1T0AA

Crystal structure of 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase from shewanella oneidensis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
158
Chain Sequence
KIRIGHGFDVHKFGEPRPLILCGVEVPYETGLVAHSDGDVVLHAISDAILGAMALGDIGKHFPDTDAAYKGADSRVLLRHCYALAKAKGFELGNLDVTIIAQAPKMAPHIEDMRQVLAADLNADVADINVKATTTEKLGFTGRKEGIAVEAVVLLSRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase from Shewanella oneidensis at 1.6 A: identification of farnesyl pyrophosphate trapped in a hydrophobic cavity.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Lyase
molecule keywords 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 46
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2004-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1t0aA00
3JVHA 3IKEA 3ERNA 1YQNA 2PMPA 2GZLA 2UZHA 3EORA 3ELCA 3IKFA 3K14A 3IEQA 3GHZA 1IV1A 3F0FA 3K2XA 1W55A 1IV3A 1IV2A 4C8EA 3IEWA 1VHAA 1W57A 3F6MA 3QHDA 4C81A 4C82A 3MBMA 3P0ZA 1U40A 3KE1A 3P10A 1U3LA 3B6NA 1T0AA 1KNJA 2AMTA 3ESJA 1IV4A 1VH8A 3F0DA 3FPIA 3F0GA 4C8IA 3FBAA 3RE3A 1JN1A 1GX1A 4C8GA 1U43A 1H48A 3T80A 5B8FA 1JY8A 1KNKA 3F0EA 1U3PA 3Q8HA 1H47A
chains in the Genus database with same CATH superfamily
1Z5WA 3HKCA 3JATA 5LYJA 2QTPA 4EB6B 3VI6A 3EORA 4DRXB 1Q8RA 1JJ2F 2ZOVA 3IEQA 4LCKA 3N2GA 5HP8A 1R1MA 3R0PA 3I7TA 5IJ9B 5HP7A 4O2BA 4O4HA 1VQLF 3JASB 3C9SA 3LWRC 4WBNB 2OTMA 1UI9A 3SIVA 4BVTA 1T0AA 2EWCA 3QTYA 5HXZA 3KIZA 2V9YA 5FNVA 3VOBA 1OFUA 3RYCA 3RA5A 3FFMA 5LXTA 1H7MA 1QAHA 1RA4A 4O2BB 1NQ3A 4BT3A 3CC2F 2I6DA 2CSLA 3CG6A 1FFXB 2GZLA 2VAWA 3U0OA 2OHWA 5A2QM 5KMGA 1J7HA 2KTUA 1W41A 5EB0A 2QEXF 4LNUB 4TUYA 1CK2A 5JCOC 3G4SF 3CCSF 3JARB 2VAMA 3RYHA 3S0HA 4EI7A 3HKCB 3VOAA 3VIUA 1RLUA 2CW4A 5HXUA 1IV4A 4IIJB 2OZBA 1YIJF 5GIPC 1COMA 3CYPB 1U43A 2FGYA 1K73H 3IMPA 1JY8A 3F0EA 4TV9B 1YITF 3OBYA 3VYSC 4NQ3A 3S0WA 1SA0B 3RYIA 3VYTC 1VQ4F 1RLGA 2BTOA 3GHZA 5J2UB 4DXDA 1IV1A 3ZP4A 5ITZA 5BMVA 3KHNA 5JVDB 4BVRA 4LNUA 4TUYB 1SDSA 3PLAC 1ODEA 2UYNB 3B6NA 3CCMF 1VQ6F 3F0DA 3J81M 1KC8H 5JCOA 1FSZA 3LWQC 4X1KB 2AIFA 4C4WC 2Z1TA 4O4LB 2F9ZC 2UZHA 3K14A 2CZWA 1XV2A 1QU9A 2DYYA 2KG4A 3MCQA 3K2XA 3RYCB 3C8LA 1JFFA 3S06A 3E22A 1X25A 