4D 3GRWA 5K59F 3MRBA 3NCYS 4N0FB 4Q74A 4OFVA 3V5KB 1IAKA 3G5YB 2IAMD 4TTDC 3ZTJG 3VXOB 5F1IA 1DVFC 5MHSE 4KDWA 4RNRA 4OLEA 1QR1B 5FV1L 4MCZA 2AJZB 3HE6D 2GIYA 1CR9L 1JYXA 5KJRH 4Y4HA 4E41A 5L6YH 1R5IA 1KIQA 2PR4H 5GJSH 1RHHA 4KV5E 3MX0A 1DR9A 2DQUH 2L4OA 4I3RH 3PHOB 3TJHC 2Q8BH 5MENE 1E6OL 3BT2L 4UDUB 4G3YH 4MYWB 1AY1H 5KANG 4I3RL 4BKLB 2I24N 2OXGA 1OP5H 4KK9D 4CVXA 3FOMB 3P77B 1KCUH 1JPGA 5GS1B 2OJZH 3EGSA 2XNAB 1L0QA 2OR9H 4WW2C 1VEOA 2EYTA 3P11H 2V2TB 3IAQA 4UTBH 4U6HB 1JPGB 2AXGB 1FFQA 2B1HL 4MMZC 3LH2L 4FQIL 3FO9B 4WIQA 4L8BB 2R23B 3LRSB 3W9DA 3TZVB 3LKOA 5MEPA 4MCYA 1I9EA 3IFPA 1I1RA 3ZKND 1CXLA 4HWNA 4XBGB 3BE1H 3GIVA 4LKCA 3UBXA 4M62H 1K8IA 4QF1B 2VXSL 1HYSD 4XTRC 4XMKL 4NIKB 1G7PA 4N0YL 2DBLL 3TPUB 1M7DA 4CN1A 5IJKC 3ARFA 3P4OB 4X5LA 2FO1A 4G80B 1EVTC 1D5MB 3EDFA 1JNLH 1HXYA 3OKEA 4RRPG 5B8CB 1KXTB 1J5OH 4TUOB 5C8JB 2DYPB 1K4CA 1T89A 4GRLA 4OCXH 1TETH 1W72A 3S4SB 4UQ2B 5C0AE 2B0SH 3GBLA 1JGVH 4MA7L 1G7HA 2J8UB 4FOMA 5CGYC 4YZFF 2AJ3A 2IADA 1OPGH 1NCNA 3R8BB 5I17A 3KYKL 2RGSA 4D94A 5GS0D 4MDIA 3GB7B 2X9XA 3UTTA 2C5DC 3U2SA 3HCVB 4U1HA 3U0TA 5I8KL 3T0ED 4X8JB 2G5BB 4YDKL 1F90L 5DC0A 5CSZB 3ARED 5D9SA 4M3KB 4FQCL 4WU7B 2I5YL 2UWEA 3CPLA 4H88H 5IB5A 5EO9B 5IBTH 2EH8H 1KOAA 4JFYB 3WNLA 3KR3H 4U1SA 1S7RA 1IEHA 3Q5OA 4V1DA 4GS7B 4L3ED 4H8WC 2BVEA 2HLAA 2ZG3A 1BVKB 3FHQA 3OKDA 4XAWL 2F8XC 2HKHH 4JQVA 3WDJA 1YMHA 3RRQA 3VFVA 3T1FB 1CDBA 4YH6A 5DUML 3BZFA 2BVOA 2MNUA 1AI1H 5FYJE 1I7ZA 3SGDI 3WNPA 1IKFL 4ZS7H 4K7FA 5E7FA 4PJIB 3K8KA 1SJHA 4YO0A 1VPOH 1TQCB 1JZ2A 1BJ1H 3RIAF 4AEIL 5TE4L 3DPBA 4K7FB 1JK8A 4DCQA 1DJSA 4ZFFA 4G9FA 3BKYL 3DBXB 1TENA 3N85L 2V2XB 3QHZH 1A4JA 5D7LA 2P42B 2AEQH 1T04A 2VL5A 1QZ1A 4FQHB 1CE1L 3RIFF 3S3PA 5GQBA 3BP7B 4YHOH 4NZDA 1X5XA 3AY4A 5DMJB 1YEDB 3BESR 3V6FB 2XN9B 4HT1H 1N4XH 1A8JH 5GS0C 4NO2A 1NAML 2CKBA 3CFBA 1JGUH 4M1DL 3DI3B 5DQJA 5F89A 1N4XL 2PTVA 3MUZ1 4OZHF 4APQC 3C5JA 3LEVH 3BGMA 3PQYA 5F9DC 5FYLD 4ZQKA 4QCIA 5ICXA 4MJIE 1Q9WA 3GBMH 2IEPA 5BXFA 2NY6C 1KN4H 1KSRA 3WFBH 3WS6C 3MUY1 5TH2B 2SEBB 1A5FH 1GIGL 1MIML 1QSFB 5EUOB 2F53D 3B2VL 1TJHH 4HS8L 4ZFOA 5EO1B 4WFEE 2FIKB 2C3WA 1G9MH 3IF1A 1FAIH 1DANU 3RZCD 1I75A 5I1IH 2BVPA 1HWGB 1K4CB 5DK0A 2ZPKH 3LS5L 1CD0A 1HH9A 2N56A 5DS8A 2HTLD 3QDJB 4NQSB 3HC3H 1SY6L 4QRRA 1TJIL 3DV6B 4NUJA 4ZAKB 3SPVA 4E41E 3E6FA 4MVBC 4OD2B 1BD2E 4MQTB 3D25A 4BYHA 1RK1A 1I9RL 5BZWA 4BSWA 4PRHB 3SE8L 4GAJL 3MCKB 3T4AA 3SGJA 3BZ4A 4FTVB 4HMEA 3UTOA 5EBWA 3BDBA 5IEHA 3WUWB 4U1GC 4WUUD 4AMKH 2GJJA 3VFTB 3VU2A 1MCOH 4Z18A 2ZCLH 3TBTA 3MRMA 1S8DA 5FGCB 3UTPE 1S7UA 3PP4L 3R0MA 4I9WD 1IM9B 4D9LL 4HV8B 2HT4D 4F7CB 5L6YL 2OSLB 1B0RB 4AK1A 4MSWB 3B43A 2Q7NA 5F71A 2YKLL 2A0LC 4HXBH 1KPUA 5H37H 2HT4C 2NY2B 5KW9H 4N8PA 5ACMA 1HIML 3VFRA 5DRZB 3FO1B 2M8XA 3CJJA 1HI6B 1IAII 4LEXH 3ROOB 3C60C 3QO0A 4X99A 3P30L 3DUSB 1NEZA 3C9NA 3E6HB 5E99L 1FZKA 4MXWH 5DJYA 2AKRB 5DD6A 2XKNA 4HBCL 3VGGA 1U3HC 2FB4L 3G5ZA 3O3AB 1MQ8A 3FQXA 1KLGA 4PJ5D 4FXGA 4G9DB 3ARWA 4X4XA 3JWOL 4J4PC 4PLJC 3O4OB 4OCMC 4OT1L 2Q6WB 4Z7VA 3MRFB 4MD4B 4JM4H 5KSAA 2DL9A 4FG6D 3QISA 3DXAE 1VFAA 1XF5B 5F6HI 3KJ4B 5HI5C 1PLGH 4XMPL 1IQWH 1N6QL 2BK8A 3JVGC 1KJVA 1QG3A 1DEEA 2EC8A 3FT2A 4D9RD 2FBJH 1FQ9C 2NY6D 4Y5YB 4DOHE 3CDCA 4PRDB 3HI6H 5T3XD 4Z7QF 2EICA 3AB0B 4XBPB 4OZGF 4G9FE 5T3ZD 1N0XL 1EEYB 1OSPL 1TVHB 5DRXA 4I77L 1JNJA 4JZNA 3MUJA 4XNZC 3EOBB 1J1OL 5MENB 2E7CA 1TQCC 4HUXB 5CZVH 4NO5B 4R97B 3FQUB 3OL2A 4GKNA 1BVKA 2LTQC 4P4KB 1YJDH 1T3FB 3V6ZA 5EC1B 2OL3H 1ZLSL 5H94B 1G84A 3ZLQC 4IRSD 2A77L 1TZHA 1BM3H 3O8XD 1A4KA 3NGBC 4LAJH 4PRHD 3BXNB 1P6FA 1OAKH 5DD6B 3QEGH 4LCIH 2A77H 5BZDA 1S7TB 3TYFA 1II4E 4UINH 3SBWC 3HZVA 4KQ3L 4PJ8D 4Y2DC 4XWGL 4C58B 4UINL 3HRZB 1YY9D 1FG9C 1QVOA 3PHQA 4BQ9A 5B4MC 1NEUA 4MMXC 3WHXA 4BZ1L 4NO0D 4U3HA 1UXSB 4DVBB 4LP4A 3LKOB 5J6GA 5DJCB 4HS6A 3KYAA 1JCKA 1SVCP 4NJ9H 5CJQH 5B8CA 3ARQA 2E7MA 3U6RA 4O58H 3FRPA 3AS1A 1DLHB 5DVOA 5TE4H 1CD1A 3U0WH 3ZE2F 3P77A 5FM4A 3BP6B 5L8KB 1AGDA 3ZE0F 4EDXA 1L7TH 4IEFB 5IKCB 3QPQD 3RNKA 4MHHI 4YBLC 4JFDD 5TE6H 4CJ0A 2D03H 4G6AD 2KUTA 4RAUB 3KYOB 3RBSA 2CRZA 3FHAA 3SE4A 5JW3L 5IHLB 2XQBL 3TZVA 2WIIA 2X9YA 1LEIB 1WITA 4NQVA 2ITDB 3CFIC 3K7UA 5E2VL 1HKLL 4FFZH 4EIGB 2V5TA 4U31A 2OYPA 1ULVA 1JWMA 3OZ9H 1C1EH 4JZOB 2EIBA 1RZ8B 5ALCH 1G7LA 1DLHA 4JR9H 3O3EB 1XGUB 5L2KB 1BQHA 4KPHH 4WFGE 4Z7OE 4Z7VE 5DK2B 1G9NC 5EU7E 5C0IB 5C0BB 1WSST 5HVWA 3MUHL 3FB6B 1EZVY 1XGYH 2NY1C 3EFFB 5IF0B 1K5NA 2OS7A 1YNLL 1UM5H 4FQJH 4YXLH 5GGQH 2BHUA 4JHBA 2X89D 4NQED 4NQTA 4KK6D 1UZ6E 1IBGL 4DTGH 5CGMA 4HZLB 3K1DA 1MUJB 25C8H 5I1KH 3MV11 