1T0HB

Crystal structure of the rattus norvegicus voltage gated calcium channel beta subunit isoform 2a
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
Knots found
sequence length
219
structure length
187
Chain Sequence
RMPFTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKAIIERSNTRSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRHLNVQMVAADKLAQCPPQESFDVILDENQLEDACEHLADYLEAYWKATHPPRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a complex between a voltage-gated calcium channel beta-subunit and an alpha-subunit domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords VOLTAGE-GATED CALCIUM CHANNEL SUBUNIT BETA2A
total genus 52
structure length 187
sequence length 219
other databases KnotProt 2.0: Artifct K +31
ec nomenclature
pdb deposition date 2004-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1t0hB00
2QMEA 1RC8A 3S1AB 1OV4A 3KDSE 4JJKA 4B71A 4EFNA 5CM8B 4KAXA 2XAUA 4TZ6A 4BEBA 2NO7A 2PZGA 3K09A 3NG1A 1IN4A 4I1VA 4B6FA 2B8WA 2QZ4A 3DPUA 1GOTA 2YVUA 5J40A 5GJWC 2WIBA 2VP9A 5F9FA 2IBMA 2BWJA 3G0HA 2GA8A 2ZTSA 3U60B 2GEUA 4P32A 5DGXA 3EPHA 4LSGA 1RRGA 2HYIC 2ZRBA 2FDCA 4P0TA 2ZRGA 2BDTA 4B76A 4R9UC 4TZ0A 4WW0A 3RNLA 5FL7A 1CULC 3ADDA 4P4SA 4Q4AA 1OT3A 2VHCA 2HLDD 1KY3A 1PLKA 5G40A 3QG5A 2GXSA 3ZDQA 2Q3HA 1C1YA 1N5LA 2BKEA 4KFSA 2QQEA 4G01B 1GNRA 2ZSBA 2GTPA 4DHEA 3PFIA 1FNMA 4HB0A 2ZPTX 2IA5A 1DBSA 3L0SA 2GCNA 3CRRA 5EXTA 2GXQA 4YXWA 4CEJB 3LXRA 4GOXA 1KNXA 3UG7A 1XFAA 1Z0KA 3R9IA 3REGA 1UBGA 1FNNA 2OBLA 1OHHA 1R5NA 1FW6A 2PMDA 3RYTC 5DI3A 3VR6A 2WICA 1S9DA 3A1TA 1LV7A 1M34E 1W0JA 1J2JA 2EW1A 3IIJA 2PX0A 2YOGA 4B2IA 2IW3A 2G0TA 1D9ZA 1G3MA 1XCPA 2FG5A 4DC9A 4HZUB 1W48A 1G5TA 3KFXA 3WNDA 1ZU4A 4IDHA 1JEDA 2BOVA 1IXRC 4HAZA 3T5GA 3U3MA 1SXJA 1VDZA 1G1MA 2OEPA 2VP5A 1OIXA 5D3QA 2C78A 1FP7A 2J7KA 2OV2A 2ZSFA 4C7OA 3CRW1 4RKEA 1KHTA 4A6PA 1F2UB 4HUQB 1Z63A 1L8QA 3VR2A 1KI7A 4FIDA 3V4FA 4PTLA 3AKEA 2IF2A 4OJKA 2GBLC 3RS4A 3BS4A 3RDPA 3I5YA 5FI0B 2ZUDA 3TR5A 2RGNA 5CJPA 3NBFA 2HCJB 4HZIA 3Q3JB 2WJHA 2XXAA 2J3EA 4HATA 2NZJA 1OFTA 4PC7A 3B1VA 1K8RA 2UZIR 1NVWQ 3ND8A 4ZI3A 3HPQA 2DYKA 3KX2A 4RSGA 2CNWA 2Q3MA 4S35A 2I1QA 1CJUC 4JS0A 1MABA 4I1UA 4W5HA 1FFHA 1CRPA 1TUIA 4D26A 1A4RA 3BH0A 4PPNA 2QUZA 4A0RA 1XCGB 2HCBA 1RJ9B 3RRZA 1PLJA 2ZSDA 2QEQA 4KYIB 