1T0AA

Crystal structure of 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase from shewanella oneidensis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
158
Chain Sequence
b'KIRIGHGFDVHKFGEPRPLILCGVEVPYETGLVAHSDGDVVLHAISDAILGAMALGDIGKHFPDTDAAYKGADSRVLLRHCYALAKAKGFELGNLDVTIIAQAPKMAPHIEDMRQVLAADLNADVADINVKATTTEKLGFTGRKEGIAVEAVVLLSRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
molecule tags Lyase
source organism Shewanella oneidensis
publication title Structure of 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase from Shewanella oneidensis at 1.6 A: identification of farnesyl pyrophosphate trapped in a hydrophobic cavity.
pubmed doi rcsb
total genus 46
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2004-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1t0aA00
3F0EA 1KNJA 3EORA 1U43A 2PMPA 3F0DA 3IEWA 3P10A 3IKEA 5B8FA 1IV4A 1U3PA 1T0AA 3ERNA 1JN1A 1VHAA 4C81A 3QHDA 3T80A 1JY8A 1IV2A 1GX1A 2UZHA 1H48A 4C8IA 3K14A 3ESJA 3FPIA 3IEQA 1W55A 3B6NA 3ELCA 4C8EA 3JVHA 1U3LA 1IV1A 3IKFA 3MBMA 1U40A 3F6MA 3KE1A 4C82A 1KNKA 3F0GA 1VH8A 2GZLA 3F0FA 1H47A 1IV3A 1YQNA 3K2XA 4C8GA 1W57A 3P0ZA 3FBAA 3Q8HA 2AMTA 3RE3A 3GHZA
chains in the Genus database with same CATH superfamily
3CMAF 1KNJA 3TD3A 3ZO8A 5HY0A 5DCVA 3RYFA 5J2UB 1GZ0A 3IMPA 5FLXM 5JVDA 4YJ3B 3SIVA 3BYQA 3S0WA 2QTPA 1W2BF 1U40A 3LWRC 1N8RH 4ERHA 2H8EA 3K12A 5AVMA 1TVKA 1IV3A 5FNVB 3CXCF 1SDSA 3C9UA 1FNKA 3I3FA 5JQGB 3IEWA 5FNVA 5GINC 2ZOVA 3S0HA 5HY1A 2PHNA 5EYPA 1X7OA 4ZI7A 5IYZA 4I55B 1YIJF 3DC2A 2N48A 3P4EA 5EZYA 3U0OA 3RYFB 5KX5A 3C9RA 2YXZA 3V3TA 3HKDB 2CSLA 1RQ2A 4RHAA 2AMTA 1KQSF 2GVIA 3CMEF 1U43A 2MQEA 5EO3A 5ITZA 3RYHB 5HY4A 1JY8A 3JAMM 5C8YA 3CYPB 1YJ9F 2Q1YA 4O2AB 2NMUA 1VQPF 1NMUB 3D00A 3LMEA 1J7HA 4R40B 5JH7A 5GANK 3CPWF 4LCKA 2KTVA 4G4WA 2R6R1 2RHLA 1VH8A 3HAXD 3C9SA 2OZBA 3OONA 3J7AR 1KC8H 3VMFB 5FJ4C 5B8FA 3WGLA 1UI9A 1W5FA 2UYNA 5C8YB 3T80A 1COMA 1UFYA 5JH7B 1X25A 1VQ4F 3TD4A 3S0YA 4PWTA 1XRGA 3JCMM 5GIOC 1W5EA 4BW0B 3ELCA 5LOVB 3E22B 3IKFA 1JFFB 3JAKA 3WJPA 1K73H 3CCMF 3RYIB 3CCJF 1SA0A 4X1YA 3RYHA 1E7KA 4O2BB 2I6DA 3VCZA 5ITZB 3M4SA 1H47A 2LBWA 3CB2A 2BTUA 3MQWA 4TV8B 5LYJA 