1T0AA

Crystal structure of 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase from shewanella oneidensis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
158
Chain Sequence
KIRIGHGFDVHKFGEPRPLILCGVEVPYETGLVAHSDGDVVLHAISDAILGAMALGDIGKHFPDTDAAYKGADSRVLLRHCYALAKAKGFELGNLDVTIIAQAPKMAPHIEDMRQVLAADLNADVADINVKATTTEKLGFTGRKEGIAVEAVVLLSRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Structure of 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase from Shewanella oneidensis at 1.6 A: identification of farnesyl pyrophosphate trapped in a hydrophobic cavity.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Lyase
total genus 46
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2004-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1t0aA00
2AMTA 1IV1A 4C8GA 4C8IA 1U40A 3RE3A 1VHAA 1VH8A 1H48A 3ELCA 1U3LA 3FBAA 1H47A 1IV3A 3IEWA 3B6NA 3P10A 3KE1A 1JN1A 1IV2A 1JY8A 3IEQA 3IKFA 5B8FA 3T80A 3EORA 1W55A 1KNKA 4C8EA 3F0FA 2UZHA 1W57A 3F6MA 1T0AA 3F0EA 3F0GA 1GX1A 2PMPA 1YQNA 3JVHA 3K14A 3MBMA 1U3PA 3Q8HA 3ESJA 2GZLA 3P0ZA 3FPIA 3K2XA 1KNJA 3ERNA 3IKEA 3QHDA 3GHZA 1IV4A 4C81A 3F0DA 1U43A 4C82A
chains in the Genus database with same CATH superfamily
3WPWA 4U3JB 3RYFB 1JJ2F 4R40B 3WJQA 4TV8A 4WBNB 2PHNA 3HKCA 2KG4A 1IV3A 3BYQA 4LCKA 1H7MA 4U39A 2RHHA 3ZOPA 5LA6A 5EYPA 3F6MA 3HKBA 5EWRA 3S0YA 5CA0A 4EI8A 1Q8RA 5IJ9B 1RLGA 4TV8B 4C81A 2DT4A 3HKCB 1XHOA 4X1YA 5FLXM 3HKDA 3JASA 5ITZA 2BTUA 4ZHQA 5LA6B 4BVTA 3VYSC 4RQOA 3NVIB 3HKEB 3VOAA 3HKBB 3LMEA 2KGWA 1Q7YH 5HWEA 3RYHB 2EWCA 4ZHWA 1ODEA 2Z1EA 2LCAA 3C9SA 2H8CA 2CSLA 4X1YB 4DRXA 3ESJA 3GTZA 1KNJA 3IMPA 3FD6A 3HKDB 3JASB 5ITZB 4ZHQB 1YI2F 2ZOVA 4O2AA 1W2BF 3CD6F 5DCVA 2R751 2IQQA 3GYQA 3RE3A 3N4ZA 1VHAA 1GZ0A 2L26A 2QTPA 5BMVA 1SZQA 1K9MH 1JY8A 1YGYA 3S0WA 1K8AH 5HXZA 3VTIC 2OTLF 4DRXB 4NQ3A 4X3LA 5FJ4C 2AIFA 3C9TA 3F0GA 2BO1A 5LP6C 2VXYA 4NUTA 5FNVA 3U0OA 1VQPF 3E22A 4RHAA 4BVRA 1VQ5F 4C8GA 3HJWC 3CB2A 5BMVB 3LWRC 2OZBA 1JFFB 3MDOA 1RQ2A 3KE1A 3C9RA 1VQOF 3WGJA 4G88A 2HVYD 4FFBA 1X52A 1YJ9F 1VQKF 2G9IA 4O4IA 3F0EA 1KC8H 4BT2A 3E22B 2Z1UA 4I55A 1YJNF 3P0ZA 4ZI7A 1CLIA 4G4ZA 1U43A 3SIVA 5GINC 4G4WA 1W3EX 1M90H 