2ZI9A 4CT4B 3QG1A 2KI5A 4BRUA 4Q4JA 3SBDA 1CF4A 5E4FA 521PA 2QPTA 3AQ4A 5DHFA 4ACAA 2ZYVX 1S9HA 1LY1A 5CM9C 5HPYB 2QAGC 2PX3A 4ZKDA 4FWTA 1CJVC 5KPJA 3VAAA 4F92B 1S1CA 3R8CA 3UWOA 4HAXA 1FTNA 2VHTA 1KTVA 1J8YF 5FR2A 1NMXA 3QNUA 1UBCA 1VTKA 2RCNA 3NTUA 3NC0C 1GILA 3FDIA 1SVKA 1AN0A 2QQ0A 3N2IA 1BYUA 5FPTA 1G16A 4B35A 3CONA 4BFSA 4LBWA 2VBCA 3VX4A 5CDFA 1RFLA 1P62B 1X6VA 1NVVR 4BFZA 4DCUA 1NIPA 2XTZA 5H70A 3QXHA 1N2CE 3SI7A 1X86B 1GRNA 2ZYWX 4JJZA 2BBWA 2JLZA 3BAFA 4LYHA 2NPFA 1ZMXA 2FWRA 1P5ZB 3PXGA 4JL6A 2H5EA 2JLSA 2CCGA 1QHSA 4LC1A 3IPYA 2W2VA 1CR1A 2W6ID 2DPXA 4NMMA 3QKSA 1EX6A 1EFRD 2V7QA 3RAPR 3CPHA 5HE8A 3GLGE 4B3GA 3B1ZA 2JLRA 3CM0A 3IGFA 3KXLA 4G0NA 3K0SA 1XD2A 4DDWA 2QRNA 3HU3A 1Z6GA 1DTSA 1OXSC 1KK1A 4OJQA 2N1BA 1DPFA 1XMVA 3QF7A 1SHZA 4R71A 4V0ME 3A6PC 2V55B 2WVJA 4PO1A 3FHCB 3CX6A 4V0NA 3VKWA 3U5ZB 3E5HA 5JFGA 5JSZB 4GDFA 2GESA 2DHRA 5FUWA 1G8FA 1E6CA 1YZUA 3D8BA 2CL7X 3N70A 2D06A 3T15A 1VIYA 5H1YA 4E22A 4JLJA 4GPTA 8OHMA 1XJQA 4FCTA 2IT1A 3MJRA 1FQKA 3T34A 1GM5A 1ZAKA 2QAGA 2J59A 2RGAA 2XOKD 2O0KA 1MRNA 3ASZA 5F9HA 4DIDA 2PLRA 1LS1A 4B75A 1RVDA 1ZD1A 4MRPA 5FOSA 4BRWA 3MMPA 3C14C 1U99A 2FN4A 5L3QB 3AF3A 1CRQA 1F48A 4N3NA 3U7GA 3A4LA 4TT3A 1Q12A 3SC3A 3KQUA 4DXAA 4ABYA 3Q5DA 3FTQA 3WRXC 4EJSC 2ODBA 4XWOA 5KHOC 1FMJA 4EQ6A 3NWJA 3C15C 4FMDF 1E1QD 4M1SA 1KJYA 3VHXA 2FJUA 2XB2A 4HLQB 1G41A 1CKEA 5DHAA 1NMZA 4IFEA 4JBXA 2HT1A 2WPDD 1GTVA 5DISB 3MGCA 3A4MA 4PC6A 3SYLA 1IY1A 2XX3A 3AGPA 3X2SA 4F38A 1GKUB 3AF0A 4BWYA 3KKMA 1M1YE 3U3OA 4JMPA 1SVMA 2REBA 1E2NA 4MKGA 1TQDA 3OHMA 4U02A 1M74A 1ZC4A 4FWIB 3ZVNA 4CVNA 1YU9A 2C98A 3PUXA 4ZPXA 4D4MA 3QF4B 5JRZA 2VHJA 4Q9KA 3GEIA 1G4AE 4M0LA 4R2HA 3RRMA 1Q44A 1M7HA 2DY1A 1JI0A 2XGJA 3BJIC 4KFUA 1R10A 3RRYA 1E1RD 4HLCA 1P75A 4AG6A 2YWHA 2ZI5A 2CHGA 4KU4A 3RWMB 4Q7LA 1COWD 2A7QA 1VYVA 2ZRAA 3B9QA 5G3YA 4HYYA 2R6AA 3MD0A 4BGDA 3CWZA 4AC9A 1F5NA 3PUWA 4JLAA 1AQUA 5EUMA 1CBUA 2RGBA 2R44A 4XOIA 1NG1A 2JIZD 4M2LA 2KWIA 2HUPA 1KI6A 2OCPA 1JQLB 5JCPA 2YC4C 2QN6A 2O8BA 2H92A 1QVAA 1ZNYA 2G3YA 1OB5A 1HT1E 3RS7A 4QOSA 3L0OA 1GL6A 3K0FB 3LO5A 4US2R 3AUXA 3FFBA 2FPKA 1KI2A 3WBKA 2F1HA 4YDSA 2YWFA 4QRHA 5LD2B 4GL2A 3A1VA 1CR0A 1W0KA 4A2PA 4UNSA 2CE7A 3U3JA 2V6JA 2XNDD 3RSOA 2VL7A 3W8NA 4LHZA 2O8FA 2V54A 3AF1A 1II0A 2DCUA 1VHTA 4B2LA 2J7PA 