3SDXF 5CKAA 1S7XA 1U8NB 1D3CA 2DM2A 4XPBH 3QPXH 2X5PA 4FFYL 3MV7B 2BRRL 4EUPB 3AS0A 5F9AC 5DYOB 3MNWB 2IQAA 3W39A 5D5MB 4X6EA 1SYSA 4FFYH 1JWSB 5JXAL 1ZLWK 5J06A 3OPZH 1IGIH 4WI6A 4LSVL 3BP5A 5DJCA 4WUUE 5IB1B 1MWAB 2APBA 3TNMB 2X4UB 3LEYL 4XPGL 2UVEA 1EK3A 1W0VB 3BISA 4U1GB 2NYYD 2FL5A 3OJDB 5C09E 2OK0H 4GBXA 3W9EB 5T1MA 3F62A 3EOAA 1B88A 4P2RA 1RJYA 3UTSA 5EOCL 3VXSD 4FXLA 3MA7A 3TBYB 4WFHD 4NRYA 1CL7I 1RJZB 1RIVL 4BZYA 1FIEA 1IAIH 2D7QA 1PZ5B 4N68A 4TTDD 4N0YH 5T5FH 4NKOB 3LMJL 3RGVB 1X5KA 3EIFA 4ZUVA 1JZ7A 3V6OA 5I8EB 4G8GB 1YN7B 4YAQB 4AT6B 3O3UN 1ZVYA 4G8GE 4JCMA 4M6NH 5HGAB 4CW1B 4PTTA 1NBVH 4S1SH 2HN7A 2V5YA 5ETUA 4LDLB 4ODWA 3GMPA 4Z78A 4WI2A 4X7EC 5C8JA 2B0SL 4P49A 2DI7A 4PJGA 4EOWH 2FB4H 4JB9L 5HYJB 2BXYA 5ESQB 1CQKA 2VXQL 4YIQA 4C54A 1U8JB 2DM4A 1RAMA 3F58H 3MJGX 3QI9A 4YDLB 5C0RL 3WN5C 1S9XB 3AC0A 4PJDB 4PGEB 5C09B 4YGVA 4YHMH 1VFUA 3T0BA 3F58L 1U8PB 3DRTA 2NTSP 3T4YA 4LRNL 4CADB 2MHAB 3H7LA 5HGDA 5DEFA 1QPPA 3IFLH 3RL1A 2VDNL 1FNHA 4UI2A 4DZBB 1RZKL 3HRPA 3VGFA 4DKFL 1C7SA 5IHZB 5K33A 5GRJH 5SWZA 2XT1B 1TVBA 2HRPL 5T33H 3WL9B 2Z31C 4R90L 2ICWB 2ESVA 4ZUSA 4ZSOA 2F74B 1G9NL 2XWJA 3JTSB 4DEPC 2V9TA 1U0QA 2HKHL 2JKXA 2HRPH 2XNAA 1R0AH 1DN2A 2YC1B 3BKMH 4L5FL 1M7DB 1UWXH 3GMNA 1AD9B 4MNHB 1QLFA 1P7QD 4BK5A 4UILL 5CILL 3ARVA 4U6VH 3IJYB 2BVUA 1QBAA 2OL3L 3ARFD 1N5AB 4DUWA 5HI4C 3NCJL 5HY9A 4PJAA 2IF7A 4WUKL 5HDOA 2CRIA 1MREL 2AK4D 4ZG1A 3BPLC 4N5UA 2AJUH 4S1QL 1T0MB 3BKYH 5D1QB 5IK3B 5BV7L 3QDMB 4KQ3H 4JQXC 3HPJA 3QDJA 3ZHDA 3OHXA 5TFSL 4ODBD 5HVHB 5F8RC 1CT8B 4JPKH 1AC6A 1AFVL 3RWDB 4M1CD 3QEHA 1CGSL 1MHCA 4XNMB 2H26B 4HC1L 3FAWA 3GSRA 5D6CA 1C12B 1F02I 1AP2B 5E8PA 2Y6SD 1VKXA 4TYUA 1A9EA 1FFNB 4M00A 2W07A 5JNYB 4Y4HB 5A1AA 2BHZA 4HWZB 2X4QB 4NWTH 5DJDB 2EE3A 1VESA 1AXSA 3BPNC 4Z7WE 1H15B 5JA9A 4AIZA 3MCLL 1HH9B 3DIFA 3UMTA 4HF5L 3MFGB 3HPLB 2E9WA 1LE9A 1BZ9B 5GPRA 4OGXL 2VQUA 4OLUH 2LTQB 4ODWB 2CJUH 2COQA 1F6FB 4EKXA 3UTZB 3WLWD 3L7FA 3QEQA 1KTKE 1AQDA 4Y16B 2DLFL 2I25N 2P47B 4TNWK 4WJ5B 4DJMA 3GSWA 2B39A 3QFDB 3MRCA 3B5TA 3G04B 5I8OL 4PJCE 5D7LB 2B2XH 3GGWA 1MCJA 2BERA 4D0BA 4YJZL 5SX5K 5DT1L 4S0SD 2A9ML 5KSUA 7CGTA 5CZXD 4MJ5B 3UPCA 4LLWB 1Q1JH 2AI0L 4MQXD 4MNHA 2R0KL 1V3LA 1F4WH 3I6KB 1AQKL 4RFEB 3FQWB 2X4OB 4GRLC 4RCAA 5IP4A 1I7RA 4U1IA 2P5WD 1AD0A 4YXLL 5FUCE 1JGDB 1E6OH 5DFVC 1HYRC 1AIFB 1NKOA 4ODHL 4HW6A 3QJFB 3H9SE 5CP7B 3TNNB 1JNHB 4IRJB 4P5TD 3TBVB 5LGHL 5EN2A 5TPWH 3BPNB 2MWCA 3RVVC 4MA1C 4U6XA 4MNQB 3BD3A 5L9DL 2VITA 4GLRH 4LHJB 1LEKB 1BOYA 3IXAA 2JCCE 4PJ9C 5DRXB 5JXAH 2WNGA 4HX1B 2BDNH 5IB2A 1MQKL 4S1RH 3U4BH 1QA9B 1HHKB 3NGBB 3SDCC 1N7ML 1BAFL 1QFOA 3HC4L 5IW1B 1FNGA 4QNPF 3STZA 4FQ2L 5KOVC 4NN5B 2YPVL 1X3DA 4YPGB 4ZPTA 1Q38A 5GGSY 5ISZA 5IIEA 3IDMA 1J7VR 1A7QL 1T1ZA 3GSWB 2P5WB 4WW2A 5D7IA 3MLRL 4P3WA 3BWAB 1CFTA 1RZ7L 4PD4K 3EKCA 1J18A 4ONGH 2HVKA 4PJFB 4J2XA 2HLAB 1G7HB 2J8UA 1YPZF 5CEZH 5E6IB 3RWIB 1QQDB 4Y4FD 5TF1H 3NACH 5ADPH 4FFWD 2Q6WA 1S7RB 5HYSA 3QUZC 3PHSA 1MFAH 4HLJA 2RQ8A 1R6VA 3BP4B 3BRFA 2ITDA 1K2DB 1V05A 1AE6L 1GHFH 1VFOA 2GK2A 4MZ3A 4NZTL 4XCEB 5IB4B 3PQYD 2OSLA 4YBHA 1MRCH 5CSZA 5DD1L 5EZLB 5D7JC 1IM3B 4X7SH 3AAZB 5C0JA 1SEBA 4OCSH 1ZTXH 2ITCB 2NTFB 4TNVF 3VRLF 3W0WB 3LKQB 4FQXD 2APFA 2IH3B 1RVFH 3BZ4B 5DJXB 1FO0B 1L6XA 1JYWA 4NRZB 4D0DA 4XNMA 1NJ9B 2IBBA 1NUNB 1KJ2A 1B4JH 4JO2H 1EZVX 4U1LB 1AXIB 4GG8A 2O5XH 3H9HB 2F8VA 1NGQL 1RZFH 5HHOA 3SO3B 3QIBB 4Y2OA 1KN2H 4YC2B 3NFPA 4LVHC 5FHAL 3ARZA 2NY3D 3LPFA 5DJ8A 4WFED 3MJ6A 4QRQA 4PB0L 1I7TA 1QFWH 3EDKA 4IHOB 5D2NA 3WIIL 1LE5A 2DRUA 3T2QA 4NQCB 1ACZA 5BMFH 2ED9A 2HJLB 2UV3A 3M17B 4L3CB 2IBZX 3EYVA 1F6LL 4NC1E 5BMFL 1BQHG 4EN3D 2R1WA 4MXVE 3IU4L 3ULUH 4JY4B 1IL1B 2AV1B 5KSAD 1RIHH 3HZYB 2QQQA 1P9MA 2BNRB 4ZFGH 5AZEL 2X4SB 2VDOL 4RMQA 5T1KB 5FYKH 2ZG1A 3NZHH 5I30H 3VH8A 4OF0A 2OTUA 1RIHL 3JTTA 2V5SA 3TBWA 2W92A 4HG4K 4D0CA 4OZFA 3TVMB 3WXWH 5IHZA 1HQRA 1YPZE 1HHGB 3OMZA 1G0YR 2QSCL 1CLOH 4QOKB 5CUSH 1QFUH 2AJUL 1EDQA 5F7UA 1D9KA 4X5XA 1KT2A 2XI9A 4QTIH 1L9NA 5FOBA 2VQTA 4TRPH 4F37F 1DFBH 1AR1C 4RX4D 3DVGA 1S9VB 3A6CL 4JFOA 1JZ3A 1ZSDA 4LOUD 5FO8A 4ENEC 2CIIA 2E7BA 1INDH 1AFVH 3VH8G 4XVSL 3QIBC 4HUWA 1DN0A 5CIPB 2DQEL 4PJXF 4WWKD 1WZ1L 4JKPH 2VMFA 2PTUA 4O4YH 2N4IA 3I3DA 5ESQA 4BUHA 3FO0H 1JTTA 3TBVA 5EWIL 3WN5B 1I1YB 3TLRA 4CVZA 1JHKH 2EDRA 1AGFA 5KAQF 4UTBL 1IGCH 2UYLB 2EIZB 5F21B 4R2GB 4HCRA 4J6RH 5FHBH 2Y4SA 3V8CA 4HUVA 5DRWB 4PRBB 4BUGA 3T08A 3TA3D 3PWNA 4R0LB 1FIGL 3MCG1 3BE1L 3P4NA 1AGEB 1PG7L 3B9KA 5DJ6B 3L7EB 1V7NL 1YY8A 4LMQI 2DDQL 2EO9A 3HAEB 1OAZH 4ELME 4CJ1A 3VD9A 2Y1VA 