1T0AA

Crystal structure of 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase from shewanella oneidensis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
158
Chain Sequence
KIRIGHGFDVHKFGEPRPLILCGVEVPYETGLVAHSDGDVVLHAISDAILGAMALGDIGKHFPDTDAAYKGADSRVLLRHCYALAKAKGFELGNLDVTIIAQAPKMAPHIEDMRQVLAADLNADVADINVKATTTEKLGFTGRKEGIAVEAVVLLSRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Structure of 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase from Shewanella oneidensis at 1.6 A: identification of farnesyl pyrophosphate trapped in a hydrophobic cavity.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Lyase
total genus 46
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2004-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1t0aA00
3KE1A 4C81A 3EORA 1GX1A 3P0ZA 2GZLA 3FPIA 1U3PA 3IKEA 3P10A 1H48A 3GHZA 3IEWA 1KNKA 1IV1A 3IKFA 1VH8A 3RE3A 2UZHA 3QHDA 3F6MA 3JVHA 4C8EA 3IEQA 1IV4A 3F0DA 3T80A 5B8FA 3ERNA 1JN1A 2PMPA 3B6NA 1KNJA 3ELCA 1W57A 3MBMA 1U43A 1W55A 2AMTA 1JY8A 3F0EA 1YQNA 1U40A 4C8GA 1IV3A 1IV2A 1T0AA 1VHAA 3ESJA 1H47A 1U3LA 3Q8HA 3K14A 3F0FA 3FBAA 4C82A 3K2XA 4C8IA 3F0GA
chains in the Genus database with same CATH superfamily
3G6EF 5HP7A 3IMPA 3L7QA 4FFBB 3EORA 4BW0B 3FPIA 2HRYA 1OAPA 5EZYB 3GHZA 1YITF 1QU9A 1W581 5DCVA 3TD5A 3O85A 5G4UC 1RA4A 5LXTA 2UZHA 3D54A 1VQOF 5IJ0A 4U39A 1XBIA 4LCKA 3GTZA 3M4SA 3JALA 5LP6A 2HVYD 4R40B 4BVRA 1JD1A 3M84A 1W2BF 3LWRC 4IIJA 1VQKF 2V9YA 4G4YA 2UYNA 1VQ9F 2PHNA 3OBWA 2I6DA 2YXZA 3V4DA 2G9IA 1W3EX 2GVIA 3JAWB 4G4WA 1VQ8F 2QI2A 4EB6B 3LWOC 5EYPA 4WBNA 3D01A 3C9SA 2RHJA 3E1YA 1Q7YH 4YJ2B 3CCEF 4ERHA 3LYBA 4C8EA 3FD6A 3WPWA 5C8YA 3ERNA 3NVIB 3KIZA 3CMEF 4I50B 3N2GB 1NQ3A 5FNVB 4EB6A 4O2AA 3DC2A 2H8CA 3KHNA 2I6RA 4ZHYB 4O4JA 3HKCB 4F6RA 4I4TB 5CB4A 4B62A 2RB9A 1YIJF 4EI9A 5GAPK 3CB2A 4X1IA 1K8AH 5J2TB 3CCLF 4X1YA 3VIUA 1X7PA 4IHJB 3WGMA 4I50A 1KD1H 3U0OA 5KX5A 1VQMF 4X3MA 3N4YA 5LOVA 3HAXD 2LCAA 1IV2A 5IT9M 3OBYA 2N48A 3CCQF 4HNAB 4X1KB 1RQ2A 3QUWA 1X52A 4YJ3A 2HRUA 3RA6A 4ZOLA 3CCRF 2Z1TA 3CG6A 2HS3A 5EO3A 2JNBA 5GONB 3RE3A 2OTJF 2VAMA 1QD9A 5JCOC 1VQLF 2LBTA 3T80A 1FSZA 3CCMF 3OW2F 2QEXF 5IJ9B 3WJPA 