2RHJA 4I4TB 3K0TA 4U3JB 4DRXB 3P10A 3IKEA 3CC2F 2ZVYA 3M1XA 4BVTA 3LFOA 2ZVZA 1RQ7A 2OHWA 3ON1A 4C81A 4WBNA 3N4YA 1FSZA 3V7QA 1W59A 2VGNA 4I50B 5GONA 3FPIA 4X20A 1K8AH 4I55A 3N2GB 5BMVA 4ZI7B 3F6MA 2IG8A 3MCQA 2QA4F 3WJRA 2Z1FA 1ODEA 1CN7A 1VQ7F 4BVQA 2KG4A 2FGYA 4IIJB 4ZHWA 3DDNA 1VQKF 1X7PA 2HP0A 2PMPA 3ZP4A 1TVKB 2HS0A 2ALEA 3HKEA 3N2KB 1GO1A 1QAHA 2UYJA 2OTLF 4WBNB 5EIBD 1VQ6F 3VI6A 1TUBB 1JJ2F 2ZODA 4EI7A 2HS3A 1W40A 4EI9A 3NVKE 4BT5A 3CPQA 5LA6B 2F9ZC 3VYSC 3WGNA 3MBMA 4TUYA 3G71F 2Q1XA 5J2UA 2V9YA 4O4HB 2GZLA 2LBXA 1Z5WA 3JATA 3K2XA 4YJ2B 2LCAA 4F6RB 1W57A 3VOAA 3L7QA 5LOVA 1QVGF 4ZHYB 1DT9A 4F6RA 1W3EX 4ZHVA 5CA1B 1IV4A 4NWOB 3QTYA 1VQ5F 4E6EA 3CCRF 3V7EA 3NK6A 2HP3A 3HJWC 5LXTB 2HQSC 2RHHA 5CA0A 3QUWA 3JASA 2IQQA 3CCQF 3WPWA 3ZOPA 3CCLF 2VAWA 2YYEA 2HP0B 3MDOA 5J2TB 5GIPC 3Q8HA 2Z1UA 3FD6A 4IIJA 3RE3A 4EB6B 3GHZA 4O4LA 4ZHQB 1VQNF 3C9TA 4O2AA 3LYBA 2OTMA 3CCUF 4BT4A 1T0AA 2K1SA 3CCEF 2BTOA 2VAMA 4G4YA 4G88A 2VAPA 1FNJA 3RYCA 1W5BA 3R0PA 3RA5A 3O85A 4ZOLA 2HRUA 5EWRA 3WGJA 3F0GA 1JD1A 2CVLA 1FFXA 2B33A 2L26A 3HKDA 3I7TA 3N4ZA 4O4IA 3WXMB 4BT3A 1YQNA 2AIZP 1Q81H 1VQ8F 1H7MA 4TV8A 4LNUA 5LYJB 2HS4A 3E20B 4BVSA 2P6YA 2I6RA 3CC7F 3WGMA 3HKCB 3KHNA 1JN1A 2BO1A 5EYPB 3NK7A 4B45A 3GYQA 1RLGA 2CW4A 3E22A 5MN5A 4XCQA 3V4DA 1H48A 5LP6A 4X3MA 3I55F 1S72F 5JCOA 2LBTA 4O4LB 1QU9A 3LWVC 5HP8A 2QEXF 2DYYA 3UT5A 4O4JB 5J2TA 5IJ9B 1RLUA 2H6LA 2KGWA 2RHOA 3D01A 4G4XA 1VQOF 3SIUA 4IHJA 2DT4A 3ZP7A 3GTZA 4BT7A 3G6EF 3ERNA 2W8BC 1PF5A 1VQ9F 3UT5B 3JARA 2UYKA 3OW2F 3PLAC 4NUTA 1IV1A 1VK3A 3VO8A 1QVFF 3JATB 3LDTA 4BT6A 3S03A 1OFUA 4TZZA 3HKCA 4B46A 4B5CA 1KD1H 3LWQC 5MN6A 1VQLF 2CHSA 3P0ZA 2CHTA 4NQ3A 3FD5A 5IT9M 1QD9A 3HTNA 1VQVA 4X1IB 1Q82H 1T0KB 2Z1EA 3CD6F 3QHDA 4RQOA 5GAPK 3NVIB 1IV2A 5EZYB 1YI2F 2AIFA 5LA6A 3ESJA 1W41A 3OBYA 3IEQA 1W581 3CG6A 3HKBB 5CB4A 4C4WC 3N2KA 1R1MA 3HKEB 2VXYA 1ZWZA 4HNAB 4ZK7A 3RA6A 1YGYA 3KJKA 3F0DA 3CYQA 4X20B 3WJQA 4I50A 3C8LA 1XHOA 4X1KB 3CCSF 5MN4A 3J80M 2ZF8A 3K14A 3IR9A 4G4ZA 5GONB 3J81M 4I4TA 4YJ3A 1XBIA 3B6NA 1YHQF 3JAWB 4TV9A 5JVDB 5EB0A 3E1YA 4DXDA 3S02A 4X1IA 1M1KH 4BT2A 3HWUA 1XV2A 3CC4F 3RYCB 2R751 2RB9A 3EORA 3G4SF 5G4UC 3AGKA 1SA0B 3RYIA 2UYNB 