3P73A 4EN3B 4ODVH 4TPRL 4HPOL 3GKWL 2PXYA 4FFWC 4RFOH 4LDOB 5BJTA 1N59A 3VFOB 1U91A 3RU8L 1HHJA 3QEUA 2YUVA 1FNSH 2HLFD 1CICA 3WNNA 3KXFE 1ZGLA 2F5BL 1ZANH 4P2RE 4WTZG 3S98A 3BKCL 1J05B 2C1PB 3KPTA 4EUPG 4WJ5A 3UX9B 1IE5A 1ZHBB 4G8GD 1UB5A 2PW1B 4L1HA 2NY3B 2VZSA 2MCPH 5MERB 4KU1A 3NFSL 3V52H 2A1WH 1KEMH 3TH4T 4U7KA 4NNYA 5GSRB 3H42L 5CD5D 2LU4A 4XPGH 3TBTB 3TN0C 5IBLC 1XH3B 3NBNA 1GGUA 2QQLL 1UZ6F 4N9OB 4M9PA 4WU7A 3RTQD 2ERJB 3RVVD 3RNQB 1OTUC 3BN3B 4NN6C 1MEXH 1XF3B 4RWYL 3MLTB 4ELMA 3L1OL 1IKNC 3ARTA 4H5SA 4ZD3H 3Q3GB 5I17B 2D7MA 2BJMH 1AP2A 1R3HB 5JA8B 4N0UE 3VXNB 4DN3H 2AQ1A 1Z9LA 5JLZA 1F2XK 5DJZA 4WI7A 5IB1A 1ZLVK 4MJID 4XPTL 2NY6B 1UWGL 3MFFB 1A1MA 3S5LB 3NABH 1T2JA 3VWKB 5I73B 1QSFA 3U0PA 5BO1L 2XZCL 2ZCHH 1QHOA 3BQUC 4LL9A 3MNWA 3FQXB 4KI5C 3RWHA 1LNUB 1QBML 1JPFA 1GGCH 2HVJB 4JDZB 5F70A 1U8NA 2ZCHL 2YBRB 5JOPE 2G60L 1PLGL 4XMPH 2B8OT 2XRAH 3DI2B 3SGEI 3EOTL 1IAOA 2VKWA 3NOIA 2FGZA 5IJVA 1BOGA 4KWUA 1AHWA 1SM3L 3AMLA 3A67L 3B3IA 5GGVL 3SE3C 2EXWD 3QR2A 2ZG2A 5EU4B 4K3GA 1EGJL 3RNKB 1T66C 3L95A 3X3GH 1CXFA 3ZDZE 1G7JA 3LQZA 4U4BA 1NBZB 1G0XA 3LPWA 5F1IB 5ICYA 2IQ9L 2CIKB 1UEYA 2NXYD 4LIQH 1Q72L 3LD8C 1PYWA 3GJEA 4PJEF 4KVNH 4OTXH 1TVBB 1T1YB 1LP9A 5HY9B 1JF1A 4PY8J 4NRZA 2XQYG 2AK4A 3DUUA 1OCWH 1F4XH 3QUKB 3HRZA 3O4LE 1GOGA 3DRQB 3PDOB 2YS4A 2NY2C 1FZOB 1T5XB 2KH2B 3MLWL 3LN5B 3A6BH 2CLVB 3MCKA 2B1AH 3K4AA 2Z31A 1SEBB 3QEQD 1P69B 3NCEB 3VXPB 1KFAH 3ZZ1A 4WUKH 1PVHA 1KIUA 2PETA 3B2VH 4K3DH 2B1AL 1NGPL 4J1UA 3ZL4L 4ZSOB 3UTTD 2F15A 1RZKC 4HKJA 4W4OC 5SWZB 3GJFA 3G5XA 3PNWA 3NH7L 1EO7A 4J3VA 4ZUWB 1U3HA 1RULL 5F3BB 4NNYB 3VXUB 4BZ1H 2YUXA 4G6JL 3U46A 2ZSVB 2VABA 3QFJB 3CUPA 3RVUC 3KPNB 3MGOB 4PV8B 4NM8H 1OD7A 4L8CA 4LKXA 3V0AC 1BBDH 3C60A 3KYNA 3QA3B 3KXFA 1NANI 1EEYA 5F1SA 1A7OL 4NZRH 1M7XA 4KJQD 5KVDH 2OQJB 2ZOKB 5EBLB 3WYRA 1BF2A 5DC9B 4L4TA 1EFXB 3MROB 4WHTA 5ADOL 4HJ0C 4UIKL 3AU1B 4J8RA 3GBNL 4YLQT 1NFKA 3WJJA 1QEWB 4Z0XA 1YUHA 2AJ3B 2IADB 1NCWL 1WTLA 4JFEE 4JN2A 6FABH 1OWRM 5IVNA 3KS0J 2Q76A 4UQ2A 2NNAA 3TNNA 2R39A 3X11A 2IANA 2O26U 4GW1A 3P0YH 4FQQA 3DX8B 1GGTA 3TCLA 5HD8C 2WUCL 5FM5O 2CKBL 3GNMH 2CXKA 5JUEH 2BY0A 4PS4L 3MTRA 2P44B 5E8DL 5DJYB 4UT9H 1OLZA 1W8NA 3EOAB 4DGVL 3KDMA 2D2OA 2BNQE 4MX7A 3HUJE 5IMKA 3HMXL 3H9ZA 2EIDA 4DGIH 1A6TB 1YMME 4R2GC 1FLTX 5CP7A 5SWZD 3MRGB 3VW3H 4OZHA 3FB6A 4JRXA 1I8IA 2AXGA 3ARDD 4OT1H 3KGRA 1HSBB 2YZ1A 4NC0B 1PEZA 1NGYA 2J1KA 3C60B 3PXHA 1U8KB 1U92B 4HFUL 3LCYA 4XXCC 4X6DE 2F8OA 4GW1B 5KSBE 2BFVH 5L88L 4YDVB 2LU7A 1I1YA 4OZFG 3SCMC 5IT2L 3IFOB 3QO1B 4GMSH 1IGML 3RWEB 3MRLA 5CBEA 4K3JH 4WNQA 2AABH 3VFWA 2FO4A 2NW2B 1BZ9A 1Y6KR 3WS3A 3CDGA 1GGBH 3OAUL 2VL4A 3MRPB 2E7LA 4AIZB 5DQ9A 1Y6NR 4D2NA 3VXUE 1GXEA 4P5MA 5I9QC 3HKFA 2JJVA 1FZKB 2WUBH 3VRJB 3ECBA 2PYFA 3KYNB 3QA3A 4AQ1B 3WD5H 1OQXA 4ALAL 3V0VA 2F54B 5I9QB 5T5NF 5DHYA 1KCVH 1BVLB 1RUPL 4K23H 5C07A 1KB5A 4H88L 3I84A 1CFVL 1BFOB 3CDYA 4M61B 5D7SH 1MEXL 2A6DB 2FATH 1NSNH 4WFFD 5DJ8B 2VZUA 3EJYD 2VRAA 3G5XB 2QSTA 5E1AA 5EOQH 3KXFD 5C2BH 2Y9RT 3FB8B 5BW7A 2FLBT 4M1GL 5BRZD 2ED8A 3OKKB 3VFGL 5TGBB 2V5MA 1F8TH 1WUNT 4YWGH 4ZO6A 5TH2A 1OAYL 1V5JA 2W0LA 3VFGH 4NDMA 5EA0H 1WBZB 1NAKH 4DZ8B 1CLZH 1HH6A 2IWGA 5IFJB 3W2DL 4QTHB 1VPOL 2F5AL 5LKNA 2YD2A 4L1DA 3VFUB 2VLJE 2DQFA 1MCIA 4ODUA 5F9JB 2VSDA 2VDPH 3NCBB 2ILLA 4TOYH 3H7BB 5FYJH 5HTSA 4AEHL 2QKIA 5D1QC 1SM3H 3RQ3A 1TXKA 5IBLD 5C6TL 3TN0D 3BEVB 1SBSH 5ITFA 1EMTL 1A1MB 5EO1A 3LKRA 4K9EH 1FHGA 1JK8B 3I02B 5I1EH 1NPUA 3QPQC 5SV3A 1NDMB 4GAYB 4LPWA 3DMMD 5F3HB 4WFGD 3GSVA 4KZDL 3C09C 4M43H 1KIQB 3BKML 2YBRA 5FIEA 1F3RB 1SBBA 3KG5A 5M7QA 4K94H 4H8WH 3MRPA 3CLEH 4G6MH 4P2OB 4I0PB 3VGAC 4MLIA 1FRGH 4MJ6A 4CMMA 3KVQA 4P9HH 5HHXL 3MLYL 3O9WD 2PXYC 4RFNC 2JB6A 2X4PA 5IWLC 1CWVA 4ORZC 5B4MD 5I1CH 1MREH 5FKAB 5A43C 12E8H 1NC4A 1PAMA 1X7QA 2IGFL 2OMBA 1D5XA 2GUOA 1J8HB 1U8OA 3O8XB 4YAQA 2R9HC 3WO4B 3CZFA 5GGSB 4HIIB 1J12A 3MV8B 4QRRD 3G5ZB 2NXZD 2YA1A 3HC3L 4QTIL 3TT1H 1GVIA 5F44A 5GGQL 2FR4B 1VSCA 4L8DA 5LAXB 3MLVH 3F7QA 3NVQA 3TT3H 2DWEA 5D1ZA 5C0GA 1FBIL 5JW4M 4GW5B 4L8CB 1HI6A 4KQ4L 3ZKMC 2X4RA 1QP1A 4O2FB 5GSVB 4XAKD 3ROLA 2BSRA 3DXAA 3LB6D 3QDGD 4MNQE 4WHDA 2P5ED 3GSNB 3TCLB 1B0WA 4P59H 1JHKL 4S10A 1JN6A 2AXFA 5C2UB 3MLZL 4WCYL 3C09B 3IDIB 4J1UB 1FGNL 1YEIH 2X41A 5FO9A 3VE0A 4L3EA 2ADIB 1I3VA 2GTWB 1P6AB 4PJCF 3VXRD 2H2PD 3F7PC 1YUHB 4KMTH 3UTQA 1IMHC 2CLRB 3O6FC 3IETA 3HPLA 4O00A 3CCHA 3F12B 1AO7A 4IOIB 3HI1B 3K8LA 3OG4B 1HNGA 1CYGA 3UAJD 2DLFH 4I2XE 4ONFL 1H8OA 1VGEL 1WC7A 3B9KD 2F58L 1WBZA 1I3RB 1EPFA 4Y5XB 5KSAC 5DDHB 2C26A 1HINH 1EH9A 