2ZF8A 1Z5VA 2RHJA 3UT5A 3CCLF 2ZVYA 4BT4A 5LXTA 3CC2F 3CCQF 3RYIA 4FFBB 5J2TA 1CK2A 4O4IB 3WJRA 4I55B 2OTJF 3FFMA 1W57A 4E6EA 3KIZA 3KJJA 2PMPA 3S06A 3JAKA 4I50A 3J81M 4BVQA 4YJ2B 2GLZA 2GZLA 4BW0B 3UT5B 3QHDA 4EI9A 1IV4A 4C82A 3JAWA 4IHJA 4XCQA 3RYIB 5G4VC 2UYPA 3CC7F 5J2TB 4IIJA 1W40A 5KX5A 4I4TA 3MQWA 2IAFA 2LBTA 1U3LA 1XBIA 2HS4A 5GANK 1SDSA 2ALEA 3E20B 4O2BA 4B46A 3G71F 4I50B 3VOBA 3CG6A 3OW2F 3CYPB 3WGLA 4EB6A 1YITF 1TVKA 2UYNA 4IHJB 1DBFA 1U3PA 3CC4F 4ZOLA 3DDNA 4IIJB 1QAHA 5KX5B 3WJPA 4ZK7A 5IYZA 5JCOC 5GIOC 1M1KH 2GVIA 1ONIA 2DYYA 4C8IA 3LWVC 1YHQF 3ELCA 3FBAA 4G4YA 2R6R1 3RA6A 5EYPB 3NK6A 1IV2A 4KWEA 2I6DA 2HS3A 4EB6B 1TVKB 2UYNB 4C4WC 5CA1A 3KHNA 4ZOLB 3LYBA 3NMUC 5CA0B 1Q81H 3O85A 5IYZB 4G4VA 1VQVA 1R1MA 1Z5WA 1QVFF 2Z1FA 4TUYA 3WGNA 3V7EA 1JD1A 3QTYA 2HP0A 3LWOC 3IR9A 2HQSC 1KD1H 1W42A 3V4DA 1VQLF 3C8LA 2QI2A 3VYUC 3VI6A 5CA1B 3I55F 3M84A 1GO0A 1NQ3A 3NK7A 3M1XA 3CCSF 3ZP7A 5HY1A 4TUYB 3OONA 3K0TA 1YQNA 3WXMB 4X1IA 4M8IA 3Q8HA 2LBXA 5HXUA 3FD5A 3M4SA 4O2AB 3JALA 3ERNA 3CMAF 1W5BA 5EIBC 1IV1A 2HX0A 1W5AA 3K12A 3CCRF 3D01A 5CB4A 2CWJA 3RA5A 5LYJA 2Z01A 3B6NA 3WGMA 3KJKA 4B45A 3C9UA 1RA4A 3CXCF 4X1IB 1W55A 4X1KA 3I56F 5FNVB 4BT3A 3JALB 1FFXA 2HS0A 3WGKA 2CW4A 4PWTA 1PF5A 2K1SA 3K2XA 1VQMF 3GHZA 1VQNF 1YJWF 5CB4B 2Z1TA 4EI7A 3J7AR 4O4HA 5IJ0A 3V7QA 1VH8A 2ZVZA 2QEXF 2CZWA 1H47A 4X1KB 3TD4A 2AIZP 2FC3A 2FGYA 5HP8A 1FFXB 2Q1XA 3CCJF 2VGMA 2VAPA 5JQGA 2BTOA 3SIUA 2Q1YA 2I6RA 3ZP4A 4ZI7B 5GIPC 1J7HA 1W41A 2KTUA 3IKEA 4O4HB 5IJ0B 5LXTB 3TD5A 5AVMA 2B33A 5LP6A 1U40A 1PXWA 3CMEF 4X3MA 1H48A 4U3JA 5JH7A 5JQGB 1QVGF 3TD3A 4O4LA 3P10A 2NMUA 2OTMA 3WPXA 3V3TA 1GO1A 3CCMF 3EORA 3JAKB 4ZHYB 3VO8A 2QA4F 3L7QA 3D00A 3DC2A 1W581 3PAFA 3VCZA 3JVHA 5EB1B 3JARA 2IG8A 2JNBA 1QU9A 3JAWB 1OAPA 5LP6B 3HAXD 1RLUA 3VIUA 2VAMA 1YIJF 4I4TB 1UFYA 4G4XA 5JH7B 5IJ9A 4O4LB 3OBYA 1ZWZA 3J80M 3RYCA 1CN7A 4O2BB 3IEWA 2UYJA 1JN1A 2CVLA 3P4EA 3HWUA 3MCQA 3JARB 2UZHA 3LWPC 2YXZA 3HKEA 1W59A 4DXDA 1TUBA 4B62A 3RYHA 2RHLA 3MBMA 4O4JA 1Q86H 5JVDA 1NMUB 2WALA 3N4YA 1QD9A 3RYCB 1OFUA 3CYQA 2RB9A 1S72F 3ON1A 4HNAA 1K73H 2AMTA 1X7PA 2RHOA 5EO3A 5HP7A 1VQ4F 2OHWA 3PLAC 3IKFA 1TUBB 2LBWA 4TZZA 2H8EA 4ERHA 