3JALA 4TUYB 1JFFA 3JAKB 3VIUA 2GLZA 3VOBA 2FC3A 2BTQB 1W55A 4IHJB 4B62A 4EB6A 3LWPC 3JARB 1TUBA 1GO0A 3KE1A 4C82A 1KNKA 5KMGA 5HWEA 3VTIC 1M90H 1PXWA 2WALA 3F0FA 2H8CA 1YJNF 3JASB 3LWOC 3MCAB 3FBAA 5LXTA 4G4VA 1IPAA 1U3PA 5LP6B 5IJ9A 4FFBA 4O4JA 1GX1A 4BY9D 2OTJF 1YJWF 2EWCA 2UZHA 3N2GA 1Q86H 4C8EA 4LNUB 3PAFA 2QI2A 4M8IA 3M84A 1Q7YH 2Z01A 2VGMA 4U3JA 1DBFA 4ZOLB 4DRXA 1K9MH 2G9IA 3JAWA 4TV9B 3FFMA 5EIBC 1X52A 4O4IB 4O2BA 1FFXB 5IYZB 3OBWA 4X1YB 5KX5B 1VHAA 1NQ3A 1Q8RA 4U39A 5G4VC 1W5AA 1NJIH 4X1KA 1CLIA 3VYUC 4C8IA 2JNBA 3TD5A 1OAPA 2CWJA 4KWEA 5JQGA 3JVHA 4EI8A 4FFBB 1ONIA 3KIZA 4HNAA 1CK2A 5HXUA 2HVYD 4ZHQA 2Z1TA 4BVRA 5HP7A 3CCVF 2CZWA 5BMVB 5LP6C 3F0EA 3HKBA 5CB4B 4X3LA 1Z5VA 2HX0A 3WPXA 5JCOC 2UYPA 3S06A 3WGKA 1RA4A 5A2QM 5KMGB 5CA0B 1W42A 1YITF 1VQMF 5HY2A 3NMUC 5EB1B 1U3LA 2HRYA 3JALB 2IAFA 3D54A 5EAZA 5IJ0B 4YJ2A 3I56F 2KTUA 5HXZA 3KJJA 2ZAUA 4O4HA 3VYTC 5CA1A 5IJ0A 4C8GA 1SZQA
chains in the Genus database with same CATH topology
3F0EA 1KNJA 3EORA 1U43A 2PMPA 3F0DA 3IEWA 3P10A 3IKEA 5B8FA 1IV4A 1U3PA 1T0AA 3ERNA 1JN1A 1VHAA 4C81A 3QHDA 3T80A 1JY8A 1IV2A 1GX1A 2UZHA 1H48A 4C8IA 3K14A 3ESJA 3FPIA 3IEQA 1W55A 3B6NA 3ELCA 4C8EA 3JVHA 1U3LA 1IV1A 3IKFA 3MBMA 1U40A 3F6MA 3KE1A 4C82A 1KNKA 3F0GA 1VH8A 2GZLA 3F0FA 1H47A 1IV3A 1YQNA 3K2XA 4C8GA 1W57A 3P0ZA 3FBAA 3Q8HA 2AMTA 3RE3A 3GHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0E A;  1KNJ A;  3EOR A;  1U43 A;  2PMP A;  3F0D A;  3IEW A;  3P10 A;  3IKE A;  5B8F A;  1IV4 A;  1U3P A;  1T0A A;  3ERN A;  1JN1 A;  1VHA A;  4C81 A;  3QHD A;  3T80 A;  1JY8 A;  1IV2 A;  1GX1 A;  2UZH A;  1H48 A;  4C8I A;  3K14 A;  3ESJ A;  3FPI A;  3IEQ A;  1W55 A;  3B6N A;  3ELC A;  4C8E A;  3JVH A;  1U3L A;  1IV1 A;  3IKF A;  3MBM A;  1U40 A;  3F6M A;  3KE1 A;  4C82 A;  1KNK A;  3F0G A;  1VH8 A;  2GZL A;  3F0F A;  1H47 A;  1IV3 A;  1YQN A;  3K2X A;  4C8G A;  1W57 A;  3P0Z A;  3FBA A;  3Q8H A;  2AMT A;  3RE3 A;  3GHZ A; 
#chains in the Genus database with same CATH topology