1NCAH 2V17L 4KH2A 4LBEB 4CNIA 3VGBA 4NKIL 3M8OL 1MAML 4KMLB 5FK9B 5GRZA 3CFDA 3FOLA 4PJEA 3D2UD 4LLVA 2E9JA 3LQAH 4NKQB 3N06B 3CAFA 5HI3C 4Y4KA 4ELMF 3BWUC 1SQ2N 3C60D 3SJVB 4GAFB 3SN6N 3SKJH 1AHWB 3IDXH 1Q9LB 3QH3B 3X14A 1WGOA 1AGBA 3HNTH 1XCQB 3P9MA 2D31B 2DM3A 3RGVD 1F45A 4MDJA 3B8SA 4PP2A 5F3HA 5DUBB 1QRNA 3GSNH 2A0LD 2C9AA 4YUEH 4GXUN 1YZZA 2ZUWA 2E7LC 4FS0A 2UZIH 3V6OC 3O11B 4LLAA 2KQMA 4IMKC 4NNPL 3L3DA 2DQCL 1I85A 2R2EA 3FMGH 4M6OL 5LJYH 3OXSA 4FTVD 3SCMA 1M6OA 3MV9B 4ZO8A 3QHFH 4FQ2H 4ZTOL 5E70A 2XZQL 5AYQA 1CFQA 4GLRI 4Y88A 1IC5L 1KC5L 3BIBX 1PKQB 5D2NC 4OCYL 5HHQA 1OSZA 4RX4A 3WDIA 5GRUH 1LEIA 5TDOB 3TIDA 4Y5XC 4G9FB 3BX7C 4PREB 3K2UH 4XGZA 4EUPH 1ND0B 2XTLA 1A7BA 1EVUA 4FABH 4XCFH 3CVHL 5L8LB 3M1BA 1A21A 4R7DB 2YRLA 4FRWA 5INCA 1AGDB 4XP6L 3A67H 4ZO7A 3SKUD 4YGVB 2XN9A 1F8TL 4LLUA 2CLRA 1ITBB 1F11B 5JIIA 1KIPB 4O2EB 2VAAB 1FO0L 3FFCD 5EORH 3BKJH 5DD5L 3V5KA 2W9EL 3OJMB 3VXSA 2FEDC 3ZDXE 2ICWA 5TDNA 3HE6B 4PJ9D 3WKMH 3LHPL 3W2DH 1NAMH 4U0QB 3DX9A 3O41B 1FZJB 1KELH 1QQDA 4JAMB 5E2WL 4H1LA 1QHPA 3DOSA 4P5TC 4YDJA 3HE7B 1KTRL 1LK3L 3Q6FB 3BVNA 3DRTB 3RPIA 4WEBL 4FMFA 2XICA 3CCHB 4JKKA 2DAVA 4H20L 4UMGA 1QO3B 4WY7H 1IM3A 2EYSA 4PB0H 1B9ZA 2QQKL 2VZOA 1A4KB 3MCLH 3FRUA 4WTZA 4ZUTA 5TQ0H 1F3DJ 3T1FA 1WFTA 3V8OA 1H3XA 5HHMB 4PRIB 5CZXC 3SDCA 1LEGA 2FECL 4UOW0 3R0NA 4NRXB 5JOFA 3MRRB 3UTSD 1KJVB 3K4ZA 4WUUA 3GMLA 1NC4B 4KZDH 2XY2A 1RUKL 2MKLC 1W72B 3S4SA 1O7VA 4LVNB 2GSIA 3T2PA 2C7UB 4RRPA 2CLZB 2FGWH 3VA6A 3ILQD 4MQ7A 1SYSB 4G43B 5ACLA 3IVKA 5EU5B 4Y19D 1XGPA 4HUWB 3ARRA 2ATKB 5SWSD 1CXIA 3OKNB 4N8VG 3IU3B 4NFBA 1ZVHA 2E6JA 3HR5B 2EDEA 4LLDA 5FDYA 1MCPL 5HBBA 1XF1A 4OM0L 1NEZB 4XNYL 1QPXA 2AEWA 3D39A 4JFDE 3L7EA 2V6HA 4TRPL 4XGZB 4JM2B 1QRNE 4G3YL 5I16B 3BD4A 1M05A 5FUOH 2KPNA 4LQ1A 2F53B 1UJ3B 2DQEH 1HIMH 1IGJB 4KGLA 3KWWA 3V7MA 3EAKA 3ZDXF 4IIQB 3TN0A 2EC9U 2VAAA 4Y16A 4PJAF 4C59B 1BBJB 4GXUM 2DJUA 1GL4B 5D7LE 4NSKB 2OTWA 5FYJD 2XKNB 4CU6A 5MI0B 4HV8A 1TQBB 3P30H 4HZLA 1JWMB 1MRFH 5LQBL 2WLYA 5EOTA 5JMOC 3MV01 3EDDA 4L3CA 4Z76B 5A2IH 4J6RL 4U1KB 2H3NA 3T2NH 1H15A 3F65A 3MLZH 4WCYH 4XPHH 1GZPB 4N5EC 2DLGA 3T0AA 2PYEE 4YGAB 5EOCH 3FO9A 3MBEB 5D96B 3VXRE 4N1HB 4XPHL 1ES0A 3SKNB 1YPZA 1BGXH 3C08L 4XVJH 1RZ7H 2YPLE 1AQDB 3OQ3B 4GW4A 1G6RH 3MACH 3MRBB 3TVMA 4G5ZL 3KPMB 1V3JA 3NACL 4LCYA 5ADPL 5BS0B 2WWMC 3RDTD 3KLHD 1IT9L 1GOFA 2DBLH 3IF1B 1TMCB 4XC3H 1IRAY 35C8H 3QFJE 2Q86B 3BN9D 1W0WB 1N0XH 2EE2A 3KPRD 4KY1L 2PCPB 1E4JA 4P2QD 3C6LA 2BVQB 2N7BA 3QIWB 3RIFK 4PB9L 3VCLA 1F2QA 2A1WL 4U05A 5I18L 5JDSB 1DQLH 1FJ1B 1Q9WB 1MHHB 3GK8H 2ICEA 5AD0A 5DVNA 1NH6A 3KS0H 4PJGF 4P5MB 5D2NE 2Z93A 4JDTL 1K2DA 2E3VA 2IBZY 3FB8A 2JCCA 1Z9OA 5DFTA 2H26A 1GRWA 1UZ8A 1T0NB 2P24B 4Q7DA 4JN1L 2ADGB 3O4LB 5GRYA 2QR0B 4GW4B 1YJDC 3GMRA 3TJHD 2YPLA 3QIWD 3UROR 4P9HC 5C0BE 5D7IB 3MV7D 2ATPA 3GMQA 1DBML 1T0MA 5D7IF 3V6OE 2XG4A 4HKBA 1VFBB 1I8IB 2AEPL 3WHXB 4P4KC 3HE6C 1I1CA 2FSEA 3T0EB 1DVFD 3AROA 5GSVA 3NABL 5DRNA 1R0AL 1OAYH 2ZJSL 4PJDF 3VD7A 1MCNA 5F1NB 3PF2A 2H8PB 2MPAL 1JFQL 5CJ5A 2FHFA 5FYLE 3GSXB 4LLDB 4AEIH 1UG9A 4JG0H 5AUMB 2FDBP 2OL3A 3VE0B 3EBAA 5FO9B 3ULVC 1OAUH 1BQLH 1R5VA 4KUZL 4NC2B 1XF2A 1D5ZB 3DVFA 4YHLL 2QADB 3KWWB 5HYSB 3MREA 1P7KA 3TZVD 1BZ7B 1NCBL 5TQ2H 4QHKI 3AS2A 2WMPA 1D5IL 4XHJD 2OXHA 1OAQL 4OKDA 5CEYA 4LPTA 4X4YB 4K7PX 5D7KE 1OB1B 1U3JA 1LD9A 2EE9A 3PABB 4P3CL 1JL8A 3BSZL 2FYYB 2X70A 4Z0XB 3D39B 3IRZA 4LCUB 1BMGA 1CGSH 2DWEB 4TSCL 1Y6MR 2J8OA 5KSUB 1JGUL 4JFPA 5CSGA 2V7HB 3OB8A 3QDGA 5D9SB 4Y4FA 4M7LL 3TC9A 4R0LC 4NO0B 1G6RA 1OM3L 5FYKD 1M7IA 1YEGH 3BRGC 15C8L 1MCQA 4OQTH 4R4BA 3AS3A 5DQDH 4L4VA 1HWHB 4K94L 5FOJA 4URTB 4A2LA 4PJBE 3NPSB 2I07B 3SGDH 5JHDD 3BN9C 1T1XA 5HHME 1VFAB 3KJ6L 4AL8H 2Q76B 5D5MF 2H32B 2NY5H 4WY7L 1KCRH 5KVEL 1T7ZA 5E7BA 1I85C 1QEWA 4IMLA 2DYPA 5TQ0L 2E8ZA 4PYHA 1FZMA 4LCWE 1MIMH 2X4OA 2XTJC 2QR0A 4HIXH 1IFHL 1T4KB 2YD7A 3L3OB 3O3BB 3GHEL 1Z0NA 3VFUA 4G6JH 4OIIL 1IC4H 4ZOEA 4HBQA 4ODVL 4QRUA 3SY0B 2ADFL 4ZDHA 1HNFA 3UTSB 4N5ED 4KHXL 2HFFB 3L3IB 4W68A 5DRNB 4L3AA 3C2AL 3LKRB 3CUPB 3CFCL 5E5MA 4PG9A 1S7SA 3BKCH 4ZUUA 1WZMA 4XH2A 3D25B 4ODXB 3VD3A 1T1WB 3BP5B 2HFEB 3VG9B 4OLYH 1MI5A 3I3EA 4MSWA 3GO1L 2XKUA 3O4LA 5B3NA 4PGDA 5F9JA 2DF3A 4ZNEA 1T1WA 3S37X 2D9CA 3F7VA 5IEKA 1BFSA 4A6YH 4JHZA 4DEPB 4NYLB 1KB5B 2YPKB 5A3IC 3HNSH 3SJVD 5T3XE 5ANMB 1HSAA 4HCRL 5CIPA 1XMWA 3C5ZD 4A6YB 1WISA 3T3ME 1REIA 2A73B 3NZ8A 2FBOJ 5JMRA 4KI1A 2YEZB 2VZ1A 4KVCH 5E99H 1TZGH 1B90A 5TDPB 1LO0L 2GFBB 5GS0H 1MQKH 4KXZH 2FIRT 5D2LB 3PWLB 1NAMA 1IC1A 1I7UA 5IB4A 3U79A 3KNBA 2YUZA 