4O4JB 5JVDB 2KTVA 4TV9A 1GX1A 1NJIH 5MN5A 2HP0B 4HNAB 1UI9A 2VAWA 3LDTA 1VQ6F 2BTQB 5C8YA 1Q82H 5KMGA 3S03A 3JCMM 3CCVF 4BT6A 4BVSA 1FSZA 1VK3A 3G6EF 2ZAUA 5JCOA 1XV2A 4TV9B 1E7KA 3N2KA 1JFFA 2VGNA 3T80A 1IPAA 5LOVA 3D54A 3VYTC 3F0FA 4LNUA 3LFOA 5C8YB 1RQ7A 3N2GA 1VQ8F 1W5FA 5EIBD 5KMGB 5MN4A 1KQSF 3R0PA 2CHTA 2HRYA 2P6YA 4B5CA 2HRUA 3CPQA 4BT7A 5LYJB 5MN6A 3I3FA 5GONA 1X25A 3N2KB 4ZHVA 5HY2A 5LOVB 3I7TA 3CCUF 5GAPK 4LNUB 3IEQA 2UYKA 5A2QM 3JATA 5B8FA 3N2GB 1VQ7F 3NVKE 1KNKA 4C8EA 2ZODA 2MQEA 5EB0A 4F6RA 2CHSA 4X20A 3AGKA 1SA0A 1FNKA 5EZYA 2N48A 5J2UA 1W5EA 5GONB 5HY4A 2H6LA 5EAZA 3CPWF 3QUWA 4YJ2A 3OBWA 1DT9A 2HP3A 5G4UC 1XRGA 3JATB 3MCAB 3S0HA 4YJ3A 3LWQC 2V9YA 4BT5A 3RYFA 1VQ9F 4F6RB 5IT9M 3ZO8A 4WBNA 4BY9D 4X20B 3E1YA 3VMFB 2F9ZC 1X7OA 1SA0B 5EZYB 2W8BC 5J2UB 3JAMM 1T0AA 1T0KB 3CCEF 5HY0A 3HTNA 4NWOB 3K14A 1N8RH 3G4SF 1COMA 3S02A 2YYEA 3FPIA 1FNJA 3F0DA 4YJ3B
chains in the Genus database with same CATH topology
2AMTA 1IV1A 4C8GA 4C8IA 1U40A 3RE3A 1VHAA 1VH8A 1H48A 3ELCA 1U3LA 3FBAA 1H47A 1IV3A 3IEWA 3B6NA 3P10A 3KE1A 1JN1A 1IV2A 1JY8A 3IEQA 3IKFA 5B8FA 3T80A 3EORA 1W55A 1KNKA 4C8EA 3F0FA 2UZHA 1W57A 3F6MA 1T0AA 3F0EA 3F0GA 1GX1A 2PMPA 1YQNA 3JVHA 3K14A 3MBMA 1U3PA 3Q8HA 3ESJA 2GZLA 3P0ZA 3FPIA 3K2XA 1KNJA 3ERNA 3IKEA 3QHDA 3GHZA 1IV4A 4C81A 3F0DA 1U43A 4C82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AMT A;  1IV1 A;  4C8G A;  4C8I A;  1U40 A;  3RE3 A;  1VHA A;  1VH8 A;  1H48 A;  3ELC A;  1U3L A;  3FBA A;  1H47 A;  1IV3 A;  3IEW A;  3B6N A;  3P10 A;  3KE1 A;  1JN1 A;  1IV2 A;  1JY8 A;  3IEQ A;  3IKF A;  5B8F A;  3T80 A;  3EOR A;  1W55 A;  1KNK A;  4C8E A;  3F0F A;  2UZH A;  1W57 A;  3F6M A;  1T0A A;  3F0E A;  3F0G A;  1GX1 A;  2PMP A;  1YQN A;  3JVH A;  3K14 A;  3MBM A;  1U3P A;  3Q8H A;  3ESJ A;  2GZL A;  3P0Z A;  3FPI A;  3K2X A;  1KNJ A;  3ERN A;  3IKE A;  3QHD A;  3GHZ A;  1IV4 A;  4C81 A;  3F0D A;  1U43 A;  4C82 A; 
#chains in the Genus database with same CATH topology