 3CMA F;  1KNJ A;  3TD3 A;  3ZO8 A;  5HY0 A;  5DCV A;  3RYF A;  5J2U B;  1GZ0 A;  3IMP A;  5FLX M;  5JVD A;  4YJ3 B;  3SIV A;  3BYQ A;  3S0W A;  2QTP A;  1W2B F;  1U40 A;  3LWR C;  1N8R H;  4ERH A;  2H8E A;  3K12 A;  5AVM A;  1TVK A;  1IV3 A;  5FNV B;  3CXC F;  1SDS A;  3C9U A;  1FNK A;  3I3F A;  5JQG B;  3IEW A;  5FNV A;  5GIN C;  2ZOV A;  3S0H A;  5HY1 A;  2PHN A;  5EYP A;  1X7O A;  4ZI7 A;  5IYZ A;  4I55 B;  1YIJ F;  3DC2 A;  2N48 A;  3P4E A;  5EZY A;  3U0O A;  3RYF B;  5KX5 A;  3C9R A;  2YXZ A;  3V3T A;  3HKD B;  2CSL A;  1RQ2 A;  4RHA A;  2AMT A;  1KQS F;  2GVI A;  3CME F;  1U43 A;  2MQE A;  5EO3 A;  5ITZ A;  3RYH B;  5HY4 A;  1JY8 A;  3JAM M;  5C8Y A;  3CYP B;  1YJ9 F;  2Q1Y A;  4O2A B;  2NMU A;  1VQP F;  1NMU B;  3D00 A;  3LME A;  1J7H A;  4R40 B;  5JH7 A;  5GAN K;  3CPW F;  4LCK A;  2KTV A;  4G4W A;  2R6R 1;  2RHL A;  1VH8 A;  3HAX D;  3C9S A;  2OZB A;  3OON A;  3J7A R;  1KC8 H;  3VMF B;  5FJ4 C;  5B8F A;  3WGL A;  1UI9 A;  1W5F A;  2UYN A;  5C8Y B;  3T80 A;  1COM A;  1UFY A;  5JH7 B;  1X25 A;  1VQ4 F;  3TD4 A;  3S0Y A;  4PWT A;  1XRG A;  3JCM M;  5GIO C;  1W5E A;  4BW0 B;  3ELC A;  5LOV B;  3E22 B;  3IKF A;  1JFF B;  3JAK A;  3WJP A;  1K73 H;  3CCM F;  3RYI B;  3CCJ F;  1SA0 A;  4X1Y A;  3RYH A;  1E7K A;  4O2B B;  2I6D A;  3VCZ A;  5ITZ B;  3M4S A;  1H47 A;  2LBW A;  3CB2 A;  2BTU A;  3MQW A;  4TV8 B;  5LYJ A;  2RHJ A;  4I4T B;  3K0T A;  4U3J B;  4DRX B;  3P10 A;  3IKE A;  3CC2 F;  2ZVY A;  3M1X A;  4BVT A;  3LFO A;  2ZVZ A;  1RQ7 A;  2OHW A;  3ON1 A;  4C81 A;  4WBN A;  3N4Y A;  1FSZ A;  3V7Q A;  1W59 A;  2VGN A;  4I50 B;  5GON A;  3FPI A;  4X20 A;  1K8A H;  4I55 A;  3N2G B;  5BMV A;  4ZI7 B;  3F6M A;  2IG8 A;  3MCQ A;  2QA4 F;  3WJR A;  2Z1F A;  1ODE A;  1CN7 A;  1VQ7 F;  4BVQ A;  2KG4 A;  2FGY A;  4IIJ B;  4ZHW A;  3DDN A;  1VQK F;  1X7P A;  2HP0 A;  2PMP A;  3ZP4 A;  1TVK B;  2HS0 A;  2ALE A;  3HKE A;  3N2K B;  1GO1 A;  1QAH A;  2UYJ A;  2OTL F;  4WBN B;  5EIB D;  1VQ6 F;  3VI6 A;  1TUB B;  1JJ2 F;  2ZOD A;  4EI7 A;  2HS3 A;  1W40 A;  4EI9 A;  3NVK E;  4BT5 A;  3CPQ A;  5LA6 B;  2F9Z C;  3VYS C;  3WGN A;  3MBM A;  4TUY A;  3G71 F;  2Q1X A;  5J2U A;  2V9Y A;  4O4H B;  2GZL A;  2LBX A;  1Z5W A;  3JAT A;  3K2X A;  4YJ2 B;  2LCA A;  4F6R B;  1W57 A;  3VOA A;  3L7Q A;  5LOV A;  1QVG F;  4ZHY B;  1DT9 A;  4F6R A;  1W3E X;  4ZHV A;  