2OZBA 4DRXA 4X1KA 4C4WC 4O4IB 1YQNA 3ZP4A 5FJ4C 1VQVA 3KJJA 3K14A 3MCQA 3CD6F 3RYFB 2YYEA 5LYJA 3C9TA 2QTPA 4G4XA 3P0ZA 3RYIB 3JATA 3IEWA 5MN6A 3I3FA 2P6YA 3VYTC 2HS0A 4LNUA 3LDTA 3S0WA 4O4IA 3LWVC 2LBXA 3B6NA 2HX0A 3J80M 5MN4A 1KNJA 4G88A 1W57A 5IYZA 3LMEA 3S03A 3HKDB 1U40A 3RYIA 1XV2A 3FBAA 1SDSA 3WGLA 3V7QA 3PLAC 3OONA 4U3JA 4C8IA 3RYCA 3JARB 5ITZA 2GZLA 2EWCA 1H48A 1X7OA 2HS4A 3TD4A 5EIBD 3IKFA 3CC7F 3QHDA 3F6MA 5CA1B 5JQGA 3CCUF 1KQSF 3IEQA 4NQ3A 3WJRA 4XCQA 1JFFA 1OFUA 1SA0B 1X25A 2KG4A 2NMUA 1PF5A 3ELCA 5BMVB 5KMGA 3HJWC 1JY8A 2Z1UA 4C8GA 4E6EA 5GANK 1Q82H 4FFBA 2BTUA 4ZHQB 5HWEA 5EZYA 1YJNF 1W41A 4TV9B 4O4LB 2WALA 2AIZP 1DT9A 2CVLA 3S0YA 1Q8RA 5GINC 1T0KB 3NK7A 1E7KA 4ZK7A 2VAWA 2FGYA 2K1SA 2QA4F 3E22B 3K12A 1CK2A 4KWEA 3M1XA 1TVKB 2OHWA 2HQSC 4TV8B 2Z01A 4BT3A 4TUYB 2AMTA 3WXMB 4BVSA 3CCJF 3HKEB 4BVQA 1H47A 3JAWA 5GIOC 3F0FA 1K73H 2IAFA 1QVGF 2RHLA 3CYPB 4YJ2A 1GX1A 3IR9A 4BVTA 1KNKA 3C9RA 5J2UB 3VOBA 4O4HB 1VQ5F 2CWJA 1Q81H 3HWUA 4G4ZA 2ZAUA 3QTYA 5LA6B 3CYQA 3N2GA 3N2KB 3J7AR 1JN1A 1Z5WA 1QAHA 5FNVA 1ODEA 3JAKB 2LBWA 3F0EA 4B5CA 4BT6A 3ZOPA 4PWTA 3HKCA 4I4TA 3WGNA 3K0TA 5JVDB 4C81A 5J2TA 5MN5A 4IHJA 5HXZA 5AVMA 2RHHA 2BTOA 2B33A 1VH8A 1VQNF 1FNJA 2HP0B 4BT5A 3SIUA 5HP8A 4BY9D 2UYJA 3V7EA 5EAZA 1M1KH 1W55A 4HNAA 1Q86H 1VHAA 2Z1FA 2MQEA 2CHSA 3G71F 5JH7B 2BO1A 2HP3A 3IKEA 1SZQA 1U3PA 3P10A 5GONA 5A2QM 1YI2F 1KC8H 4X20B 3UT5B 5HY1A 3RYHB 3WJQA 3S02A 1XHOA 3JVHA 4ZI7B 5IJ9A 2F9ZC 2CZWA 3WGKA 3TD3A 1GZ0A 5EB1B 4EI7A 5HY0A 3I56F 4X3LA 3CPQA 2GLZA 3BYQA 1QVFF 3RYFA 2H6LA 3JASB 4B45A 2CSLA 5HXUA 1R1MA 3VMFB 1NMUB 3CMAF 3R0PA 1YJ9F 1JJ2F 3UT5A 3WGJA 2ZF8A 3HKBB 1W40A 3RYHA 4BT7A 4DXDA 1FFXB 4I55B 2BTQB 5LP6C 3P4EA 1VQ7F 3V3TA 2ALEA 2UYPA 2VGNA 3HKDA 5LXTB 5EIBC 3WPXA 5IJ0B 1ZWZA 3SIVA 3CC4F 1W5EA 3JARA 2W8BC 3Q8HA 4G4VA 1VK3A 3LFOA 2KGWA 2OTMA 4IIJB 3VO8A 2RHOA 5CA1A 3RA5A 2UYNB 3JCMM 2Q1XA 1W42A 5G4VC 1ONIA 4NWOB 1SA0A 5CA0B 5EYPB 4WBNB 5BMVA 3NK6A 1CLIA 5HY4A 2L26A 3I7TA 1W5FA 1PXWA 2DT4A 4ZHQA 5GIPC 1N8RH 2CHTA 3LWPC 4TV9A 5C8YB 4O4LA 1IV3A 3MCAB 3ESJA 4C82A 3PAFA 3NMUC 3S0HA 3CPWF 4M8IA 4ZHWA 3KE1A 3MDOA 2IG8A 3N4ZA 5CA0A 4O2AB 4NUTA 3E22A 3VOAA 1RLGA 4O4JB 1TVKA 