 3WPW A;  4U3J B;  3RYF B;  1JJ2 F;  4R40 B;  3WJQ A;  4TV8 A;  4WBN B;  2PHN A;  3HKC A;  2KG4 A;  1IV3 A;  3BYQ A;  4LCK A;  1H7M A;  4U39 A;  2RHH A;  3ZOP A;  5LA6 A;  5EYP A;  3F6M A;  3HKB A;  5EWR A;  3S0Y A;  5CA0 A;  4EI8 A;  1Q8R A;  5IJ9 B;  1RLG A;  4TV8 B;  4C81 A;  2DT4 A;  3HKC B;  1XHO A;  4X1Y A;  5FLX M;  3HKD A;  3JAS A;  5ITZ A;  2BTU A;  4ZHQ A;  5LA6 B;  4BVT A;  3VYS C;  4RQO A;  3NVI B;  3HKE B;  3VOA A;  3HKB B;  3LME A;  2KGW A;  1Q7Y H;  5HWE A;  3RYH B;  2EWC A;  4ZHW A;  1ODE A;  2Z1E A;  2LCA A;  3C9S A;  2H8C A;  2CSL A;  4X1Y B;  4DRX A;  3ESJ A;  3GTZ A;  1KNJ A;  3IMP A;  3FD6 A;  3HKD B;  3JAS B;  5ITZ B;  4ZHQ B;  1YI2 F;  2ZOV A;  4O2A A;  1W2B F;  3CD6 F;  5DCV A;  2R75 1;  2IQQ A;  3GYQ A;  3RE3 A;  3N4Z A;  1VHA A;  1GZ0 A;  2L26 A;  2QTP A;  5BMV A;  1SZQ A;  1K9M H;  1JY8 A;  1YGY A;  3S0W A;  1K8A H;  5HXZ A;  3VTI C;  2OTL F;  4DRX B;  4NQ3 A;  4X3L A;  5FJ4 C;  2AIF A;  3C9T A;  3F0G A;  2BO1 A;  5LP6 C;  2VXY A;  4NUT A;  5FNV A;  3U0O A;  1VQP F;  3E22 A;  4RHA A;  4BVR A;  1VQ5 F;  4C8G A;  3HJW C;  3CB2 A;  5BMV B;  3LWR C;  2OZB A;  1JFF B;  3MDO A;  1RQ2 A;  3KE1 A;  3C9R A;  1VQO F;  3WGJ A;  4G88 A;  2HVY D;  4FFB A;  1X52 A;  1YJ9 F;  1VQK F;  2G9I A;  4O4I A;  3F0E A;  1KC8 H;  4BT2 A;  3E22 B;  2Z1U A;  4I55 A;  1YJN F;  3P0Z A;  4ZI7 A;  1CLI A;  4G4Z A;  1U43 A;  3SIV A;  5GIN C;  4G4W A;  1W3E X;  1M90 H;  2ZF8 A;  1Z5V A;  2RHJ A;  3UT5 A;  3CCL F;  2ZVY A;  4BT4 A;  5LXT A;  3CC2 F;  3CCQ F;  3RYI A;  4FFB B;  5J2T A;  1CK2 A;  4O4I B;  3WJR A;  4I55 B;  2OTJ F;  3FFM A;  1W57 A;  4E6E A;  3KIZ A;  3KJJ A;  2PMP A;  3S06 A;  3JAK A;  4I50 A;  3J81 M;  4BVQ A;  4YJ2 B;  2GLZ A;  2GZL A;  4BW0 B;  3UT5 B;  3QHD A;  4EI9 A;  1IV4 A;  4C82 A;  3JAW A;  4IHJ A;  4XCQ A;  3RYI B;  5G4V C;  2UYP A;  3CC7 F;  5J2T B;  4IIJ A;  1W40 A;  5KX5 A;  4I4T A;  3MQW A;  2IAF A;  2LBT A;  1U3L A;  1XBI A;  2HS4 A;  5GAN K;  1SDS A;  2ALE A;  3E20 B;  4O2B A;  4B46 A;  3G71 F;  4I50 B;  3VOB A;  3CG6 A;  3OW2 F;  3CYP B;  3WGL A;  4EB6 A;  1YIT F;  1TVK A;  2UYN A;  4IHJ B;  1DBF A;  1U3P A;  3CC4 F;  4ZOL A;  3DDN A;  4IIJ B;  1QAH A;  5KX5 B;  3WJP A;  4ZK7 A;  5IYZ A;  5JCO C;  5GIO C;  1M1K H;  2GVI A;  1ONI A;  2DYY A;  4C8I A;  3LWV C;  1YHQ F;  3ELC A;  3FBA A;  4G4Y A;  2R6R 1;  3RA6 A;  5EYP B;  3NK6 