2JNBA 4WBNA 3N4ZA 3LWOC 3CD6F 1X52A 4NWOB 4O4HB 4ZI7A 5EB1B 2Z1EA 3JAMM 2LBXA 4EB6A 4ERHA 1GX1A 4M8IA 3WXMB 3QUWA 5EYPB 3O85A 5IYZB 1W2BF 4U3JB 3MCAB 3SIUA 3NMUC 3ELCA 4EI8A 4O2AA 3OBWA 4TV8A 3I55F 1TUBA 3ZP7A 3HKEA 2YYEA 3KJKA 4G88A 3WPXA 1VK3A 2Z1FA 3VO8A 3MDOA 4X3LA 1XBIA 4O4JB 3WPWA 3D01A 1W5AA 3CB2A 4I50A 3DDNA 3LDTA 1RQ7A 1NJIH 5AVMA 4I55B 1U3PA 4IHJB 4B62A 1JN1A 1NMUB 4YJ3B 3VTIC 1DT9A 2Q1YA 4YJ2A 3CC7F 2ZVZA 4RQOA 4BT5A 2HP3A 1YQNA 4G4VA 1XHOA 1QVFF 3OONA 2ZAUA 5LP6A 1IV2A 4ZOLA 2HS3A 1YHQF 2KTVA 4FFBB 4I50B 2PHNA 3WJQA 3CXCF 1M1KH 2H6LA 4PWTA 1IPAA 2YXZA 3E1YA 3HTNA 5GONA 5CB4B 3F0GA 2HX0A 5CA0B 5G4VC 1GO0A 4RHAA 2UYPA 1X7PA 2LBTA 1VQMF 4BT2A 5EYPA 4ZOLB 1GZ0A 1PXWA 5EZYB 1VQ5F 4E6EA 1W55A 5KMGB 1VQNF 4BVSA 3JAWB 4YJ2B 3QHDA 4F6RA 3P10A 3FD6A 3M1XA 3LMEA 1FNJA 3FD5A 3DC2A 4C8IA 5J2TB 5J2TA 2IQQA 5GIOC 2H8CA 5MN4A 2UYJA 5HY0A 3ON1A 3WGNA 5FJ4C 3WJPA 1W42A 3WGMA 4O4IA 2LBWA 3LYBA 4ZHVA 1S72F 3S03A 3K0TA 4U3JA 3CCQF 2OTJF 1K9MH 4X20A 5JH7A 2VAPA 4C81A 3UT5A 3C9RA 2RHJA 3ESJA 3FPIA 4R40B 1XRGA 3HKDA 2OTLF 3NVKE 2RHOA 2DT4A 2ZVYA 3M84A 4B46A 2CHTA 1YGYA 2QA4F 3S02A 2BO1A 2IAFA 5KX5A 1W5EA 5JQGB 3ERNA 3LFOA 1VQ7F 1W581 2W8BC 3C9UA 2G9IA 1QVGF 4TZZA 4HNAB 1W40A 3C9TA 3CCJF 3N2KB 3RYHB 1VQ9F 2HRUA 2CVLA 1U3LA 2FC3A 3TD3A 3VCZA 2AMTA 5EAZA 1JD1A 2HP0A 3RE3A 2ALEA 2B33A 3V4DA 1H48A 3N2KA 3WGLA 1X7OA 5JVDA 1FFXA 1H47A 2BTUA 3JVHA 3G6EF 2ZODA 3RA6A 2R6R1 4IHJA 4I55A 1PF5A 5EWRA 3CPQA 5LXTB 3AGKA 4O4JA 1KQSF 3IEWA 5LOVA 5KX5B 3E20B 3MBMA 3JALA 4TV8B 2HS4A 1QD9A 5LA6B 3CYQA 1FNKA 3N2GB 3HKBA 1K8AH 4DRXA 4ZHYB 3VYUC 2QI2A 3JATB 5LYJB 3CCRF 5C8YA 2K1SA 2HVYD 5LA6A 1KD1H 3M4SA 3S0YA 1YJ9F 5EO3A 2R751 4O4IB 3VMFB 4ZHWA 4XCQA 1IV3A 3D00A 2BTQB 4X1YB 2RHLA 3V7QA 3JALB 1W59A 5MN5A 1Z5VA 2Z1UA 3IR9A 2NMUA 4B5CA 5EIBC 1W5FA 5FNVB 2UYKA 5LOVB 3CMEF 1UFYA 1YJWF 2L26A 5IJ0B 2VXYA 3JAWA 2I6RA 5MN6A 5HY1A 3CCLF 5G4UC 5EZYA 3L7QA 1M90H 1OAPA 3JAKB 2Q1XA 4ZK7A 3I56F 4NUTA 4G4ZA 3RYFA 1W57A 5BMVB 1VQPF 4B45A 4I4TA 2AIZP 5HY2A 1N8RH 4BT7A 3LWPC 3RYIB 3GYQA 1TVKB 3G71F 3CCEF 1ONIA 5JQGA 2VGMA 5B8FA 5CB4A 2PMPA 3IKEA 4EI9A 5CA1A 4I4TB 1YJNF 3V3TA 2CWJA 3N4YA 4IIJA 1YI2F 2Z01A 2GLZA 2IG8A 3F0FA 