5SZKB 3L8YA 2VYFA 3NBYC 1P4SA 3CNNA 4QHTA 1T3SA 4DJTA 4M53A 4UNPA 4C0JA 1WBDA 4GP6A 2QP4A 4DLUA 4J0QA 1MT0A 3THYB 4Q9HA 4Q47A 3HU1A 3W6NA 1HQYE 3HWSA 4MRRA 1ZIPA 3TQCA 4BECA 4Q03A 2ERYA 3K9HA 3N5CA 4XWAA 5DO9A 4BFUA 5KO2A 2QG6A 3PEYA 2CJWB 4IOJA 3I62A 1KO7A 2ZVQX 3C5CA 1ZJ6A 1UKVY 3FE2A 5DN6A 3ZZUA 4QBIA 5KNBA 4M9SA 2LKCA 3VU9A 1IJEA 1Q1EA 1KI4A 3F0TA 1T9HA 1KKMA 1DAFA 3HP1A 3C41J 2X2FA 4PANA 1IOZA 3CPJB 1Z6XA 1NSFA 2GF0A 3AVOA 5DI3B 5LBIA 2JASA 1FMLA 4M1WA 1ZINA 4M1YA 2PBRA 3NVAA 2YOFA 2WSSA 2DWQA 1AS3A 2O8DB 4OK6A 2O8CB 2OBNA 5HCIA 4MDEA 2Z4RA 2XJ9A 3VQTA 1BS1A 5K8TA 3LVQE 3MCAA 4O0MA 5FUXA 4HZUA 4PQYA 2ODEA 1JAIA 4PAOA 2CVHA 5FPSA 1WXQA 1XZPA 1PZNA 1QG2A 3P32A 5CYOA 1NBMD 1VKJA 4D2IA 1RRFA 4YMUA 2HXSA 4LK2A 2NPIA 4YMWA 2AN9A 1E1RA 3OZXA 4QNRA 4WBSA 5FUVA 3R7WB 3EWSA 5A0FA 5GVSA 1OSNA 3R20A 1AZTA 4M9XA 3O8DA 3UK6A 4LJYA 2NTYC 4JLOA 3REFA 1US8A 1KO8A 1OKKD 3M6AA 5JLJA 3RC8A 2XZPA 4OHYA 3SQWA 2JIZA 1TL7C 1ZUHA 1Z8FA 3TRFA 3LW8A 2REOA 2BMEA 2VRWA 2X2EA 1JXOA 2CE2X 1T4GA 1KDOA 2WJIA 3QPUA 1R5OA 4TSFA 3VNVA 1P3JA 4OHXA 1G8YA 1GKIA 1A5TA 1KY2A 2QNRA 1R8SA 1II9A 3TJZA 4B43A 4B44A 2JEOA 4FCWA 2X19A 3UMSA 2WTUA 5BYJA 2ZU6A 1E32A 5FI1B 4FD2A 1DG3A 4RJLA 3LXXA 5GADl 2QBYA 3Q7QA 4Y0VA 3NDBB 4PSKA 5HZHA 4QJ4A 4G5SA 3OFNA 4EPVA 2CEAA 3KQLA 3EXAA 1QHGA 5FTJA 1Y3AA 3LNCA 1NSTA 4WXPA 1G7CA 5TDHA 5JWOA 1YZLA 2ZJYA 3GLIB 2VEDA 3QPWA 2HLDA 2ZAOA 4LC0A 1HQCA 1XTIA 2P2LA 4IFBA 4TL8A 3AVPA 2IX3A 2OT3B 1ZW6A 2J9RA 1OH5A 1E9SA 3GJ8A 3PG5A 3NH9A 2EFGA 5CJ2A 2JDIA 4CZ2A 3KKOA 4LI0A 4JL8A 3DVLA 3TE6A 2VP2A 3QUSA 4B3DA 1DELA 3I61A 1XPRA 1DAIA 5JBQA 4YONB 4KFRA 3PEVA 1VG1A 1UEIA 3X1YA 3CX8A 3GFTA 4AKIA 2QMOA 2RH5A 2J0SA 3EA0A 5A4JA 1XD9A 4TLCA 3TUIC 2AWNA 1W0JD 1G8HA 2IYYA 1U0HC 5GJCA 2P67A 3GFPA 4LUCA 3MRSA 4ZDWA 3O8RA 1SVOA 2Q6TA 3TGPA 2IL1A 2V8OA 1T3LA 5CLQA 1S8FA 1BMFA 5FOTA 4EPWA 2QP3A 4M1MA 2KBFA 2WOOA 1E0KA 3TMKA 1E9BA 3GJ0A 1IHUA 1ZNXA 2YNMA 4DSUA 3BWDD 3CR8A 1L4YA 5EZ6B 5F98A 4OKSA 1F2UA 4HUQA 1NN5A 1UFQA 5FOVA 3I5XA 3M0EA 4BZPA 3FMPB 3KKPA 4D80A 1G21E 1Z2AA 2F1JA 2CCJA 2OFXA 1Z6AA 1P9WA 4JLVA 4OI0A 1U81A 5FBVB 1JECA 1LNZA 4GOJA 4GMXA 4CDGA 2QT1A 4BASA 2AD1A 2J0QA 2ZI7A 2XNSA 1NN1A 4FW9A 2XJ4A 4PSAA 1W5TA 2L0XA 2KBEA 4TL7A 2ZAMA 3A36A 3T1OA 5KSZA 5P21A 3TAUA 3H2YA 2CNWD 2OLKA 3DL0A 1WDTA 