A;  1IV2 A;  4KWE A;  2I6D A;  2HS3 A;  4EB6 B;  1TVK B;  2UYN B;  4C4W C;  5CA1 A;  3KHN A;  4ZOL B;  3LYB A;  3NMU C;  5CA0 B;  1Q81 H;  3O85 A;  5IYZ B;  4G4V A;  1VQV A;  1R1M A;  1Z5W A;  1QVF F;  2Z1F A;  4TUY A;  3WGN A;  3V7E A;  1JD1 A;  3QTY A;  2HP0 A;  3LWO C;  3IR9 A;  2HQS C;  1KD1 H;  1W42 A;  3V4D A;  1VQL F;  3C8L A;  2QI2 A;  3VYU C;  3VI6 A;  5CA1 B;  3I55 F;  3M84 A;  1GO0 A;  1NQ3 A;  3NK7 A;  3M1X A;  3CCS F;  3ZP7 A;  5HY1 A;  4TUY B;  3OON A;  3K0T A;  1YQN A;  3WXM B;  4X1I A;  4M8I A;  3Q8H A;  2LBX A;  5HXU A;  3FD5 A;  3M4S A;  4O2A B;  3JAL A;  3ERN A;  3CMA F;  1W5B A;  5EIB C;  1IV1 A;  2HX0 A;  1W5A A;  3K12 A;  3CCR F;  3D01 A;  5CB4 A;  2CWJ A;  3RA5 A;  5LYJ A;  2Z01 A;  3B6N A;  3WGM A;  3KJK A;  4B45 A;  3C9U A;  1RA4 A;  3CXC F;  4X1I B;  1W55 A;  4X1K A;  3I56 F;  5FNV B;  4BT3 A;  3JAL B;  1FFX A;  2HS0 A;  3WGK A;  2CW4 A;  4PWT A;  1PF5 A;  2K1S A;  3K2X A;  1VQM F;  3GHZ A;  1VQN F;  1YJW F;  5CB4 B;  2Z1T A;  4EI7 A;  3J7A R;  4O4H A;  5IJ0 A;  3V7Q A;  1VH8 A;  2ZVZ A;  2QEX F;  2CZW A;  1H47 A;  4X1K B;  3TD4 A;  2AIZ P;  2FC3 A;  2FGY A;  5HP8 A;  1FFX B;  2Q1X A;  3CCJ F;  2VGM A;  2VAP A;  5JQG A;  2BTO A;  3SIU A;  2Q1Y A;  2I6R A;  3ZP4 A;  4ZI7 B;  5GIP C;  1J7H A;  1W41 A;  2KTU A;  3IKE A;  4O4H B;  5IJ0 B;  5LXT B;  3TD5 A;  5AVM A;  2B33 A;  5LP6 A;  1U40 A;  1PXW A;  3CME F;  4X3M A;  1H48 A;  4U3J A;  5JH7 A;  5JQG B;  1QVG F;  3TD3 A;  4O4L A;  3P10 A;  2NMU A;  2OTM A;  3WPX A;  3V3T A;  1GO1 A;  3CCM F;  3EOR A;  3JAK B;  4ZHY B;  3VO8 A;  2QA4 F;  3L7Q A;  3D00 A;  3DC2 A;  1W58 1;  3PAF A;  3VCZ A;  3JVH A;  5EB1 B;  3JAR A;  2IG8 A;  2JNB A;  1QU9 A;  3JAW B;  1OAP A;  5LP6 B;  3HAX D;  1RLU A;  3VIU A;  2VAM A;  1YIJ F;  4I4T B;  1UFY A;  4G4X A;  5JH7 B;  5IJ9 A;  4O4L B;  3OBY A;  1ZWZ A;  3J80 M;  3RYC A;  1CN7 A;  4O2B B;  3IEW A;  2UYJ A;  1JN1 A;  2CVL A;  3P4E A;  3HWU A;  3MCQ A;  3JAR B;  2UZH A;  3LWP C;  2YXZ A;  3HKE A;  1W59 A;  4DXD A;  1TUB A;  4B62 A;  3RYH A;  2RHL A;  3MBM A;  4O4J A;  1Q86 H;  5JVD A;  1NMU B;  2WAL A;  3N4Y A;  1QD9 A;  3RYC B;  1OFU A;  3CYQ A;  2RB9 A;  1S72 F;  