5CA1 B;  1IV4 A;  4NWO B;  3QTY A;  1VQ5 F;  4E6E A;  3CCR F;  3V7E A;  3NK6 A;  2HP3 A;  3HJW C;  5LXT B;  2HQS C;  2RHH A;  5CA0 A;  3QUW A;  3JAS A;  2IQQ A;  3CCQ F;  3WPW A;  3ZOP A;  3CCL F;  2VAW A;  2YYE A;  2HP0 B;  3MDO A;  5J2T B;  5GIP C;  3Q8H A;  2Z1U A;  3FD6 A;  4IIJ A;  3RE3 A;  4EB6 B;  3GHZ A;  4O4L A;  4ZHQ B;  1VQN F;  3C9T A;  4O2A A;  3LYB A;  2OTM A;  3CCU F;  4BT4 A;  1T0A A;  2K1S A;  3CCE F;  2BTO A;  2VAM A;  4G4Y A;  4G88 A;  2VAP A;  1FNJ A;  3RYC A;  1W5B A;  3R0P A;  3RA5 A;  3O85 A;  4ZOL A;  2HRU A;  5EWR A;  3WGJ A;  3F0G A;  1JD1 A;  2CVL A;  1FFX A;  2B33 A;  2L26 A;  3HKD A;  3I7T A;  3N4Z A;  4O4I A;  3WXM B;  4BT3 A;  1YQN A;  2AIZ P;  1Q81 H;  1VQ8 F;  1H7M A;  4TV8 A;  4LNU A;  5LYJ B;  2HS4 A;  3E20 B;  4BVS A;  2P6Y A;  2I6R A;  3CC7 F;  3WGM A;  3HKC B;  3KHN A;  1JN1 A;  2BO1 A;  5EYP B;  3NK7 A;  4B45 A;  3GYQ A;  1RLG A;  2CW4 A;  3E22 A;  5MN5 A;  4XCQ A;  3V4D A;  1H48 A;  5LP6 A;  4X3M A;  3I55 F;  1S72 F;  5JCO A;  2LBT A;  4O4L B;  1QU9 A;  3LWV C;  5HP8 A;  2QEX F;  2DYY A;  3UT5 A;  4O4J B;  5J2T A;  5IJ9 B;  1RLU A;  2H6L A;  2KGW A;  2RHO A;  3D01 A;  4G4X A;  1VQO F;  3SIU A;  4IHJ A;  2DT4 A;  3ZP7 A;  3GTZ A;  4BT7 A;  3G6E F;  3ERN A;  2W8B C;  1PF5 A;  1VQ9 F;  3UT5 B;  3JAR A;  2UYK A;  3OW2 F;  3PLA C;  4NUT A;  1IV1 A;  1VK3 A;  3VO8 A;  1QVF F;  3JAT B;  3LDT A;  4BT6 A;  3S03 A;  1OFU A;  4TZZ A;  3HKC A;  4B46 A;  4B5C A;  1KD1 H;  3LWQ C;  5MN6 A;  1VQL F;  2CHS A;  3P0Z A;  2CHT A;  4NQ3 A;  3FD5 A;  5IT9 M;  1QD9 A;  3HTN A;  1VQV A;  4X1I B;  1Q82 H;  1T0K B;  2Z1E A;  3CD6 F;  3QHD A;  4RQO A;  5GAP K;  3NVI B;  1IV2 A;  5EZY B;  1YI2 F;  2AIF A;  5LA6 A;  3ESJ A;  1W41 A;  3OBY A;  3IEQ A;  1W58 1;  3CG6 A;  3HKB B;  5CB4 A;  4C4W C;  3N2K A;  1R1M A;  3HKE B;  2VXY A;  1ZWZ A;  4HNA B;  4ZK7 A;  3RA6 A;  1YGY A;  3KJK A;  3F0D A;  3CYQ A;  4X20 B;  3WJQ A;  4I50 A;  3C8L A;  1XHO A;  4X1K B;  3CCS F;  5MN4 A;  3J80 M;  2ZF8 A;  3K14 A;  3IR9 A;  4G4Z A;  5GON B;  3J81 M;  4I4T A;  4YJ3 A;  1XBI A;  3B6N A;  1YHQ F;  3JAW B;  4TV9 A;  5JVD B;  5EB0 A;  3E1Y A;  4DXD A;  3S02 A;  4X1I A;  1M1K H;  4BT2 