1H7MA 2VXYA 4TV8A 3KJKA 4F6RB 5CB4B 2ZVZA 1IV4A 2CW4A 4TUYA 3CCVF 4X1IB 4X1YB 3CXCF 3HKEA 5FLXM 5KX5B 1VQPF 3CC2F 4BT2A 2OTLF 5LOVB 3K2XA 5J2UA 2Q1YA 4O4HA 4ZHVA 1S72F 3D00A 3HTNA 5LA6A 2KTUA 3N2KA 1YGYA 2FC3A 3GYQA 4YJ3B 3FD5A 3VYSC 3CCSF 1VQ6F 4RQOA 2IQQA 4RHAA 1UFYA 1W59A 3JAKA 4ZOLB 5B8FA 1CN7A 2H8EA 1VQ4F 2VGMA 1RLUA 1FNKA 5JVDA 1RQ7A 4TZZA 1YJWF 2ZODA 4DRXB 3F0GA 5EWRA 3JAMM 3FFMA 1NJIH 3G4SF 1UI9A 3S06A 1TUBB 2HP0A 3LWQC 5LYJB 3ON1A 3VYUC 1IV1A 4O2BB 1COMA 3JATB 3DDNA 3VCZA 2DYYA 3F0DA 3I55F 2ZOVA 3AGKA 3MQWA 1W5AA 4LNUB 2UYKA 3C9UA 3MBMA 1W5BA 3C8LA 5JH7A 1U43A 4EI8A 1GO0A 5JCOA 1J7HA 1M90H 1T0AA 1TUBA 3ZP7A 1K9MH 1U3LA 5IYZB 4X20A 4O2BA 2AIFA 3VTIC 2Z1EA 2KTVA 1YHQF 4ZI7A 3E20B 4U3JB 3RYCB 5ITZB 2R751 3ZO8A 2R6R1 4BT4A 1GO1A 1XRGA 3NVKE 1IPAA 2VAPA 3JASA 4B46A 1DBFA 5HY2A 2PMPA 2ZVYA 5JQGB 3VI6A 3HKBA 1JFFB 1FFXA 1Z5VA 3JALB 5EB0A 3J81M 4I55A 5LP6B 5KMGB
chains in the Genus database with same CATH topology
3KE1A 4C81A 3EORA 1GX1A 3P0ZA 2GZLA 3FPIA 1U3PA 3IKEA 3P10A 1H48A 3GHZA 3IEWA 1KNKA 1IV1A 3IKFA 1VH8A 3RE3A 2UZHA 3QHDA 3F6MA 3JVHA 4C8EA 3IEQA 1IV4A 3F0DA 3T80A 5B8FA 3ERNA 1JN1A 2PMPA 3B6NA 1KNJA 3ELCA 1W57A 3MBMA 1U43A 1W55A 2AMTA 1JY8A 3F0EA 1YQNA 1U40A 4C8GA 1IV3A 1IV2A 1T0AA 1VHAA 3ESJA 1H47A 1U3LA 3Q8HA 3K14A 3F0FA 3FBAA 4C82A 3K2XA 4C8IA 3F0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KE1 A;  4C81 A;  3EOR A;  1GX1 A;  3P0Z A;  2GZL A;  3FPI A;  1U3P A;  3IKE A;  3P10 A;  1H48 A;  3GHZ A;  3IEW A;  1KNK A;  1IV1 A;  3IKF A;  1VH8 A;  3RE3 A;  2UZH A;  3QHD A;  3F6M A;  3JVH A;  4C8E A;  3IEQ A;  1IV4 A;  3F0D A;  3T80 A;  5B8F A;  3ERN A;  1JN1 A;  2PMP A;  3B6N A;  1KNJ A;  3ELC A;  1W57 A;  3MBM A;  1U43 A;  1W55 A;  2AMT A;  1JY8 A;  3F0E A;  1YQN A;  1U40 A;  4C8G A;  1IV3 A;  1IV2 A;  1T0A A;  1VHA A;  3ESJ A;  1H47 A;  1U3L A;  3Q8H A;  3K14 A;  3F0F A;  3FBA A;  4C82 A;  3K2X A;  4C8I A;  3F0G A; 
#chains in the Genus database with same CATH topology