3ON1 A;  4HNA A;  1K73 H;  2AMT A;  1X7P A;  2RHO A;  5EO3 A;  5HP7 A;  1VQ4 F;  2OHW A;  3PLA C;  3IKF A;  1TUB B;  2LBW A;  4TZZ A;  2H8E A;  4ERH A;  4O4J B;  5JVD B;  2KTV A;  4TV9 A;  1GX1 A;  1NJI H;  5MN5 A;  2HP0 B;  4HNA B;  1UI9 A;  2VAW A;  3LDT A;  1VQ6 F;  2BTQ B;  5C8Y A;  1Q82 H;  5KMG A;  3S03 A;  3JCM M;  3CCV F;  4BT6 A;  4BVS A;  1FSZ A;  1VK3 A;  3G6E F;  2ZAU A;  5JCO A;  1XV2 A;  4TV9 B;  1E7K A;  3N2K A;  1JFF A;  2VGN A;  3T80 A;  1IPA A;  5LOV A;  3D54 A;  3VYT C;  3F0F A;  4LNU A;  3LFO A;  5C8Y B;  1RQ7 A;  3N2G A;  1VQ8 F;  1W5F A;  5EIB D;  5KMG B;  5MN4 A;  1KQS F;  3R0P A;  2CHT A;  2HRY A;  2P6Y A;  4B5C A;  2HRU A;  3CPQ A;  4BT7 A;  5LYJ B;  5MN6 A;  3I3F A;  5GON A;  1X25 A;  3N2K B;  4ZHV A;  5HY2 A;  5LOV B;  3I7T A;  3CCU F;  5GAP K;  4LNU B;  3IEQ A;  2UYK A;  5A2Q M;  3JAT A;  5B8F A;  3N2G B;  1VQ7 F;  3NVK E;  1KNK A;  4C8E A;  2ZOD A;  2MQE A;  5EB0 A;  4F6R A;  2CHS A;  4X20 A;  3AGK A;  1SA0 A;  1FNK A;  5EZY A;  2N48 A;  5J2U A;  1W5E A;  5GON B;  5HY4 A;  2H6L A;  5EAZ A;  3CPW F;  3QUW A;  4YJ2 A;  3OBW A;  1DT9 A;  2HP3 A;  5G4U C;  1XRG A;  3JAT B;  3MCA B;  3S0H A;  4YJ3 A;  3LWQ C;  2V9Y A;  4BT5 A;  3RYF A;  1VQ9 F;  4F6R B;  5IT9 M;  3ZO8 A;  4WBN A;  4BY9 D;  4X20 B;  3E1Y A;  3VMF B;  2F9Z C;  1X7O A;  1SA0 B;  5EZY B;  2W8B C;  5J2U B;  3JAM M;  1T0A A;  1T0K B;  3CCE F;  5HY0 A;  3HTN A;  4NWO B;  3K14 A;  1N8R H;  3G4S F;  1COM A;  3S02 A;  2YYE A;  3FPI A;  1FNJ A;  3F0D A;  4YJ3 B; 
#chains in the Genus database with same CATH homology
 2AMT A;  1IV1 A;  4C8G A;  4C8I A;  1U40 A;  3RE3 A;  1VHA A;  1VH8 A;  1H48 A;  3ELC A;  1U3L A;  3FBA A;  1H47 A;  1IV3 A;  3IEW A;  3B6N A;  3P10 A;  3KE1 A;  1JN1 A;  1IV2 A;  1JY8 A;  3IEQ A;  3IKF A;  5B8F A;  3T80 A;  3EOR A;  1W55 A;  1KNK A;  4C8E A;  3F0F A;  2UZH A;  1W57 A;  3F6M A;  1T0A A;  3F0E A;  3F0G A;  1GX1 A;  2PMP A;  1YQN A;  3JVH A;  3K14 A;  3MBM A;  1U3P A;  3Q8H A;  3ESJ A;  2GZL A;  3P0Z A;  3FPI A;  3K2X A;  1KNJ A;  3ERN A;  3IKE A;  3QHD A;  3GHZ A;  1IV4 A;  4C81 A;  3F0D A;  1U43 A;  4C82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...