A;  3HWU A;  1XV2 A;  3CC4 F;  3RYC B;  2R75 1;  2RB9 A;  3EOR A;  3G4S F;  5G4U C;  3AGK A;  1SA0 B;  3RYI A;  2UYN B;  3JAL A;  4TUY B;  1JFF A;  3JAK B;  3VIU A;  2GLZ A;  3VOB A;  2FC3 A;  2BTQ B;  1W55 A;  4IHJ B;  4B62 A;  4EB6 A;  3LWP C;  3JAR B;  1TUB A;  1GO0 A;  3KE1 A;  4C82 A;  1KNK A;  5KMG A;  5HWE A;  3VTI C;  1M90 H;  1PXW A;  2WAL A;  3F0F A;  2H8C A;  1YJN F;  3JAS B;  3LWO C;  3MCA B;  3FBA A;  5LXT A;  4G4V A;  1IPA A;  1U3P A;  5LP6 B;  5IJ9 A;  4FFB A;  4O4J A;  1GX1 A;  4BY9 D;  2OTJ F;  1YJW F;  2EWC A;  2UZH A;  3N2G A;  1Q86 H;  4C8E A;  4LNU B;  3PAF A;  2QI2 A;  4M8I A;  3M84 A;  1Q7Y H;  2Z01 A;  2VGM A;  4U3J A;  1DBF A;  4ZOL B;  4DRX A;  1K9M H;  2G9I A;  3JAW A;  4TV9 B;  3FFM A;  5EIB C;  1X52 A;  4O4I B;  4O2B A;  1FFX B;  5IYZ B;  3OBW A;  4X1Y B;  5KX5 B;  1VHA A;  1NQ3 A;  1Q8R A;  4U39 A;  5G4V C;  1W5A A;  1NJI H;  4X1K A;  1CLI A;  3VYU C;  4C8I A;  2JNB A;  3TD5 A;  1OAP A;  2CWJ A;  4KWE A;  5JQG A;  3JVH A;  4EI8 A;  4FFB B;  1ONI A;  3KIZ A;  4HNA A;  1CK2 A;  5HXU A;  2HVY D;  4ZHQ A;  2Z1T A;  4BVR A;  5HP7 A;  3CCV F;  2CZW A;  5BMV B;  5LP6 C;  3F0E A;  3HKB A;  5CB4 B;  4X3L A;  1Z5V A;  2HX0 A;  3WPX A;  5JCO C;  2UYP A;  3S06 A;  3WGK A;  1RA4 A;  5A2Q M;  5KMG B;  5CA0 B;  1W42 A;  1YIT F;  1VQM F;  5HY2 A;  3NMU C;  5EB1 B;  1U3L A;  2HRY A;  3JAL B;  2IAF A;  3D54 A;  5EAZ A;  5IJ0 B;  4YJ2 A;  3I56 F;  2KTU A;  5HXZ A;  3KJJ A;  2ZAU A;  4O4H A;  3VYT C;  5CA1 A;  5IJ0 A;  4C8G A;  1SZQ A; 
#chains in the Genus database with same CATH homology
 3F0E A;  1KNJ A;  3EOR A;  1U43 A;  2PMP A;  3F0D A;  3IEW A;  3P10 A;  3IKE A;  5B8F A;  1IV4 A;  1U3P A;  1T0A A;  3ERN A;  1JN1 A;  1VHA A;  4C81 A;  3QHD A;  3T80 A;  1JY8 A;  1IV2 A;  1GX1 A;  2UZH A;  1H48 A;  4C8I A;  3K14 A;  3ESJ A;  3FPI A;  3IEQ A;  1W55 A;  3B6N A;  3ELC A;  4C8E A;  3JVH A;  1U3L A;  1IV1 A;  3IKF A;  3MBM A;  1U40 A;  3F6M A;  3KE1 A;  4C82 A;  1KNK A;  3F0G A;  1VH8 A;  2GZL A;  3F0F A;  1H47 A;  1IV3 A;  1YQN A;  3K2X A;  4C8G A;  1W57 A;  3P0Z A;  3FBA A;  3Q8H A;  2AMT A;  3RE3 A;  3GHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...