5HVHC 4QRPD 3O3DA 1RMFH 1HINL 1N7MH 1NCAL 2V17H 3QB7C 3QUZA 3QUXB 2PO6C 4G42B 4X4ME 5C08A 3CFBB 1NFDB 2KKQA 2ERJC 3N1GC 1EHAA 4Y2DD 2BVPB 4PD4J 4PJBF 3B9EA 3ZTJH 3LIZL 5FYKE 4DGIL 4H0IA 3QO1A 4JFZL 1N5YH 1MY7A 4HJJL 1ED3B 3QQ3A 1N64H 2Z91A 2YD5A 5D1QA 3AREB 1DQMH 2VXSH 1ES0B 1K9TA 3LD8B 4UV7H 3JWOH 1QBBA 4KROC 4OZHB 4TUJB 2WW8A 2R8SL 2XFXA 1U3YA 2VLRB 4KJPD 5EDXA 3IDXL 2CMRL 2XA8H 3BIKA 1XF3A 4Z77B 5GGRY 3IFLL 3LN4A 1N6QH 3ZKQD 1HCVA 2H45A 1U8JA 5EOTB 2PF6A 2KZ1B 4RAVA 1ONQA 1KBGH 2GQHA 4QRUB 1WWAX 1QOKA 1ZT1A 2UZIL 5E5UB 1OB1A 3B83A 2A6JB 2HG5B 5D2LE 1ZHNB 1J86A 1J0HA 3L3HA 1EUTA 1VGKA 1UFUA 5EBMB 4M6OH 3GUTB 3QJFA 3Q48A 4YHNB 3D3VA 4XX1E 3KYKH 5GJTH 3RWCB 3MRHB 5CHNB 4L5FH 3JZ7A 4Q0XH 4ZTOH 3C87A 4R4FL 1A1OB 2GJ6E 4LBEA 5ALBH 3WCYA 1J1OH 4XH2B 4JFHE 1IEAB 4WUUB 5HI5D 2O5YH 4TULL 3RUGA 4GKNB 3HFMH 2P8PB 2IH3A 1DQJA 3G6JF 3B9VA 1MFDH 3QG7H 4HIHB 4XCYB 3P73B 5C3LD 3IETB 1DQJB 2DQJH 3MV7E 5C6PB 2NX5E 3GRWH 4RAHA 4XPAH 4JO1L 1A0QH 4YHPB 4NKMA 4Q9RL 2HKFH 2FH8A 2EH7L 1WT5A 2YA2A 1IGYA 3J7HA 1CIUA 1ACYL 2MPAH 3FT4A 3NH7H 4Z7NF 1AXTH 3L7FB 4RGMC 4MWFB 5DUPH 3X3FL 2J4WH 2WINB 5GGTH 4JANA 4HKXB 2JJSC 3FQUA 3FCTB 3ULVE 1FVEB 2CGRL 4UDTA 3U1SL 2NY7H 2I9TA 1YN7A 4NJAL 4PJXE 5L2KE 1AKJB 3VFNA 5GGTL 1YEKH 4AEHH 4LASL 5KS9A 4PYGA 4BQ8A 1OARL 1GC1C 5EB9A 3GSUA 4O2CB 3QIWC 4MJIA 3STLA 5C0BD 4BH7A 1G6RB 1MCDA 1R5VB 3TBYA 1DQQB 4LQFH 1MCLA 1UWEL 3QHZL 4OUUB 5C0CE 2LAAA 4MDIB 5INCB 1E4WL 3U0WL 1HEZA 4B0MM 3RJDA 4EVNB 4LSQH 1HN1A 1LEKA 1DBKH 1J88A 5IQ7H 3KPNA 4JREB 4FFVC 3CVIL 4TNWF 4OGAD 1MFCH 3RTQA 1W0VA 4RDQF 3IXTB 5KSVA 4X9GA 4Y19A 3NCYP 3TIDB 3R1GH 5C7XH 1ADQL 5AWNL 4WV1B 3VGEA 5JQHC 4QOKE 1P7KB 1DBAH 2B2XL 1WZKA 4PR5B 2NY4C 1DUZA 1FGVL 1N8ZA 4MD5B 3SDXE 4U3CA 3MNZB 1OHQA 2X10A 2CUHA 4YXHH 1A6UL 3I6KA 3O45A 1FGVH 1H8NA 2LAGB 5E4IA 4LLWA 2WWMD 5L2JA 4M6MH 2HH0L 1P9MC 1FL3A 1JPSL 4BQCA 1JTOA 4P5TA 3L6FB 1UGNA 2BOCA 1NEZG 1CGWA 1T0PB 5IJVB 3MLXL 3O0RH 4ERSH 5ITBH 3UAJC 2HH0H 4FTVA 4H26B 1ZK9A 4ETYA 5FF6A 1FC2D 2W0PA 4QHMB 4Z9KB 4RFOL 2OTWB 2LFGA 2ZSWB 3LS5H 1BP3B 4GRMA 2Z4QB 4APQD 1L7IH 4PRPB 5E94B 3BFOA 1AY1L 2C1OB 3SE8H 1CLYH 4ODUB 5ILTH 4DKEH 1GGBL 3OAUH 4LLVB 4OZIA 3EYVB 1A6PA 3I9GL 1B6UA 4PJHB 4HJGA 3WHE0 1J10A 3L3JA 1E4XH 1YEEL 4HQQH 4UAOB 1K3IA 1IAIM 4PJ8A 1FGNH 3VG0L 1YEIL 1AGBB 2XN9D 2J7LA 3WD5L 4MCZB 5IFAH 1YEEH 4LSRH 4HXAL 3E8UL 3SDYH 4LCWD 1KCVL 1NCTA 3QNXB 2DWDA 5F96H 3GDBA 1VGEH 3ZYJA 3RWFA 3NFNB 2GAZB 3GHBL 3BI9X 2Y23A 1RY7B 1UH3A 2WK2A 4KVCL 5F1KC 1LDPH 5KVGH 2UWEF 4NRXA 4ZFOB 3G9AB 1MRCL 2FX9L 4ETQB 1FORL 1URLA 4YWGL 3U83A 5CWSB 1T6VN 3MLTA 4ELMB 3MRQA 5BRZB 1RK0A 4XPFH 4B5EA 3H9YA 3DYPA 2KL6A 2A6IB 4XZUA 2Y07L 6CGTA 5HPMA 1U91B 2W9DH 3D69A 3FKUS 2PNDA 3MODL 1NDGA 1D9KD 1LILA 1FYTA 2Y36L 4JFQB 4KTDL 1SJEA 2WBKA 4JKLA 1TNNA 2W9DL 4JANB 3T0XA 5FKPA 5EN2B 4KC3B 4NSKA 4TOYL 1WWBX 2CK2A 2UZXB 4KTDH 4IRZL 1MI5D 1G7IB 1MFBL 4M6AA 3O4LD 4JG1L 1X5HA 2VLKA 5C0EA 1M05B 5LGJB 5E6ID 5FKAA 2YOCA 2P8LA 1DANT 2QJDA 4FXKB 2WWKO 4F9LA 2VDKH 3M1BB 3WFEL 3WFDH 3OKOB 4P2OA 4OZHE 4NQEA 4QXTB 3PWUA 3QZWB 4HUKB 2BY1A 3D69B 3ARGD 3KPSE 4XB8A 1H9VA 3U9UA 3U0TB 3TVMC 1U8IA 1Q94A 3MLWH 1FCGA 3T3PE 4X6FB 2Q3ZA 3RX5A 3MLYH 5H2BA 1PY9A 2ARJA 3QNYA 5IUSA 5CWSA 4U6VL 1AD0B 4OB5L 1HYSC 1NMAL 1L6ZA 2D0HA 4Z0BL 2IMMA 2HG5A 3IDYC 3QQ3B 2AERT 5TJWK 1M6OB 1TQBC 3V0WH 1ZT1B 4U3XA 1CD8A 3PJSB 4UNVA 4V1DB 4P46D 3VXUA 1DDHA 5JOFB 2BNUA 2VLLB 1DSFL 3V6BR 1FYTB 5T1KA 4Q6IB 1MPAH 1AHWC 1LO3L 4JQIH 4F3FB 2UWEB 2D0FA 1HXYB 2CO7B 4DQOL 4F8TA 5J11B 1KENL 1L0YA 1Z3GH 4HGWB 1CL7H 1WZ1H 1P53A 4NQDD 4Q6IC 5FDWB 3MRQB 5BRZA 2BVQA 3GSQB 3VI3F 2VTFA 4N0UB 1QFWM 2AK1L 5F7EL 5T1MB 5C0CB 4R26H 5IW3A 3BPCA 3LQMA 4IS6A 5GRWA 4QRSB 5JDJA 3QUMA 1XIWC 4NT6A 3D3VD 5HSFA 1YMMA 5F7FA 3U30C 1FDLL 4I18C 4GKZB 1OSZB 1DVFA 1FIGH 3S96A 1XFPA 2K3TA 1TJHL 4F58H 3ULVF 1DZBA 5KG9B 1MY5A 4I48A 4P5KA 2GCYB 3EO1A 4X7DC 5KOMC 2X42A 1UXSA 4ORGA 4EI6B 1LK2A 2X7LB 5DGRA 3TPUA 1LP9F 3RU8H 1FZOA 1IC7H 3MJ8B 1Z9MA 1KULA 3O2WH 1CN4A 4UOW1 4YQXH 1ZANL 3KPRE 1UA6L 3PHOA 1VERA 5IVXE 3QDMD 5HXMA 3UZEA 1ZGLP 5HYQB 1MF2L 3JV0A 5ID0B 3Q2CA 4OD3L 3IB4A 3OHXB 1I3GH 5F7HA 3EYFA 4DKAA 1R5WB 4P3DB 1U41A 2HTKD 3QI9C 2OZ4L 3SJVA 1MCBA 1RFDL 3AB0C 2KQNA 3DHJA 3ULSB 3PP4H 3MMEB 5IR1A 5FF6B 1F4WL 4DCQB 3G6JE 2E6QA 3PP3K 1RV6X 4OV6F 2VSCA 1J8HE 2VE6A 3SKJL 1OW0C 5EIQA 3MA9L 1TFHA 3SY0A 4ZFZA 2EE6A 4K3JL 4U49A 1I8LC 3QUXC 4PJHE 2BRRH 1J11A 4QCIB 5ICXB 2NZ9D 3FT3B 1ROWA 1GGIH 3MO1A 1S3KL 1QA9A 4YUEL 3QXDA 1AGCA 1KJ2L 2AJYH 4DN3L 5F88B 3VXOA 5LGHH 2NY5C 4XAKE 2OJEB 3QUML 4NP4H 4Y0GA 