4C8EA 3HWUA 3V7EA 4U39A 3JARA 5JH7B 3TD5A 2KGWA 4G4YA 5DCVA 3UT5B 3P0ZA 3P4EA 1Q7YH 4X20B 3OW2F 5IJ0A 1CN7A 3CCVF 2HS0A 4X1IB 3BYQA 4BW0B 4C8GA 4ZHQA 5HWEA 3WGJA 3MQWA 1CLIA 1KNKA 1VQVA 4BT4A 3HJWC 5EIBD 4G4WA 3HKEB 3IKFA 1Q86H 1SZQA 1E7KA 2P6YA 1VQKF 4X1YA 3J80M 4X1IA 3CPWF 1ZWZA 4F6RB 3JASA 3F6MA 3NK7A 5IJ9A 4C82A 4KWEA 5IYZA 3JCMM 1GO1A 5C8YB 1W3EX 3NVIB 2LCAA 3CMAF 3CCUF 3HAXD 3PAFA 3HKBB 4BVQA 4ZI7B 3T80A 5CA1B 3CC4F 1JFFB 2VGNA 1RQ2A 5FLXM 3E22B 3WGKA 1TVKA 2H8EA 1VQOF 4O4LA 5CA0A 1VHAA 1T0KB 5GONB 2WALA 2RB9A 4G4XA 2HQSC 4BT6A 5IT9M 5LP6B 4ZHQB 3TD4A 5GAPK 4FFBA 4BY9D 3LWVC 1KNJA 3RYFB 1Q81H 3GTZA 4X1KA 5HY4A 2UYNA 3JAKA 1W5BA 2HP0B 2HRYA 1VQ8F 3J7AR 3ZO8A 3Q8HA 4YJ3A 5ITZB 5GINC 3K12A 2RHHA 3I3FA 5J2UA 4HNAA 2GVIA 4X3MA 2CHSA 1SA0A 4TV9A 3KJJA 5LP6C 3ZOPA 1U40A 3KE1A 5GANK 4O2AB 1VH8A 2MQEA 1DBFA 1TUBB 3FBAA 1Q82H 3WJRA 3HKDB 2N48A 3NK6A 3D54A 2ZF8A
chains in the Genus database with same CATH topology
3JVHA 3IKEA 3ERNA 1YQNA 2PMPA 2GZLA 2UZHA 3EORA 3ELCA 3IKFA 3K14A 3IEQA 3GHZA 1IV1A 3F0FA 3K2XA 1W55A 1IV3A 1IV2A 4C8EA 3IEWA 1VHAA 1W57A 3F6MA 3QHDA 4C81A 4C82A 3MBMA 3P0ZA 1U40A 3KE1A 3P10A 1U3LA 3B6NA 1T0AA 1KNJA 2AMTA 3ESJA 1IV4A 1VH8A 3F0DA 3FPIA 3F0GA 4C8IA 3FBAA 3RE3A 1JN1A 1GX1A 4C8GA 1U43A 1H48A 3T80A 5B8FA 1JY8A 1KNKA 3F0EA 1U3PA 3Q8HA 1H47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JVH A;  3IKE A;  3ERN A;  1YQN A;  2PMP A;  2GZL A;  2UZH A;  3EOR A;  3ELC A;  3IKF A;  3K14 A;  3IEQ A;  3GHZ A;  1IV1 A;  3F0F A;  3K2X A;  1W55 A;  1IV3 A;  1IV2 A;  4C8E A;  3IEW A;  1VHA A;  1W57 A;  3F6M A;  3QHD A;  4C81 A;  4C82 A;  3MBM A;  3P0Z A;  1U40 A;  3KE1 A;  3P10 A;  1U3L A;  3B6N A;  1T0A A;  1KNJ A;  2AMT A;  3ESJ A;  1IV4 A;  1VH8 A;  3F0D A;  3FPI A;  3F0G A;  4C8I A;  3FBA A;  3RE3 A;  1JN1 A;  1GX1 A;  4C8G A;  1U43 A;  1H48 A;  3T80 A;  5B8F A;  1JY8 A;  1KNK A;  3F0E A;  1U3P A;  3Q8H A;  1H47 A; 
#chains in the Genus database with same CATH topology