5L3VA 1YQTA 1D2MA 2BJVA 4I4LA 3PEUA 3PVSA 2J41A 3CF2A 2OAP1 1OXVA 1YR7A 5JCZA 2PJZA 1LFDB 1JEEA 2O5VA 3K0CA 2P6UA 1OFIA 3Q85A 4NL4H 4G5OA 1E3MA 1IQPA 5DE3A 1G64A 2BEKA 1TF5A 3GLFA 1ETUA 1KDTA 2QP9X 5KNCA 4POAA 4XWKA 2Z4SA 2RGDA 3I72A 4JIMA 4QXAA 3MWYW 2YOHA 3OF5A 4WOPA 3BXZA 4PC3A 1LF0A 3BFKA 4RZ3A 3VR3A 421PA 4ASUA 2GHIA 4EJSA 3NXSA 2JLVA 1KMHB 3FFAA 1VG9B 1XTSA 3EAQA 3IQWA 4MKFA 2OZEA 3TR0A 1V43A 1T5IA 3K9LA 1KGDA 1W7AA 5IT5A 2DB3A 4LYAA 3HR8A 1NY6A 4HB4A 1OB2A 2P3SA 1Y63A 3GMTA 4XTRA 4UXHA 3EG5A 1KIMA 4O2RA 5E95A 4LHXA 4Z8YA 2IUTA 1XX6A 4AIIA 5LB2A 4GI7A 1Q22A 5BQ5A 1NBME 1VG0B 3X1ZA 3AH8A 4HLDA 2DR3A 2QPAA 4MRSA 4V0MA 2WJGA 1GRQA 2FNAA 1VECA 2WMNB 3I8SA 4HDQB 1KSJA 1GDDA 2ZROA 2TMKA 5KDLA 2JCSA 4I81A 4MYUA 2J0VA 3TKLA 1VYTA 1QHXA 3IDQA 4DSOA 1IY2A 2GKSA 4HAWA 4Q7JB 2R6FA 4PAMA 3GLGA 1EX7A 1C4OA 3NBZC 1OIVA 3W5IA 5BYKA 2CXXA 2IC5A 3CH4B 1ZM3A 2I4IA 2QM7A 3EZ7A 3ZVLA 4GSYA 3UPUA 4EPXA 3EPLA 3V00A 4BFXA 1T6NA 1ZRHA 1F3OA 2Z5FA 3B1YA 5EZ5A 4GZLA 2P0EA 3BFVA 4DDVA 3CLVA 3QKRA 4BLTA 4KO8A 5JHHB 4I99A 2J87A 3U6KA 2IYLD 4A8JB 3TSWA 1UKEA 1WQ1R 2IYVA 4DLSA 3K0FA 2F43A 4C0QC 5JS8A 4DLTA 1WMSA 2QROA 3PQCA 4QG7A 5FBRB 2IWRA 4TLEA 4AG5A 4RVCA 1E2FA 3QVUA 4B3BA 2GAAA 2FPMA 3OESA 4RCYA 3IQXA 4U5XA 2ZRCA 221PA 4DLWA 4GOKA 1ELOA 2WWWA 4MKHA 4IOMA 3BB4A 4FMBB 4Q1EA 2HF8A 3DEFA 3FYHA 1N6NA 6Q21A 2O52A 3SYKA 1L7VC 4Q66C 3HR7A 2CL0X 2FEMA 5JECA 4Z51A 5AUQA 3AUYA 1FZQA 1KJWA 2VP6A 2WPDA 2CHVA 3A1UA 1LF5A 2B6HA 1OH6A 4D25A 4CW7A 2HXYA 4HAVA 121PA 4QGHA 1OH7A 3ZIAA 1VCOA 1EWQA 3NEJA 2ZE7A 4L9SA 2SHKA 2R2AA 3VTKA 5SZIA 2C8VA 1SXJD 1VMAA 3AGQA 3EZ2A 1XBTA 5KUTA 1VCMA 1YZTA 4BEJA 1NY5A 3I8XA 3T06B 3TH5A 3GEHA 3QF4A 2ZRNA 4A92A 1EXMA 2QENA 4QKQA 1ZCBA 1ZD8A 4QJ5A 5C2JB 5JI2E 2A9KA 1RRPA 1E9CA 3TW4A 5B64A 2ATXA 2IHBA 3IKJA 4HB2A 2Q21A 2EWWA 4LYFA 3I73A 3R8FA 4DEXA 2XZLA 2JJ8A 3GPLA 2RGEA 2GBLA 3OAAA 1XTKA 1KI1A 1E4VA 1ONBA 4QM7A 5CLLA 1II8B 1XB2A 2RMKA 4C2UA 1YRBA 2A5YB 2CK3D 4NCJA 1KI6B 3SEAA 4B48A 4PHGA 2F55A 5FTMA 5HE9A 5J47A 1S4QA 3BBPA 5GJBA 1HA3A 4C2TA 1E0JA 3HU2A 2ZE6A 3GJ3A 4II7A 3U3KA 4PHHA 3LLMA 3OEHD 1GP2A 1US8B 3KUCA 2G0NA 2B7CA 2F6RA 4JSYA 5AR1A 3UANA 4DVGA 5BN3A 2V1UA 3OIWA 1EESA 1RYHA 4HI0E 4HDOB 3KFVA 4JT4A 3NHAA 4KVGA 1QDEA 2CLCX 3G82C 3FKQA 3PR1A 3DOFA 4Z1MA 3UXMA 4BZXA 2BBSA 