3I9GH 2CKBB 4R8WH 4MAUL 5I1HH 2VR4A 1UWGH 4L29B 3WL9A 3UYRL 4XWOC 3WJLC 3VGDA 1OGAA 4OQ1A 1ETZA 1KIRA 2NY1B 2X4PB 2DQGH 3NIFF 5IFAL 1I1FA 3B8YA 1J0YA 3IDGA 1KB5L 3W0WE 4QNPE 4CW1A 2NXZC 3FOLB 4PJEB 2XY1A 3SJVE 2ZUXA 4XMKH 5F96L 1ZHLA 3OKLA 5CBAB 4ODXA 3EOTH 4ZS6D 3TF7C 2R2BA 1DBJH 4LARL 4PG9B 1PZ5A 4Y5XA 5DD1H 2R4SH 1NFIB 3HCVA 5DD0L 4JRXD 3MA7B 4OCWL 3SDXB 3O9WC 2NY2D 3AGVA 1CTNA 1JGVL 4IDLA 2H6PA 4KKAC 4Y19E 5DJAA 2FNBA 4OCWH 4E0RB 5I18H 1KBGL 4BM7A 4M93C 4U0RB 3AFLA 4EOWL 4JB9H 3MNVA 3S6CA 1H8SA 1ZTXL 3LY6A 3QNZB 4M02A 3O8XA 2C1PA 3FQRA 2XTJB 2V7NB 2GT9B 4OM1L 1V7MH 3GMLB 5D5MA 5FYJU 1JHTA 1H3PH 3PL6D 1UC6A 4NO5A 1F11A 5IESH 4KRPC 4TTGA 3CXDH 2JIXA 1B4JL 1SMOA 5LXGH 4JG1H 3G6DH 2HFGH 1RZKH 3LN4B 5DFWH 4NO0A 3UYPA 5K9QG 1MFDL 4Y4KD 1XZ0B 3QZWG 5JOPD 5T33L 2YD4A 2M1KA 2Q3AA 4CU8A 3VG9C 1Q9KA 3Q6FA 3TO2B 1N2RA 4ZFZB 5AYUH 5ANME 2AEIT 4JO4H 1DEEB 4QLRA 2VABB 3I50H 3QFJA 1P5VA 3FN0L 1H0DB 3B2UC 5L0QC 4M7ZC 4OZFB 4HHAA 2Z8VC 5F9OH 3FAXA 1QBLH 3WXWL 4NBXB 1IQDA 4QXGL 1H3VA 4NQCD 1K8DB 4AM0A 4X4XB 4TSAH 1X5ZA 5F9OL 3REVA 1CXHA 4PJDE 2VDOH 2GITB 5BRZE 4F15B 2N7AA 1NMAH 2O5ZL 4F80A 1K5NB 3T8XA 3ILPA 3P9MB 2VXVH 4JRWA 2YN3A 5B38B 1EV2E 1XGTB 1CLOL 4PJHA 2M2DA 1ZAGA 4LPVA 8FABB 4M7LT 4GRWF 5IMOB 2YPKA 1JI1A 3UC0H 1RZ8A 4KKLC 9CGTA 3G6JA 4XHQA 4FQLL 1QFWI 4KK5C 5T3XL 3IJHB 4O9HL 2OI9C 3QQ9C 4G8IB 4G6FB 4DN4H 3U6RB 2IPKA 4I0KA 2DB8A 2B20A 2HAZA 5D2LA 1QYGH 3HN3A 3Q5YA 2GJZB 3OZ9L 2EC9T 5FYKU 1S7UB 4OGYL 4YXHL 3VXMA 4EI5B 1MHEB 1FNEB 3V5HA 3SCMD 4RQQA 3NPZB 3MRDA 3GFUA 4JGUA 1WZLA 5EZIH 1HSAB 2OZ4A 4FZEL 1BWMA 5BV7B 4M5YL 3ILPB 4KJYA 4OGXH 2BNRD 4MHHG 3ARDC 1MHHA 3VRJA 1CLCA 5CP3H 4HIJA 3KLDA 2GCYA 2DQDL 3EO1B 3RAJL 1SY6H 4MA3B 3WEXA 3P40A 4TVPE 4ZS6C 3U0PB 3S96B 1FFOA 3L3KB 5IT2H 1AKJA 2BSED 2D7NA 3VFNB 1U8MA 4KV5F 3VRLE 3U82B 3NA9H 3RVXD 1A64A 2JIXD 3MBXL 1BEYH 1JRHL 1M4KA 4XC3L 4CKVX 3WIHH 2OR8A 1KEML 1F6AA 2NY0C 3FFDA 2MHAA 5HHOE 1MCOL 1WIUA 4XWOD 3TGXA 5A2JH 1K4DB 3MLPA 1UKQA 1J05A 5HD8D 4R96B 3OR7B 2NTFA 4D9LH 4NM4L 2Y5TB 4J4PA 2C4XA 3LS4L 2VR5A 4HUUA 5E6YA 5FUZL 7FABH 5DHVB 4R96A 2NZ9C 1P4IH 2A83A 1R24A 4LSRL 3FFCB 5I2IB 1AO7E 1FL6B 4MB4A 3TYGH 2KZWA 2MOVA 4B53A 4U33A 4KJQC 2AW2A 5D93C 3Q0HA 2ENSA 1M71A 5GS0L 2XN9E 4RGNB 1EAPB 3LVEA 5EG6C 5DRWA 3WO4C 1MJ8L 4XXCA 4Z7VB 2J88H 3ARBC 3HC0A 4QWWC 2W60A 2X1WL 1BVZA 3I85A 4JZNB 4LEOB 4MXWL 5JHDE 1MJ8H 2XZCH 3MRIB 5GGRA 1J1PL 1NAKL 4NZUH 3RVUD 1NUDA 2R2HA 4OCYH 4JHAL 5HDQH 1S7XB 4YE4H 1TZIB 2DMBA 2PYEA 4XP5L 4K3EL 5E56A 4BK4A 4J3TA 4BFBD 4J3UA 3AU1A 3CNKA 4M7KL 3HE7A 5FYLH 3DRQA 3PDOA 4L4TB 4I3SH 3RVTC 5FGBA 5CEZE 4M7KH 1MRDL 5FYLL 5F72S 1GC1H 5EBGA 2FSEB 2FBJL 4WV1C 4HUVB 3ZKSD 4TUJA 5EU3A 4UBDC 4BQBA 1YC8A 4LGSB 4MGXA 1C5CH 3PWPD 2IPKB 5C6TH 3LSOA 3X13A 4EQ2A 2Q7YB 4FQQB 2DKSA 2E27L 1EUUA 4ETQA 1X7QB 1U93B 1EAPA 5CGTA 2VLRD 1G7IA 4LHQB 5GGVH 2GEEA 3BSZH 3IDNB 4BSVB 1ONQB 3SKOA 1MIEL 5GGVY 3RWFB 4A2MA 3U30B 5BCAA 4M7ZB 3C8DA 3BJ91 2IQ9H 4Q0XL 1KEGH 2BY2A 4FQXC 4LIQL 4YHYC 4G7YL 3NCCB 2VC2H 5JPMA 1CCZA 5L2KD 3VXME 4YR6B 1R5IB 1XGQB 2BP3A 1CBVH 4OQTL 1UJ3C 2O5XL 1FE8H 1Z2KA 2G9HA 4WO4B 4NUGL 2DQTH 1UCBL 2JK5B 5IV2A 3NCJH 1FSKB 3BO8A 4NHUA 4NN7C 3C5ZB 1I9JL 2HKFL 1RJLA 4G6KL 4Y4FC 4ZODA 3V7AE 4C83B 5FK9A 1FPTL 3HB3D 3TT1L 3ARSA 4NQVB 1N2RB 1Q0YH 5H37G 1OP5K 1J0ZA 3B4NA 5EPMA 8CGTA 4KDTC 1JP5A 3TT3L 2QHRL 4HIJB 1LO3H 4JQIL 2XWBA 1WIPA 3K2MC 3O6FB 3KYOA 4I13B 1Q0YL 4YDIH 1CG9A 1F3JB 4R7DA 1KGCD 3DYOA 2YWYA 3VXRA 4PUBH 3ARGC 5MEQA 4W70A 1N5AA 2R1YB 1PY4A 3V4VL 5I6XC 3UJIH 1LO2H 4BSVA 3EYQC 4HUMB 5I0DA 2NZIA 4LCYB 2XIDA 4FQXA 2PR4L 4NWTL 5GJSL 3WJJC 2DD8H 1JNNH 2X9WA 2Z4QA 1NFDF 1QLEL 1OTUD 1DFBL 1IGJA 3E3QE 4X0KB 5DFVD 4LU5H 2XQBH 4OFDA 3BUTA 3HNVL 3DXAB 1SYVB 3PDDA 5CMAB 4E0RA 6FABL 1EHNA 4PBVC 3WE6A 5MENA 5T3XH 5IHBA 1UM4L 3VWKD 2L7JA 2R0ZH 4PJIF 5IW6A 5JXEA 3P0YL 5C0DB 4Q9QH 4Y1AD 5E8EB 4PP2B 1X5AA 4UUJB 4LEXL 4H5SB 4OI9A 4EXPX 1CIDA 2VDLL 5IVZB 1MVUB 1UA6H 2R2BB 3TPKA 4F3FA 4N0RA 4PRDA 3QFJD 1YC7A 4HH9A 4C56D 2VLKD 2FZ3B 4P46A 4RIRA 4ERSL 2P48B 3W5MA 2VXTH 1AGFB 1ZGLM 3LOWA 1KNOB 3FTGB 1H0DA 3MSPA 4D8PA 3PUCA 3QWRD 5E9DD 1WWWX 2Z8WC 4F9PC 3C2SA 2CDFA 25C8L 1MI5E 2LV4A 4JRXB 5FCUL 4DWHA 2JJSA 4OZGE 5EIIB 5EU6D 4F7TB 3DV4A 5E8NA 4D9QD 3SO3C 2VUOA 3MA9H 4WU5A 5K9KA 4GG6F 2W65B 2AJVL 4GG6B 3MV8E 4OCXL 2YD1A 5FCUH 5J12C 2XACC 1E4XI 3NA4A 5E8EA 3MXVL 3OBAA 1HHJB 5L9DH 1CDHA 1UB6B 3RPIB 2JIXB 1P7QB 1ZS8A 2H8PA 1C5BH 3PABA 1LD9B 1OT1A 2NY4B 2E7HA 1HQRB 1AGEA 3B9KB 2EDWA 4RIRB 5D7SL 3NTCH 3WSQH 3E8UH 3U7WH 1F97A 1DTUA 5GRUL 3RGHA 3SE3A 3X17A 