 3G6E F;  5HP7 A;  3IMP A;  3L7Q A;  4FFB B;  3EOR A;  4BW0 B;  3FPI A;  2HRY A;  1OAP A;  5EZY B;  3GHZ A;  1YIT F;  1QU9 A;  1W58 1;  5DCV A;  3TD5 A;  3O85 A;  5G4U C;  1RA4 A;  5LXT A;  2UZH A;  3D54 A;  1VQO F;  5IJ0 A;  4U39 A;  1XBI A;  4LCK A;  3GTZ A;  3M4S A;  3JAL A;  5LP6 A;  2HVY D;  4R40 B;  4BVR A;  1JD1 A;  3M84 A;  1W2B F;  3LWR C;  4IIJ A;  1VQK F;  2V9Y A;  4G4Y A;  2UYN A;  1VQ9 F;  2PHN A;  3OBW A;  2I6D A;  2YXZ A;  3V4D A;  2G9I A;  1W3E X;  2GVI A;  3JAW B;  4G4W A;  1VQ8 F;  2QI2 A;  4EB6 B;  3LWO C;  5EYP A;  4WBN A;  3D01 A;  3C9S A;  2RHJ A;  3E1Y A;  1Q7Y H;  4YJ2 B;  3CCE F;  4ERH A;  3LYB A;  4C8E A;  3FD6 A;  3WPW A;  5C8Y A;  3ERN A;  3NVI B;  3KIZ A;  3CME F;  4I50 B;  3N2G B;  1NQ3 A;  5FNV B;  4EB6 A;  4O2A A;  3DC2 A;  2H8C A;  3KHN A;  2I6R A;  4ZHY B;  4O4J A;  3HKC B;  4F6R A;  4I4T B;  5CB4 A;  4B62 A;  2RB9 A;  1YIJ F;  4EI9 A;  5GAP K;  3CB2 A;  4X1I A;  1K8A H;  5J2T B;  3CCL F;  4X1Y A;  3VIU A;  1X7P A;  4IHJ B;  3WGM A;  4I50 A;  1KD1 H;  3U0O A;  5KX5 A;  1VQM F;  4X3M A;  3N4Y A;  5LOV A;  3HAX D;  2LCA A;  1IV2 A;  5IT9 M;  3OBY A;  2N48 A;  3CCQ F;  4HNA B;  4X1K B;  1RQ2 A;  3QUW A;  1X52 A;  4YJ3 A;  2HRU A;  3RA6 A;  4ZOL A;  3CCR F;  2Z1T A;  3CG6 A;  2HS3 A;  5EO3 A;  2JNB A;  5GON B;  3RE3 A;  2OTJ F;  2VAM A;  1QD9 A;  5JCO C;  1VQL F;  2LBT A;  3T80 A;  1FSZ A;  3CCM F;  3OW2 F;  2QEX F;  5IJ9 B;  3WJP A;  2OZB A;  4DRX A;  4X1K A;  4C4W C;  4O4I B;  1YQN A;  3ZP4 A;  5FJ4 C;  1VQV A;  3KJJ A;  3K14 A;  3MCQ A;  3CD6 F;  3RYF B;  2YYE A;  5LYJ A;  3C9T A;  2QTP A;  4G4X A;  3P0Z A;  3RYI B;  3JAT A;  3IEW A;  5MN6 A;  3I3F A;  2P6Y A;  3VYT C;  2HS0 A;  4LNU A;  3LDT A;  3S0W A;  4O4I A;  3LWV C;  2LBX A;  3B6N A;  2HX0 A;  3J80 M;  5MN4 A;  1KNJ A;  4G88 A;  1W57 A;  5IYZ A;  3LME A;  3S03 A;  3HKD B;  1U40 A;  3RYI A;  1XV2 A;  3FBA A;  1SDS A;  3WGL A;  3V7Q A;  3PLA C;  3OON A;  4U3J A;  4C8I A;  3RYC A;  3JAR B;  5ITZ A;  2GZL A;  2EWC A;  1H48 A;  1X7O A;  2HS4 A;  3TD4 A;  5EIB D;  3IKF A;  3CC7 F;  3QHD A;  3F6M A;  5CA1 B;  5JQG A;  3CCU F;  1KQS F;  3IEQ A;  4NQ3 A;  3WJR A;  4XCQ A;  1JFF A;  1OFU A;  1SA0 B;  1X25 A;  2KG4 A;  2NMU A;  1PF5 A;  3ELC A;  5BMV B;  5KMG A;  3HJW C;  1JY8 A;  2Z1U A;  4C8G A;  4E6E A;  5GAN K;  1Q82 H;  4FFB A;  2BTU A;  4ZHQ B;  5HWE A;  5EZY A;  