1EGAA 1SVWA 3IHWA 4Q4LA 5TVKA 2GCOA 1Z3IX 1OF1A 1P60A 2IYWA 4LJ9A 4V0LA 2FMXA 3SR0A 4LY6A 4IVQA 3GFOA 2J7PD 2OESA 3I32A 1JB1A 4BZQA 1PJRA 1XTJA 2IS6A 4O3MA 1XD2B 1G8PA 2ZVPX 4UQOA 3W5JA 2KJQA 3A4NA 4Q9IA 1ZP6A 4WAUA 2ZM5A 5LD2C 1G7SA 2WKQA 3QEOA 3SS8A 3CNLA 2WWYA 1RIFA 5IK2D 3ADCA 1H8HA 2ZE5A 1KK3A 1DAMA 2ZR7A 5DN6D 3DOEA 3MWKA 2NO6A 3AVQA 2CHQA 2H1LA 3K9GA 4B74A 4JLKA 2ZJOA 4PQFA 1ESMA 4A0HA 4C0SA 4DCNA 2YYZA 4A4DA 2PZEA 2ZJ5A 2ZRIA 2R6DA 2ZREA 4L5BA 1OIWA 4NU0A 1E0SA 3K0CC 1HE8B 2JJ2A 1XJ0A 1XCMA 2REXB 5A5GA 4TMZA 2XTMA 1DVRA 4AWXA 5J5CA 1Z28A 3RSLA 2YWGA 4NP6A 4Q48A 2HJVA 5D3MA 5JWRA 5G3ZA 1NI3A 2ZI6A 3F8TA 3PCRB 3SNHA 4B32A 4E03A 2OAQ1 1FP6A 1VYUA 1B0UA 3CRMA 1M7GA 1XZQA 2IYTA 1ZIOA 3MAAC 2C03A 4GZMA 3EIEA 4LBYA 4OI4A 1I4LD 1N6OA 2XOKA 3U4QA 3C5HA 2GRJA 2WBLC 3CW2A 3K0AB 2CVFA 1UEJA 2G77B 5C4MA 2AD5A 2AFIE 1E2GA 3F3YA 4IKEA 4NDZA 2FSGA 3LY5A 3B8HA 4Q18A 5FTNA 3FPAA 4MYHA 4EDHA 4ZDIA 2FH5B 4M21A 3DZ8A 2IK8A 4M9QA 2ZS9A 4M8NE 2FA9A 1R5BA 2HEIA 4P3YA 1NRJB 5TMPA 4LHWA 2J1LA 3THXB 4OI1A 2QRZA 3EASA 4B34A 2RAPA 3QXSA 2G88A 5KSPA 1JR3A 3UMFA 2QT0A 3T35A 2D2EA 1P72A 1KI9A 1LB1B 1VHLA 2QSYA 1N5IA 4QGFA 3HYTA 5AJZA 3W34A 3V4RA 3AVUA 3WBJA 1N5KA 2PCLA 4MYTA 4Q4HA 5E7MA 3WHLA 3D6TB 3BORA 4ZCMA 2GJ9A 1G9XA 1P9NA 5JJKA 4RD2A 2A30A 4XVUA 1E2LA 4XVQA 3U2QA 3WNBA 4E09A 1SXJE 1XTRA 1YVDA 5H68A 4NCKA 1YZGA 1AK2A 5DYIA 3GJ7A 4OBEA 4TLAA 5EE3A 4C4PA 1E79A 4UXJA 2DWPA 3QPVA 5C18A 3A8TA 1ZM2A 2V6IA 3MUFA 2QTFA 2W00A 2QAGB 4URWR 4KITB 1Q57A 1BKDR 4DCTA 1KMHA 3H4MA 4LBVA 4D0NA 2WHXA 3VR5A 1KSHA 2ZRFA 3P26A 4WIAA 2GZAA 3FWYA 4W9MC 4CEIB 4LPSA 2ONJA 5L3QA 4LHYA 4LRWA 4G3XA 2NO1A 2QM8A 3DMDA 2ATVA 1TX4B 5DYGA 3E1SA 4H1UA 4OQXA 2MMCA 1OE0A 5IDVA 1KO5A 3EW9A 1XMJA 3FMIA 4DLVA 2ERXA 5FL7D 2VSFA 1RKBA 2FFAA 3JVUA 3C4JA 1KSFX 1LVGA 2EYQA 2ZR9A 3RS5A 1KO4A 2XSZA 5ELXA 2EVWX 2J5XA 3GLIE 2FEOA 3ECCA 4QGAA 4XJXA 3V9PA 2BKUA 2IUUA 2NGRA 2VSOA 4B3FX 3IUYA 3K0EA 1X1RA 5E7IA 2PZFA 3WP0A 2F1IA 3WXMA 4Q1DA 4D4KA 2VHQA 1T0HB 3VFDA 4NYJR 4LJ5A 1W0KD 4KCGA 1TPZA 5B57C 5HZKA 1IONA 3QI2A 4RD6A 1QF9A 4NCHA 2FE4A 2P5TB 5CK5A 2YV5A 2ZJBA 4OHWA 1OYYA 3HPRA 5K8IA 5FFMA 1SULA 3THWB 2W2XA 3P4YA 4D81A 1Z47A 2WJJA 4H1VA 4XIGS 1KAGA 2GF9A 3IEVA 2VHUA 4BE7B 1RRCA 4PXAA 3AP3A 4TTQA 4MKIA 4PR0A 1G5RA 4D4LA 1KKLA 1XPUA 1DARA 