 1Z5W A;  3HKC A;  3JAT A;  5LYJ A;  2QTP A;  4EB6 B;  3VI6 A;  3EOR A;  4DRX B;  1Q8R A;  1JJ2 F;  2ZOV A;  3IEQ A;  4LCK A;  3N2G A;  5HP8 A;  1R1M A;  3R0P A;  3I7T A;  5IJ9 B;  5HP7 A;  4O2B A;  4O4H A;  1VQL F;  3JAS B;  3C9S A;  3LWR C;  4WBN B;  2OTM A;  1UI9 A;  3SIV A;  4BVT A;  1T0A A;  2EWC A;  3QTY A;  5HXZ A;  3KIZ A;  2V9Y A;  5FNV A;  3VOB A;  1OFU A;  3RYC A;  3RA5 A;  3FFM A;  5LXT A;  1H7M A;  1QAH A;  1RA4 A;  4O2B B;  1NQ3 A;  4BT3 A;  3CC2 F;  2I6D A;  2CSL A;  3CG6 A;  1FFX B;  2GZL A;  2VAW A;  3U0O A;  2OHW A;  5A2Q M;  5KMG A;  1J7H A;  2KTU A;  1W41 A;  5EB0 A;  2QEX F;  4LNU B;  4TUY A;  1CK2 A;  5JCO C;  3G4S F;  3CCS F;  3JAR B;  2VAM A;  3RYH A;  3S0H A;  4EI7 A;  3HKC B;  3VOA A;  3VIU A;  1RLU A;  2CW4 A;  5HXU A;  1IV4 A;  4IIJ B;  2OZB A;  1YIJ F;  5GIP C;  1COM A;  3CYP B;  1U43 A;  2FGY A;  1K73 H;  3IMP A;  1JY8 A;  3F0E A;  4TV9 B;  1YIT F;  3OBY A;  3VYS C;  4NQ3 A;  3S0W A;  1SA0 B;  3RYI A;  3VYT C;  1VQ4 F;  1RLG A;  2BTO A;  3GHZ A;  5J2U B;  4DXD A;  1IV1 A;  3ZP4 A;  5ITZ A;  5BMV A;  3KHN A;  5JVD B;  4BVR A;  4LNU A;  4TUY B;  1SDS A;  3PLA C;  1ODE A;  2UYN B;  3B6N A;  3CCM F;  1VQ6 F;  3F0D A;  3J81 M;  1KC8 H;  5JCO A;  1FSZ A;  3LWQ C;  4X1K B;  2AIF A;  4C4W C;  2Z1T A;  4O4L B;  2F9Z C;  2UZH A;  3K14 A;  2CZW A;  1XV2 A;  1QU9 A;  2DYY A;  2KG4 A;  3MCQ A;  3K2X A;  3RYC B;  3C8L A;  1JFF A;  3S06 A;  3E22 A;  1X25 A;  2JNB A;  4WBN A;  3N4Z A;  3LWO C;  3CD6 F;  1X52 A;  4NWO B;  4O4H B;  4ZI7 A;  5EB1 B;  2Z1E A;  3JAM M;  2LBX A;  4EB6 A;  4ERH A;  1GX1 A;  4M8I A;  3WXM B;  3QUW A;  5EYP B;  3O85 A;  5IYZ B;  1W2B F;  4U3J B;  3MCA B;  3SIU A;  3NMU C;  3ELC A;  4EI8 A;  4O2A A;  3OBW A;  4TV8 A;  3I55 F;  1TUB A;  3ZP7 A;  3HKE A;  2YYE A;  3KJK A;  4G88 A;  3WPX A;  1VK3 A;  2Z1F A;  3VO8 A;  3MDO A;  4X3L A;  1XBI A;  4O4J B;  3WPW A;  3D01 A;  1W5A A;  3CB2 A;  4I50 A;  3DDN A;  3LDT A;  1RQ7 A;  1NJI H;  5AVM A;  4I55 B;  1U3P A;  4IHJ B;  4B62 A;  1JN1 A;  1NMU B;  4YJ3 B;  3VTI C;  1DT9 A;  2Q1Y A;  4YJ2 A;  3CC7 F;  2ZVZ A;  4RQO A;  4BT5 A;  2HP3 A;  1YQN A;  4G4V A;  1XHO A;  1QVF F;  3OON A;  2ZAU A;  5LP6 A;  1IV2 A;  4ZOL A;  2HS3 A;  1YHQ F;  2KTV A;  4FFB B;  4I50 B;  2PHN A;  3WJQ A;  3CXC F;  1M1K H;  2H6L A;  4PWT A;  1IPA A;  2YXZ A;  3E1Y A;  3HTN A;  5GON A;  5CB4 B;  3F0G