1YJN F;  1W41 A;  4TV9 B;  4O4L B;  2WAL A;  2AIZ P;  1DT9 A;  2CVL A;  3S0Y A;  1Q8R A;  5GIN C;  1T0K B;  3NK7 A;  1E7K A;  4ZK7 A;  2VAW A;  2FGY A;  2K1S A;  2QA4 F;  3E22 B;  3K12 A;  1CK2 A;  4KWE A;  3M1X A;  1TVK B;  2OHW A;  2HQS C;  4TV8 B;  2Z01 A;  4BT3 A;  4TUY B;  2AMT A;  3WXM B;  4BVS A;  3CCJ F;  3HKE B;  4BVQ A;  1H47 A;  3JAW A;  5GIO C;  3F0F A;  1K73 H;  2IAF A;  1QVG F;  2RHL A;  3CYP B;  4YJ2 A;  1GX1 A;  3IR9 A;  4BVT A;  1KNK A;  3C9R A;  5J2U B;  3VOB A;  4O4H B;  1VQ5 F;  2CWJ A;  1Q81 H;  3HWU A;  4G4Z A;  2ZAU A;  3QTY A;  5LA6 B;  3CYQ A;  3N2G A;  3N2K B;  3J7A R;  1JN1 A;  1Z5W A;  1QAH A;  5FNV A;  1ODE A;  3JAK B;  2LBW A;  3F0E A;  4B5C A;  4BT6 A;  3ZOP A;  4PWT A;  3HKC A;  4I4T A;  3WGN A;  3K0T A;  5JVD B;  4C81 A;  5J2T A;  5MN5 A;  4IHJ A;  5HXZ A;  5AVM A;  2RHH A;  2BTO A;  2B33 A;  1VH8 A;  1VQN F;  1FNJ A;  2HP0 B;  4BT5 A;  3SIU A;  5HP8 A;  4BY9 D;  2UYJ A;  3V7E A;  5EAZ A;  1M1K H;  1W55 A;  4HNA A;  1Q86 H;  1VHA A;  2Z1F A;  2MQE A;  2CHS A;  3G71 F;  5JH7 B;  2BO1 A;  2HP3 A;  3IKE A;  1SZQ A;  1U3P A;  3P10 A;  5GON A;  5A2Q M;  1YI2 F;  1KC8 H;  4X20 B;  3UT5 B;  5HY1 A;  3RYH B;  3WJQ A;  3S02 A;  1XHO A;  3JVH A;  4ZI7 B;  5IJ9 A;  2F9Z C;  2CZW A;  3WGK A;  3TD3 A;  1GZ0 A;  5EB1 B;  4EI7 A;  5HY0 A;  3I56 F;  4X3L A;  3CPQ A;  2GLZ A;  3BYQ A;  1QVF F;  3RYF A;  2H6L A;  3JAS B;  4B45 A;  2CSL A;  5HXU A;  1R1M A;  3VMF B;  1NMU B;  3CMA F;  3R0P A;  1YJ9 F;  1JJ2 F;  3UT5 A;  3WGJ A;  2ZF8 A;  3HKB B;  1W40 A;  3RYH A;  4BT7 A;  4DXD A;  1FFX B;  4I55 B;  2BTQ B;  5LP6 C;  3P4E A;  1VQ7 F;  3V3T A;  2ALE A;  2UYP A;  2VGN A;  3HKD A;  5LXT B;  5EIB C;  3WPX A;  5IJ0 B;  1ZWZ A;  3SIV A;  3CC4 F;  1W5E A;  3JAR A;  2W8B C;  3Q8H A;  4G4V A;  1VK3 A;  3LFO A;  2KGW A;  2OTM A;  4IIJ B;  3VO8 A;  2RHO A;  5CA1 A;  3RA5 A;  2UYN B;  3JCM M;  2Q1X A;  1W42 A;  5G4V C;  1ONI A;  4NWO B;  1SA0 A;  5CA0 B;  5EYP B;  4WBN B;  5BMV A;  3NK6 A;  1CLI A;  5HY4 A;  2L26 A;  3I7T A;  1W5F A;  1PXW A;  2DT4 A;  4ZHQ A;  5GIP C;  1N8R H;  2CHT A;  3LWP C;  4TV9 A;  5C8Y B;  4O4L A;  1IV3 A;  3MCA B;  3ESJ A;  4C82 A;  3PAF A;  