5TDNB 4RZCA 5ALBL 2ZUYA 1D5ZA 2YPLD 4X4MA 5DA0B 4MXQD 1TITA 2Y5EA 1MVUA 3ALWA 3KR3L 4OIBA 2BSRB 1OF2B 3L3HB 1J0KA 2GTZB 1KIPA 5GS1C 3H3PH 2A6JA 1U8HB 5TF1L 4OAWA 3G08B 3L9RB 4DOHB 1CU4L 3S37L 1FORH 3HZMB 5HI4D 5F1NA 3N1PC 3CD4A 5HYIA 1T83C 2DYPD 5EO0B 2JJTA 1CDUA 3ARFC 3HR6A 1YY8B 2P43B 1CXEA 2FL5B 5CMAA 5EORL 3MRNB 1JFQH 3RDTA 3G04A 4XWGH 3QDGE 4MNQD 3QCTL 2ADJB 2HT2C 4JG0L 3FB5A 1J1XH 3I6LE 4M48L 1KELL 1CLZL 3VXQA 5BQ7A 2EYTB 2NY4D 2QBWA 3FN9A 1T22A 3P0GB 4NPYB 5CJQL 2EDQA 3KPLB 1S78C 2JB6B 1JWUA 4L29A 3HPJB 4I1NB 4KDTA 4H20H 5E95B 5KTEH 3WNMA 1X5IA 3B3IB 3ULVH 5AD0B 4JKWA 1RPQA 4QT5B 1KF9B 3SHSA 3QJHB 4LMQE 1WVZA 1EEZB 4MLSA 2A9NL 3GKZA 2JELH 5KTEL 4H25B 1RZGB 2YEZA 4I0PD 4YBQD 2ZZUT 1U8QB 5GRXG 4HJGB 1T2QH 5FV2A 5F89B 4XNZB 3GSRB 5D6CB 5T1LA 2VJXA 4NQCA 2VXUL 3ALXA 3QUYA 1DDHB 3RWEA 5HVGB 3C5ZA 1T1YA 5J12B 4UILH 3PGDB 2R69H 1YYML 2XOTA 2YC1A 3F7VB 2FECI 3KJ6H 3FN0H 5B21A 5B22A 1S9WA 1PBYA 3ABZA 3WFCH 1JI2A 3PQYE 2F19H 3UXFA 1HSBA 3DURB 4BELD 2DKUA 3ECBB 3GJFK 3MOBL 2IAMB 4Q58C 3TBSB 2L7UA 3O4OC 3QH3A 4JPWH 1FAIL 3F7YA 2J2ZA 1I9JH 1XF4A 1S5IH 12E8L 2IGFH 4GUPB 5HYFA 2Z92B 1DSFH 2J3SA 3LKQA 5B3JF 2NW2A 1ORSA 4LAQL 3H9SD 1U36A 3QSKB 4I0CC 4NYLA 5J0BA 1MJJB 3JVGA 1KPRB 2B7DT 3IYLW 3MBEC 4IRSA 1UQSB 5DSCB 3MV9E 3QXTA 2AP2A 5EZLA 3TN0B 1ZV5A 3X13B 1DVFB 3UJJH 4NQCE 1QSEB 4KZEH 2BOBA 4KK5D 4QHLA 4OFPA 4WWKA 4AMKL 5ILTL 5I15H 5EUKB 4Y19B 4KI5F 3BH9A 2BZDA 4H1LH 1EAJA 2BSSB 4RGOL 1C7TA 4LSVH 5I15L 3GSOB 4QYOB 4PLNC 3JV6A 4TVSa 5EC2B 1IGCL 3BZDA 3CFEA 4F7MB 4EVNA 1SJHB 4RGOH 4YO0B 4PGBA 5IIEB 1JUFA 3GZKA 3EYUL 3WFZA 2DI9A 5CINH 3SDDD 5BZDB 3C08H 2AJSH 4OBRA 4RWHA 3UTTB 4JEGB 3OAZH 3IJSA 4PJEE 2Q87A 5IB2B 4WDIA 2NY1D 3JWDL 3MOAL 2NNAB 1JV5B 3LMJH 4ONFH 3X11B 2FYYA 3ZDYE 2HP4A 1MJUL 3FB7A 1T3FA 5E2UH 4LSUL 3MRRA 1EX0A 4O2FA 1QACA 1J8KA 3SQBA 5EUKA 4JFYA 5CIPH 3ZT5A 3MBXH 4OZGA 2ZUUA 1XAUA 4LSUH 4LSTH 4HLZH 4NKIH 4YZFE 5JORB 4S1DD 3O81A 5DMKA 4NCC1 1QRKA 2AGJL 4R97C 3W5NA 3OXRB 3WLWC 2YXMA 4P2QB 3WXVL 1A9BB 3UPRB 3GSXA 4N9GB 3ZTNL 4YDKH 1F90H 3L3JB 5IB3A 4LCUA 2EYRB 2Q8AH 3MLSH 4JPIB 3VD4A 5FO7A 5ELIA 2Z0BA 4JN1H 3ALPA 1NC2A 5J6HA 1D9KB 1RIUH 4HWBL 1FZJA 4IRZH 5H35B 3MLSL 5GS2H 1GGIL 2ICWI 5F7YC 5C71A 5SV4A 4X7CC 3VFRB 5K9OA 3UO1H 2VUYA 1ITCA 4HWBH 1BZ7A 2AEPH 3ZO0A 1EO8H 4LCWB 3MYZA 2BJML 4PG2C 4Z7UE 1FAKT 5C6WH 5CCKL 4POUB 2OL3B 3U36B 3FOMA 4OIAA 4JRYB 3OB0H 4KXZI 1UH2A 1AI1L 4UDUA 4APQA 5M94B 4F57H 3OG6B 1QNZH 3NTCL 4JHWH 1YY9C 4P48A 2QL1A 3HFML 1FNEA 3V5HB 4R3SB 1UJTA 2WIMA 4D0BB 4LVNC 4F57L 2K9UA 3CU1A 5IM7A 5E2TL 1WLHA 3QG7L 1Q9LA 4LCCA 2XWBB 1JPFB 1LQSR 1U9KA 2HVJA 4XB7A 5F9WB 1G7MA 3P9LA 3DTXB 3GRWL 4NZTH 3V5DB 3UBXG 1CU4H 4QOKA 2ZUTA 1CE1H 1C5DA 1EGJH 1KG0B 3IS1X 4CVXB 5BV7H 4IRJC 4PJCB 5J56B 4NC1C 5JR1H 2XWTB 3RL1B 2EDYA 1UCTA 5BV7C 1M1SA 4HS3A 4AJ0A 4NO3B 2F5AH 1RHHB 3TH2T 3TEUA 5D8JH 3WKML 3J8F7 3NPSC 1YEKL 2Z31D 3QUXD 5C07E 5C09A 3NAAH 3VI3E 4BH7B 1JPTH 2XZAH 5CJ8A 1BJ1J 4NO3A 2A38A 1KN2L 5JPMB 1F4XL 1IARB 5IFHL 3HI1A 5LXGL 1XH3A 3ME0A 4Q6IA 2I9TB 3BAEL 5DJZB 3H2WA 1MCKA 4ZXBA 2C1OA 3S9DB 2FIKA 2JELL 3CMOL 2R1XA 2QADD 5JW3H 1WFOA 5I1EL 4WGWB 4HIXL 4FG6C 4G6KH 5IK3A 3ZHKA 4XXDB 5H94A 5FEBA 4ZAKD 2IPUG 1OD9A 4NOFA 1S7SB 5I1LA 4PJ5A 5I75B 4K8RC 3ULVD 4NRYB 2WBJA 3GIZL 2NXYB 5ALCL 5GISH 1O0VA 3MV8D 1ZLUH 1RJYB 5AAWA 2VZTA 4PJXA 4NGHL 1J8HD 1X4ZA 4XNYH 5DT1H 5D70H 2BNQA 3O3BA 4MNQA 4YHZL 2EDXA 3PWNB 2ATKA 1JPST 4ISVA 3V79C 2PO6B 5JORA 3L5HA 5FUOL 1FL5A 3VFPB 1RD6A 3FL7A 5BS0E 1NLDH 4E5XB 3U9PL 1TDQA 2RCSL 3CIQA 5SX4H 3E2HC 5CS7A 2QEJA 1QTYT 4DKEL 3BMWA 3CSPA 1YDPB 3UJJL 3Q3GA 1VDGA 5BW7C 1U8PA 4KQ4H 4OUUA 4Z77A 4FQIH 1C8PA 2R0ZL 4PGEA 1KJ2H 2AJYL 1B0GA 1ZT7A 4JO3L 2OR9L 4MAUH 4JQXA 4XXDA 4P2RD 4M62L 3IDGB 3O3EA 5C9JB 4UDTB 4XNUL 4AIXA 1CICC 4MB3A 3CLFH 4C56A 3UTZA 3P0VL 1RIVH 4F15C 3RZCC 4P46B 3VWJC 1T5WA 3VH8B 4X9BA 3GHBH 4P4RB 3FT4B 3QUXA 3HUJB 2UVFA 4G8FA 4MA8H 4K2UL 5EULV 2X1OA 1J5OL 3FQWA 2VERN 1QFPA 4MA3A 3WEXB 5HYJE 4KY1H 1YMMD 5J57B 1MFAL 1YQVH 3P4OA 3NIGE 4TUKL 4ODSH 5FOBB 1R3LA 3BJLA 3ULUE 1TCRB 4Q2ZA 1E4KA 3D87B 1A9EB 2IANE 1RUAL 4PV8A 1X5GA 1F6AB 1YNKH 4GRWH 4PJ5B 3BP6A 5E6IC 4XCNB 3L3GB 3C8KB 3EYOB 3MJ9L 2XWTA 4MAYD 2MJWA 4PRHA 5C0RH 3E2HB 3WUWG 3EO9H 1NCDH 3RWGB 2X4UA 1EERB 4P57A 1KTDB 2R4RH 1LO4L 4QHLB 3MJ9H 3QIBA 1XGUA 5J6GB 2DJ4A 4LK4A 5FGCE 5J1AB 1ZHNA 5I66A 2EDBA 2J8UF 3OJVC 3LN5A 3L95B 2P5EB 2C3HA 3ARUA 2H1PL 4LLYB 4QGTA 1IEBB 3H3PL 3RL2B 1I1AA 3O11A 3MJ8A 4ZTPH 2DQCH 5D72H 3GIVB 4LKCB 2EH7H 3RX7A 3L5WA 3C6LB 3VCLB 1IM9D 4RA0C 4HGWA 3QDJE 4JZJC 5C0BA 