A;  2HX0 A;  5CA0 B;  5G4V C;  1GO0 A;  4RHA A;  2UYP A;  1X7P A;  2LBT A;  1VQM F;  4BT2 A;  5EYP A;  4ZOL B;  1GZ0 A;  1PXW A;  5EZY B;  1VQ5 F;  4E6E A;  1W55 A;  5KMG B;  1VQN F;  4BVS A;  3JAW B;  4YJ2 B;  3QHD A;  4F6R A;  3P10 A;  3FD6 A;  3M1X A;  3LME A;  1FNJ A;  3FD5 A;  3DC2 A;  4C8I A;  5J2T B;  5J2T A;  2IQQ A;  5GIO C;  2H8C A;  5MN4 A;  2UYJ A;  5HY0 A;  3ON1 A;  3WGN A;  5FJ4 C;  3WJP A;  1W42 A;  3WGM A;  4O4I A;  2LBW A;  3LYB A;  4ZHV A;  1S72 F;  3S03 A;  3K0T A;  4U3J A;  3CCQ F;  2OTJ F;  1K9M H;  4X20 A;  5JH7 A;  2VAP A;  4C81 A;  3UT5 A;  3C9R A;  2RHJ A;  3ESJ A;  3FPI A;  4R40 B;  1XRG A;  3HKD A;  2OTL F;  3NVK E;  2RHO A;  2DT4 A;  2ZVY A;  3M84 A;  4B46 A;  2CHT A;  1YGY A;  2QA4 F;  3S02 A;  2BO1 A;  2IAF A;  5KX5 A;  1W5E A;  5JQG B;  3ERN A;  3LFO A;  1VQ7 F;  1W58 1;  2W8B C;  3C9U A;  2G9I A;  1QVG F;  4TZZ A;  4HNA B;  1W40 A;  3C9T A;  3CCJ F;  3N2K B;  3RYH B;  1VQ9 F;  2HRU A;  2CVL A;  1U3L A;  2FC3 A;  3TD3 A;  3VCZ A;  2AMT A;  5EAZ A;  1JD1 A;  2HP0 A;  3RE3 A;  2ALE A;  2B33 A;  3V4D A;  1H48 A;  3N2K A;  3WGL A;  1X7O A;  5JVD A;  1FFX A;  1H47 A;  2BTU A;  3JVH A;  3G6E F;  2ZOD A;  3RA6 A;  2R6R 1;  4IHJ A;  4I55 A;  1PF5 A;  5EWR A;  3CPQ A;  5LXT B;  3AGK A;  4O4J A;  1KQS F;  3IEW A;  5LOV A;  5KX5 B;  3E20 B;  3MBM A;  3JAL A;  4TV8 B;  2HS4 A;  1QD9 A;  5LA6 B;  3CYQ A;  1FNK A;  3N2G B;  3HKB A;  1K8A H;  4DRX A;  4ZHY B;  3VYU C;  2QI2 A;  3JAT B;  5LYJ B;  3CCR F;  5C8Y A;  2K1S A;  2HVY D;  5LA6 A;  1KD1 H;  3M4S A;  3S0Y A;  1YJ9 F;  5EO3 A;  2R75 1;  4O4I B;  3VMF B;  4ZHW A;  4XCQ A;  1IV3 A;  3D00 A;  2BTQ B;  4X1Y B;  2RHL A;  3V7Q A;  3JAL B;  1W59 A;  5MN5 A;  1Z5V A;  2Z1U A;  3IR9 A;  2NMU A;  4B5C A;  5EIB C;  1W5F A;  5FNV B;  2UYK A;  5LOV B;  3CME F;  1UFY A;  1YJW F;  2L26 A;  5IJ0 B;  2VXY A;  3JAW A;  2I6R A;  5MN6 A;  5HY1 A;  3CCL F;  5G4U C;  5EZY A;  3L7Q A;  1M90 H;  1OAP A;  3JAK B;  2Q1X A;  4ZK7 A;  3I56 F;  4NUT A;  4G4Z A;  3RYF A;  1W57 A;  5BMV B;  1VQP F;  4B45 A;  4I4T A;  2AIZ P;  5HY2 A;  1N8R H;  4BT7 A;  3LWP C;  3RYI B;  3GYQ A;  1TVK B;  3G71 F;  3CCE F;  1ONI A;  5JQG A;  