3NMU C;  3S0H A;  3CPW F;  4M8I A;  4ZHW A;  3KE1 A;  3MDO A;  2IG8 A;  3N4Z A;  5CA0 A;  4O2A B;  4NUT A;  3E22 A;  3VOA A;  1RLG A;  4O4J B;  1TVK A;  1H7M A;  2VXY A;  4TV8 A;  3KJK A;  4F6R B;  5CB4 B;  2ZVZ A;  1IV4 A;  2CW4 A;  4TUY A;  3CCV F;  4X1I B;  4X1Y B;  3CXC F;  3HKE A;  5FLX M;  5KX5 B;  1VQP F;  3CC2 F;  4BT2 A;  2OTL F;  5LOV B;  3K2X A;  5J2U A;  2Q1Y A;  4O4H A;  4ZHV A;  1S72 F;  3D00 A;  3HTN A;  5LA6 A;  2KTU A;  3N2K A;  1YGY A;  2FC3 A;  3GYQ A;  4YJ3 B;  3FD5 A;  3VYS C;  3CCS F;  1VQ6 F;  4RQO A;  2IQQ A;  4RHA A;  1UFY A;  1W59 A;  3JAK A;  4ZOL B;  5B8F A;  1CN7 A;  2H8E A;  1VQ4 F;  2VGM A;  1RLU A;  1FNK A;  5JVD A;  1RQ7 A;  4TZZ A;  1YJW F;  2ZOD A;  4DRX B;  3F0G A;  5EWR A;  3JAM M;  3FFM A;  1NJI H;  3G4S F;  1UI9 A;  3S06 A;  1TUB B;  2HP0 A;  3LWQ C;  5LYJ B;  3ON1 A;  3VYU C;  1IV1 A;  4O2B B;  1COM A;  3JAT B;  3DDN A;  3VCZ A;  2DYY A;  3F0D A;  3I55 F;  2ZOV A;  3AGK A;  3MQW A;  1W5A A;  4LNU B;  2UYK A;  3C9U A;  3MBM A;  1W5B A;  3C8L A;  5JH7 A;  1U43 A;  4EI8 A;  1GO0 A;  5JCO A;  1J7H A;  1M90 H;  1T0A A;  1TUB A;  3ZP7 A;  1K9M H;  1U3L A;  5IYZ B;  4X20 A;  4O2B A;  2AIF A;  3VTI C;  2Z1E A;  2KTV A;  1YHQ F;  4ZI7 A;  3E20 B;  4U3J B;  3RYC B;  5ITZ B;  2R75 1;  3ZO8 A;  2R6R 1;  4BT4 A;  1GO1 A;  1XRG A;  3NVK E;  1IPA A;  2VAP A;  3JAS A;  4B46 A;  1DBF A;  5HY2 A;  2PMP A;  2ZVY A;  5JQG B;  3VI6 A;  3HKB A;  1JFF B;  1FFX A;  1Z5V A;  3JAL B;  5EB0 A;  3J81 M;  4I55 A;  5LP6 B;  5KMG B; 
#chains in the Genus database with same CATH homology
 3KE1 A;  4C81 A;  3EOR A;  1GX1 A;  3P0Z A;  2GZL A;  3FPI A;  1U3P A;  3IKE A;  3P10 A;  1H48 A;  3GHZ A;  3IEW A;  1KNK A;  1IV1 A;  3IKF A;  1VH8 A;  3RE3 A;  2UZH A;  3QHD A;  3F6M A;  3JVH A;  4C8E A;  3IEQ A;  1IV4 A;  3F0D A;  3T80 A;  5B8F A;  3ERN A;  1JN1 A;  2PMP A;  3B6N A;  1KNJ A;  3ELC A;  1W57 A;  3MBM A;  1U43 A;  1W55 A;  2AMT A;  1JY8 A;  3F0E A;  1YQN A;  1U40 A;  4C8G A;  1IV3 A;  1IV2 A;  1T0A A;  1VHA A;  3ESJ A;  1H47 A;  1U3L A;  3Q8H A;  3K14 A;  3F0F A;  3FBA A;  4C82 A;  3K2X A;  4C8I A;  3F0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...