4TLBA 5UKDA 4F91B 2O8DA 4LYJA 1CEEA 2O8CA 1E96A 2ZI4A 2WZQA 2C95A 2YKGA 3P27A 4K8OA 1SQ5A 4KJZA 1PUIA 1P73A 2DBYA 4US0R 5L3RA 5AJXA 2OILA 2QTVB 4QGGA 4HLUC 4RFVA 4UNNA 4EJSB 3BGWA 3VR1A 2FSIA 4DUGD 1R0YA 4LJ8A 2AXPA 3GP8A 5FPYA 2ANCA 2EQBA 3C7KA 2UVQA 3JVVA 3RVBA 2EFHB 4Q9JA 5AJYA 4AURA 2DWOA 1MH1A 4PZYA 2R6CA 2ECKA 2WJVA 2NIPA 5AJVB 3C8UA 5C1BA 2GILA 3FHOA 4OHVA 1T5LA 1NLYA 3EA5A 4NYMR 4CIDA 1NKTA 3B9PA 2ZI3A 4UJ5A 3Q5EA 3KTAA 3WY9A 1ZM7A 1J90A 1X8KA 2CBZA 1G17A 3W3AA 1UBFA 1G6HA 1TQ2A 4OHZA 4PHTA 3VNUA 3Q72A 2IYSA 2R62A 4B47A 4CT5A 3MWLA 5SZHB 3WMEA 5GVRA 3DHWC 4G5RA 1A82A 1TQ6A 3MSXA 3AVWA 4BUJA 4N0DA 4AYWA 2YC2C 3AKDA 1DS6A 4JLMA 2BJWA 5G53C 5BW8A 4W5JA 2ZS7A 1W44A 4DCVA 3B7GA 1TUEA 1U9IA 2O0JA 4F93B 1MR3F 1BO6A 1H65A 2MSDB 4MRVA 1AS0A 2W6JD 1BH2A 4LV8B 2FF7A 2NG1A 1EG7A 3TUJC 5DIFA 3T1TA 2R8RA 1KOFA 1Q1BA 3KB2A 2VQSA 1JAHA 4EFLA 2ODWA 3MJHA 4TWZA 1W2GA 2Q3FA 3AP2A 4KFTA 3NH6A 1II8A 1H8EA 3QIAA 3EIQA 1UKZA 1XXHA 2FZ4A 3MG9A 4Q21A 4RY2A 4Z1MD 1KO1A 4XTCS 5EE5B 2R9VA 5FPHA 2NZ8A 3EARA 5B2ZA 3LVRE 1E9AA 4L15A 1TADA 5J4KA 3IO5A 1S2MA 3DO6A 5KSOA 3FKSD 3O8BA 2F43B 2PT7A 5LDDC 3VKGA 4MQBA 1R4AA 2KB0A 5F2EA 2W6IA 1U9IC 2FPLA 2QA5A 1OJLA 3TSOA 1AZSC 3CF6R 1ZCAA 5HR5A 4FXPA 2O8EB 3KL4A 2GAOA 2PCJA 4JVSB 2XB4A 3LX5A 2D7CA 3ZYCA 2HF9A 2GCOB 1AGPA 4UXIA 1PUJA 4LHVA 3ZH9B 3RABA 4C0KA 5JS7A 2BM0A 2F3RA 4S2EA 3FGNA 1JR3E 4TYQA 3KXIA 2G1JA 3DM9B 2LCFA 4WVFA 1G7RA 3JZMA 4YC7A 2Q0HA 2C9CA 1YZNA 1NN0A 4PPGA 3ZD6A 4AKEA 4OL0A 4AKHA 1NVUQ 3BB3A 4BFYA 1SKYE 1HE1C 3QXJA 1U0LA 3SJCA 2QU8A 3WMGA 4A15A 1BMFD 5HKKA 2P6NA 3LBNA 4R98A 3W6PA 5KTYA 1K5GA 1IY0A 3WMFA 4EIWA 3DKVA 1QZXA 3UKDA 2GETA 4EKDA 1Z83A 3DM5A 3NDPA 3TVTA 2Z6VA 3OIVA 1U2RA 3ZD7A 4A1FA 4MGIR 2BCGY 3SZRA 5FL3A 3CX7A 1ZM4A 4NONA 1X3SA 2XNDA 4ON9A 1F6BA 2JLXA 1KNQA 4ZO4A 1XMIA 4OQNA 5E7JA 3SDZA 1R0ZA 2WWXA 3I92A 4LV6A 1E2HA 1XEXB 4TTRA 1IXZA 3N2EA 5G41A 2GJ8A 3CWQA 1IXSB 3DDCA 1P61B 2GVDC 2N46A 2PT5A 3CB4A 4GFDA 3IPXA 2I3BA 1SKQA 4MRNA 4QFMA 1MO4A 1QBKC 2VP4A 2C77A 1LW7A 2FGJA 2ONKA 2W6JA 3SFVA 3ETLA 4YXWD 1Q3HA 5L3SA 2AFHE 2ZUBA 4FINA 3A1WA 1C9KA 3CRVA 3KQNA 1G3IA 1CU1A 1Z6TA 3CIOA 3LBHA 4KHZA 4TT3D 1W4BA 1AKEA 2CL6X 1T8TA 2JLWA 1I2MA 4TN1A 1WP9A 4X8OA 1W4AA 2PH1A 4BQSA 1FOEB 2IXFA 1E1QA 3FOZA 2J0UB 1GVNB 2P6RA 3GLHA 4TTPA 3EC2A 