2VGM A;  5B8F A;  5CB4 A;  2PMP A;  3IKE A;  4EI9 A;  5CA1 A;  4I4T B;  1YJN F;  3V3T A;  2CWJ A;  3N4Y A;  4IIJ A;  1YI2 F;  2Z01 A;  2GLZ A;  2IG8 A;  3F0F A;  4C8E A;  3HWU A;  3V7E A;  4U39 A;  3JAR A;  5JH7 B;  3TD5 A;  2KGW A;  4G4Y A;  5DCV A;  3UT5 B;  3P0Z A;  3P4E A;  1Q7Y H;  4X20 B;  3OW2 F;  5IJ0 A;  1CN7 A;  3CCV F;  2HS0 A;  4X1I B;  3BYQ A;  4BW0 B;  4C8G A;  4ZHQ A;  5HWE A;  3WGJ A;  3MQW A;  1CLI A;  1KNK A;  1VQV A;  4BT4 A;  3HJW C;  5EIB D;  4G4W A;  3HKE B;  3IKF A;  1Q86 H;  1SZQ A;  1E7K A;  2P6Y A;  1VQK F;  4X1Y A;  3J80 M;  4X1I A;  3CPW F;  1ZWZ A;  4F6R B;  3JAS A;  3F6M A;  3NK7 A;  5IJ9 A;  4C82 A;  4KWE A;  5IYZ A;  3JCM M;  1GO1 A;  5C8Y B;  1W3E X;  3NVI B;  2LCA A;  3CMA F;  3CCU F;  3HAX D;  3PAF A;  3HKB B;  4BVQ A;  4ZI7 B;  3T80 A;  5CA1 B;  3CC4 F;  1JFF B;  2VGN A;  1RQ2 A;  5FLX M;  3E22 B;  3WGK A;  1TVK A;  2H8E A;  1VQO F;  4O4L A;  5CA0 A;  1VHA A;  1T0K B;  5GON B;  2WAL A;  2RB9 A;  4G4X A;  2HQS C;  4BT6 A;  5IT9 M;  5LP6 B;  4ZHQ B;  3TD4 A;  5GAP K;  4FFB A;  4BY9 D;  3LWV C;  1KNJ A;  3RYF B;  1Q81 H;  3GTZ A;  4X1K A;  5HY4 A;  2UYN A;  3JAK A;  1W5B A;  2HP0 B;  2HRY A;  1VQ8 F;  3J7A R;  3ZO8 A;  3Q8H A;  4YJ3 A;  5ITZ B;  5GIN C;  3K12 A;  2RHH A;  3I3F A;  5J2U A;  4HNA A;  2GVI A;  4X3M A;  2CHS A;  1SA0 A;  4TV9 A;  3KJJ A;  5LP6 C;  3ZOP A;  1U40 A;  3KE1 A;  5GAN K;  4O2A B;  1VH8 A;  2MQE A;  1DBF A;  1TUB B;  3FBA A;  1Q82 H;  3WJR A;  3HKD B;  2N48 A;  3NK6 A;  3D54 A;  2ZF8 A; 
#chains in the Genus database with same CATH homology
 3JVH A;  3IKE A;  3ERN A;  1YQN A;  2PMP A;  2GZL A;  2UZH A;  3EOR A;  3ELC A;  3IKF A;  3K14 A;  3IEQ A;  3GHZ A;  1IV1 A;  3F0F A;  3K2X A;  1W55 A;  1IV3 A;  1IV2 A;  4C8E A;  3IEW A;  1VHA A;  1W57 A;  3F6M A;  3QHD A;  4C81 A;  4C82 A;  3MBM A;  3P0Z A;  1U40 A;  3KE1 A;  3P10 A;  1U3L A;  3B6N A;  1T0A A;  1KNJ A;  2AMT A;  3ESJ A;  1IV4 A;  1VH8 A;  3F0D A;  3FPI A;  3F0G A;  4C8I A;  3FBA A;  3RE3 A;  1JN1 A;  1GX1 A;  4C8G A;  1U43 A;  1H48 A;  3T80 A;  5B8F A;  1JY8 A;  1KNK A;  3F0E A;  1U3P A;  3Q8H A;  1H47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...