1TTFA 3QCTH 2J6EH 4UIMB 5DUMH 4WHYG 3D0VA 2FO4B 1S7WB 2XWJB 2NY7L 4DK3A 1G0DA 3G6JB 1U3ZA 3B6SA 4OLZL 4YHKH 5I30L 2JK5A 1BX2B 3BPCB 1C08B 1S7WA 3BD5A 4D3CH 3QUZB 5C08B 2SEBA 1AH1A 1PKOA 4AEEA 4KFZC 4YHOL 1OGAD 4CADA 5FA4A 4UT6H 1U8IB 4D3CL 1JTPA 1HILB 5DR5H 3VXTB 3AREC 5FB8A 3NZ8B 2H3NB 1IVLA 2J8HA 1U6AL 5DO2C 4K07A 4Y16C 1KTLB 4ODTL 4WNQB 3VFWB 1IQDB 4XVSH 2ARJQ 1TCMA 3R1GL 5C7XL 4G7YH 3HMWH 4IHOA 4MAYC 5D2NB 4QOKD 3IGAA 4FQLH 5F6IB 2O93L 3H8NA 3QDJD 3N9GH 1I7ZB 3S36X 3QWRA 4RGNC 2ESVD 1CFNB 1C1EL 2YUWA 5HGGS 3NAAL 4LCWA 3O9WB 1KCRL 3ZDZF 1FE8L 1A5FL 1GIGH 5E03A 1MLCB 3MC0A 5DJ0B 4X7TA 3S97C 3WIFB 4LVHB 4OF7A 1HQ4A 2FEDD 2FX8L 4P57B 5CAYB 1WICA 1W2KT 2F19L 5DDHA 4NKDA 3ES6B 4OLUL 4E42A 3N1FC 1IFHH 3MLXH 3QAZB 1J9CT 4L4VE 2HRLA 5IW6B 4XTRD 4CN4A 2DLEA 4PJIA 3CPLB 3T04D 4HS8H 2EXYC 2AQ3A 1IC7L 2WBJC 1F42A 4I2XA 4XNXL 4HAFA 3RAJH 4DGYL 4NN6B 3E0GA 4OKVB 5I1AB 3GI9L 3K80A 4GKOA 5C0AA 1OOAA 4Y5VA 2EZ0C 1UADC 1FNSL 5CBAA 1IC4L 2IPUK 2AXFB 1TJIH 4R7NA 3T0DA 4OZGB 3NA9L 3S34L 5D6DC 3MGOA 1T80A 1W72L 2FD6L 5TE7L 4G7VL 2EDKA 3V4VH 3V6ZB 1EXUA 5JO5B 1Q1JL 2AI0H 4FP8L 4JFXA 2ARWA 2P24A 4U6TA 1G9MC 1OGAB 4HK3N 2QQNL 1MUJA 1GYAA 5B3JE 1NMCB 1T1ZB 1QLEH 3VWJB 1CR9H 2ZOKA 5EBLA 2ZUSA 1NCWH 5I74C 4OJFH 5HDBE 3RX8A 4I0PA 1VEMA 1TVHA 4LU5L 2FR4A 2NX5D 5HHMD 2AXHA 4OJFL 5JNYA 2DMCA 4F7TA 3BT2H 4KUCD 2IAMA 1K4DA 3BQUB 1IAIL 5DJ0A 2JLLA 3DV6A 3SPVB 1HXMB 3QEQB 4IM8A 1D5XB 4Q9QL 1XR9B 5KW9L 3WE6B 2BCKA 3DX9B 1G7LB 2IPTL 4WEMB 43CAA 2VDLH 4HBCH 3TO4C 1LE9B 1CT8A 1RZJL 1SEQH 4HKJB 1F58H 1MELA 3LH2H 4PJBA 3HMXH 2R0LH 4G80A 4B41A 3ISWA 1RZJH 2ZOLA 4JDVA 3SQOL 4U6YB 2HTLC 4YK4B 5FGRA 4JJ5B 1J0IA 1KPRA 2R0LL 2DIBA 2XG5A 1IQWL 4XCCH 5C70A 4QF1A 5MHSD 2QSVA 4QHNB 3T65A 5J9PB 3DJ9A 4KKCC 4Q6YA 3E3QC 3F7YB 1MRDH 1A7NH 1GAFH 5SWZE 2FH6A 5IVXB 3K8MA 5DRZA 1C5DB 1C5CL 2AJZA 5I75C 2AS5M 5C0IA 4AIOA 3REVB 2ZCKH 1FLRH 1KYOJ 2P45B 2WZPD 5IMMA 2ZP0T 3AM8A 2F74A 4RGND 3FN3A 2ADGA 5M95B 3FB5B 1MNUH 4CAGA 3FMGL 4OF6A 5E1AB 4HK0A 1DQLL 2HWZH 1Q72H 1RJLB 2VDKL 2Z9TA 2X2YA 1YJDL 3BZEB 3EYOA 4Y16D 3JV5A 3EO9L 1NCDL 1FYTE 5DEFB 4DAGL 1HXMA 5EO0A 3ZMRA 3HG1E 4QRPE 2J12B 2N1KA 1N6UA 1RZFL 5IEHB 4PIRF 3NIGF 2WIIB 1A9BA 4U2YA 3HI5L 2JCCF 4ZXBD 2DTMH 4P23A 3X14B 4JPVH 1I7TB 4KROB 1S7TA 3L5XL 2YR3A 2UUDH 4P23C 3L3OA 4HPYH 5CJXC 3WIIH 4PR5A 4NUJB 4ZAKA 3HC0B 3H9HA 5J4MA 3W82A 4LNRB 1A2YA 1Y0LA 5D72L 5CFHA 4IMLB 4PRHE 3RZWA 3QIUA 3QQ4A 3L3GA 1P84J 2PO6D 3U7YH 5KN5B 5DURD 5J6HB 2AJXH 4DQOH 5ACZA 5IG7A 3SGKA 2BVYA 1CF8H 4LSPL 2J8UE 3REWA 1KJMA 3ARBA 4OKVA 5I1AA 1CF8L 4LSPH 1TVDA 1OARH 1UACL 3STLB 3D39D 2VQ1A 3MQIA 1HHKA 1A6ZA 4YHLH 4WI5A 2CGRH 3U1SH 1YEHH 4P4RA 3RVWD 1ZLWH 3DMMC 4YX2H 3IKKA 3PG2A 4U1JA 3GBNH 5HGBB 5IQ9A 3T0EC 4HDIA 4C4KO 1PZUB 1MLCA 1EJOH 3JWDC 2BOBB 4TSCH 1DUYA 1WBXB 1Y18B 2VIRB 4FFZL 5D1QD 4M43L 4O9HH 4ESKA 4PJ5E 4O4YL 3MRGA 2YWZA 1RURH 4HDIB 4C56E 2EECA 1ETZB 1MFEL 4XP4H 1NKRA 1EA9C 3PWPA 3D5OF 3ZSTA 3ZYIA 5KZCD 4BA8A 2JJWA 3KDMB 2FGWL 4J8RB 3LPGA 2VWEE 4HH8A 5E8DH 4FXKA 1DN0B 4M6ML 4K55A 4RMVA 3DHMA 3GBML 3PWPB 1AGCB 3EYSL 2EEAA 3OB0K 2FX8H 2P8LB 5FB8B 4PJDA 5IROC 1S7QA 4J3WA 2P46B 1YNLH 4LFHG 4PJ9B 4Z5RB 4WRLA 1I8MB 1WAAF 4POZD 5DMKB 3EJZC 4MXVF 3KXFB 1AIFA 3AM8C 2DL2A 3TH3T 4OUOA 4ZPVB 3DLQR 2ATPB 3GMQB 4X6DF 5KSBF 3S36H 5HGBA 5IQ9B 1VGKB 4ISVB 4Z78B 5KJRL 5GS1A 1CICD 3SDDC 2G2RB 3NMEA 1YEFH 4OCRL 4DGYH 5E8OA 2IFFH 2X1QA 4HC1A 3WV0A 3ZT6A 4OD1L 1NMBL 4UV4H 4G8GA 2B4CL 4ZUTB 1KGCE 2EDHA 3BIKB 4IJ3C 1TNMA 2MCPL 3PV6A 1E4XL 4HQQL 4U1NA 1WEJL 3D9AH 3QUMH 5D7JB 2BY3A 5D96C 1WQVT 3LKSB 3TIEB 3UYOD 5HHNB 4KK9C 4P23B 4F33A 1CE6B 4GKSB 5DMIL 2QQLH 4LLYA 4EZMA 4WFHE 1WTGT 3LEXA 2R0WL 3EYUH 5J1SC 4XHJC 5DK0B 1R3KA 4HD9A 5IEKB 3QRGL 4L4VD 5T5FL 3ARDB 4TUOA 3L1OH 5FECB 3JWDH 1DBJL 4Y7MA 3V7AG 4AG4L 4GG8B 2GJ6D 5DJDA 5C2BL 2GJ6B 3P9LB 3EGSB 4S1SL 4MA8L 5INDB 3S35L 3CX5K 3MRNA 1MH5B 1JNLL 1OTSC 4A6YA 1EBAA 4HKZA 3VFTA 4KJYB 5IMOA 3ZE0E 5AZ2H 2UWEE 3C5JB 35C8L 4N0UA 4Z95L 3U4EA 1F58L 3VJ6A 4U1KA 2HT3C 4EDXB 3VFSB 5IKCA 3I3BA 1MH5A 4M6NL 2DJSA 4P4KD 4APQB 4PREA 3SQOH 3OGOE 3KPSB 1CD1B 4HJJH 2EO1A 3QP3A 3ZHLA 3C6LD 1AD9A 5MEND 1E28B 3DO7A 4UQ3B 2X6MA 3ZTNH 4GKZA 5DMGD 4OM1H 1GC1L 4C83A 1A7PL 2VXQH 4YNYA 4JDTH 4CL7A 5J13B 2VDNH 3CXHK 2V2XA 1ZA6B 3MPCA 4QEGA 4H26A 1OTTC 2VOTA 5ENWA 5FGSA 4R3SA 4YPJA 1CE6A 4GMTL 1SBSL 3HLAB 1MFBH 3OV6A 3G08A 4CRPA 3PWVA 2I9LB 3HZKA 2GTZA 1S7QB 4LPXA 3VDBA 1WCBB 3GMNB 3QHFL 3RWJB 4IBLT 2HWZL 5D1XC 2LVEA 3KLAA 4KGJA 4LSSH 1FP5A 2PN5A 3I50L 5D7IE 5T5NG 5K9JL 2CR3A 4NBYB 1BJMA 3ULUL 4AM0B 2VXUH 2HT2D