4D4JA 1A2KC 2WKPA 1GL7A 1R0XA 1UPTA 3ZZ0A 4YMTA 4C3ZA 2VLIA 3HDTA 821PA 3U7HB 1QHYA 2ZE8A 3QKTA 3IILA 4I1OA 2A5FA 1E2MA 1ZNZA 2Q9BA 3EX7C 5EUQB 1GL9B 1N6KA 4TQUS 4QHYA 1DE0A 1E2JA 1F2TA 2GJKA 3D3QA 1QRAA 2OXRA 1N0UA 3CUEF 4IOKA 4PC2A 4BFTA 3KQHA 3THXA 5E3HA 3GLGB 2NMVA 4ZIRA 3VKHA 4RD3A 1IAQA 1WF3A 3LH5A 4U7DA 3BB1A 1KAOA 4QBHA 4HDCA 1UDXA 2IF0A 3GJ5A 3BD9A 1NG9A 1MO6A 3BFXA 3W6OA 1E99A 5B30A 2JGNA 2ZYUX 1G8GA 1NBMA 1K6MA 3FVQA 4DB4A 5IK2A 2JATA 1IN6A 4IEEA 2AKAB 1J99A 1R8QA 1W49A 3NHBA 3SOPA 3P1JA 5H8WA 1DO0A 4JLBA 2BHRA 4CF7A 1K5DA 3M1IA 2QPOA 3I4LA 1NKSA 1IN7A 2WSMA 4A8JA 1OKKA 2K5UA 2RGXA 5EJEA 4NYJQ 3B1WA 4MGYR 3KXKA 4AD8A 2QI9C 5AUOB 4Q9LA 3EZFA 1QVRA 4PPFA 2XSZD 1Z22A 4O2LA 2CLDX 4TMWA 2Q9CA 1E2PA 2BIFA 3H84A 1AIPA 2IEYA 4Q01A 2IUSA 2BEJA 4AYXA 4DLZA 3KQKA 4QM6A 1G291 1Q1ZA 1X8LA 3BC1A 3PEWA 1HV8A 1DAKA 3I3SR 3UWKA 1GKYA 1VCIA 2HJGA 3FMOB 3OE7D 4NE2A 1U90A 1ZC3A 3CZQA 4RFSB 1N5JA 1GRRA 4ZDKA 1QHHA 3NC1C 2D4HA 2C04A 3AP1A 3QEJA 4OQLA 2OFWA 5JMTA 2GK7A 1G19A 2XITA 3QBTA 3SFZA 2G9NA 4TQAA 3AVXA 2D3WA 4EPRA 5TARA 4B3XA 4L16A 3U44A 2OUKA 1X1SA 4HSEA 3LAWA 2RGNC 4A0FA 2V7QD 4JT2A 1JJ7A 2FFBA 2MSEB 1N6LA 1ZM9A 3GJXC 4JSTA 1WA5A 1GG2A 2IYXA 3ZZTA 4A2WA 2RB4A 2JDID 2ORWA 3L2OB 5DNYB 3KJIA 5BXQC 4WXRA 2IYZA 4JVNA 4JL5A 2IS1A 2ZRKA 4OQFA 4GMDA 3B60A 3Q9LA 5FOWA 3IEUA 1G5PA 5HTKA 5EE1A 1GWNA 4TYNA 2C2HA 3ICEA 3ZJYA 1D9XA 1HTWA 2YZ2A 2OCBA 3A37A 3K1JA 4Q4HB 3ZIAD 4EPTA 2ZRDA 2V3CC 4DIEA 2PEYA 1WBBA 2R6GA 4IOLA 4F4CA 4P33A 1HT2E 2AXNA 5EE9A 1S1MA 4PX9A 3OEED 4WZBE 3EZ9A 2C99A 2QY9A 3LQRA 2GJAA 3GLFE 4C0AC 1I2DA 2C96A 3OIYA 4X8HA 3UG6A 2VP0A 1Z06A 3EWAA 5SZJA 2GEVA 4W7SA 3VMFA 4A82A 2P5SA 5J4VA 3LWNA 4GBMA 5LPNA 2QTHA 1SVLA 2IXEA 2WAYA 2ZRPA 4ZI2A 5FBQB 3UIEA 4FCVA 1D8TA 2OG2A 3K70D 4PZZA 2CJWA 4RD4A 2F9LA 3RS2A 3CPEA 1FL9A 3HYRA 5CK4A 4DT1A 3OFND 2P65A 5AK0A 4CEHA 1A7JA 3CRQA 3OAAD 4BLQA 4PZLA 1MOZA 2ZJ8A 5F3WB 1NIJA 2JA1A 4ESVA 2BC9A 3EIHA 2GVZC 1JQJC 2VF7A 3U61B 2WM9B 1WB9A 4JYCA 1HUQA 4TYPA 1GNQA 4NCNA 3R9XA 3O47A 2OCYC 4LJ7A 4Q7KA 3T61A 2IS2A 4UNRA 2HDNB 5FTKA 3D7MA 2BMJA 4MH0R 721PA 1DG1G 2AHOA 4FMCB 2IXGA 4PAQA 4P4SB 4Q4AB 2BM1A 3OE7A 4LWZA 3OEHA 3ZLJA 1UF9A 3KJHA 2GZHA 2IHYA 3RANA 2B21A 1CR2A 3AKCA 3C16C 4M4SA 1G3RA 1TEXA 5BWMA 1VPLA 4Y0AA 3WHKA 4DLYA 3BOSA 3L8ZA 1Z07A 3FKSA 3KUDA 4LZZA 4PFSA 2NQ2C 5JJIA 4F4IA 2V9PA 4Q00A 1N25A 1GAJA 2BVNA 4JZKA 4TL6A 4C0BA 1IN8A 4D6PA 1R2QA 2BCJQ 2JJ1D 5EQTA 2IYRA 3HJNA 3KZ1E 1AQYA 3QJYA 5CB6A 2J46A 3VU9B 1KK2A 4A9AA 2RHDA 1XJCA 4MGKR 4NYMQ 1G4UR 1E2KA 3TNFA 1XD8A 3QOFA 2UZ3A 4Q02A 4QHSA 2AWOA 4WZAE 1JJVA 1G3UA 1BYIA 2EU8A 2GEDA 2OSBA 3KKQA 1H8HD 4BPBA 1DAEA 2W83A 1D5CA 1OXTA 1UM8A 4IDOA 5KYKA 3EPKA 4DKXA 4Q5IA 4LPKA 1XTQA 4XH9B 1AA9A 5EXSA 4K46A 3QXCA 4ZV4A 1P9RA 1XMSA 5HKKD 2ZANA 1JPJA 3U3RA 4JKYA 3LW7A 4D0LB 3ZVMA 3QE0A 4N1AA 3PJRA 1S3SA 4GT1A 4NYIR 1KK0A 5L8VA 2CLSA 4B3CA 3GQBA 1OLOA 2GDJA 2GWHA 1EFHA 3S1AA 4DCSA 1ZBDA 2V4ZA 3PENA 4TMXA 3SYNA 2JLYA 2XXAB 1W1WA 3F5FA 1N6RA 3LDAA 1EFUA 1HEIA 1CJKC 1SKYB 3BIFA 4IHQA 5FOXA 4DDUA 4RD0A 3L0PA 4X8MA 4B73A 2PL3A 4IXNA 1TU3A 1YJ5A 2ANBA 3TQFA 4BFVA 1RYFA 5CB8A 1DAHA 4MA4A 2YHSA 4BLOA 2Q9AA 4KXFB 1E69A 2YINC 4Z54A 3SN6A 4ERNA 2ZETA 5FBLB 4DSTA 4P4UA 3GJ4A 4FI3C 4EUNA 4LV5B 3FB4A 3ND9A 2C5LA 3ZGXA 2BBTA 2AK2A 4UKDA 1JBKA 2J45A 1P7CA 1W4RA 4Q4JB 5FH9A 4NHOA 2PJRA 3W3ZB 2XZOA 2X77A 1QHNA 3UMRA 3VX3A 1NVXQ 2ZJ2A 4NBSA 4IVRA 1BOFA 2LWIA 3SBEA 4KI0A 3B78A 3KB1A 1S3GA 2Z83A 3CR7A 4FMDB 1HH4A 3CKLA 4CEJA 1XEXA 3RWOA 1IBRA 5KOYA 3CF0A 1P2TA 1W46A 1AGRA 1T91A 5JZVA 1JR3D 1Q3TA 2O0HA 4YDHB 2ZJAA 2ZS8A 1W36B 2BMFA 3SHWA 3NEYA 5EXXA 4CEIA 1MRSA 2WWHA 2W2TA 3WNCA 5JRJA 1R7RA 2W58A 2E1RA 4C9BA 4G5GA 3AKYA 3P20A 3KJGA 4ASUD 2MSCB 1U94A 2ORIA 1IJFA 1XEWX 1NP6A 4L4UA 4M1OA 4Q1FA 4WZ6A 5D3MB 5CITA 5FPKA 5K8LA 2JJ1A 1J70A 4NZYA 4JBYA 3PUYA 5JEDA 2F1RA 4LOAA 1FUKA 2DFKB 2J0UA 4MUBA 1A2BA 4K81B 3ASYA 4HEJA 4DZZA 1E79D 1XNJA 2O8EA 3U4QB 1XWIA 1N0VC 1ZNWA 1DAGA 3K0AA 5HCNA 5DLQC 4XD7D 4A8JC 1ZUIA 3QKSB 4JKIA 3L0IB 4MUAA 1E98A 2DFNA 1E2IA 1Z2CA 2A3RA 2KE5A 2Z43A 2ZSEA 1I4TD 3TW8B 1UADA 4ZCIA 4X8LA 2DFTA 1NJGA 2F9MA 1E2QA 3X1DA 1MO3A 1O3YA 3AF2A 3KJEA 2FOLA 5EP3A 2BV3A 3DMNA 1Z0AA 3DKPA 4PHFA 2N42A 1E2DA 3NKVA 4URUR 2QMHA 2AK3A 3QVVA 3TLXA 3FHTA 1E9RA 3GEEA 3LD9A 2XTNA 5FBWB 1YR9A 3VR4A 4QNMA 1U98A 3RLFA 5JSZA 4TSFD 1GZSA 2IS4A 1RW4A 1OXUA 2PEZA 2WWIA 4BLPA 1P2VA 4IDPA 1RJ9A 1AS2A 2CDNA 5C4GB 3T12A 3BH6A 4OK5A 2CMKA 1CR4A 3SE0A 2EFCB 1JR6A 1KYIA 1N6HA 4QJ3A 1N0WA 5IF9A 1G6OA 1U0JA 2CCKA 4P4TA 2ZU0C 2QGZA 3PIRA 3MFYA 4JVMA 4RZXA 2OXCA 2OM2A 4GRAA 3P4XA 5EE0A 4EFMA 3I1FA 4NKRA 2VH5R 3IBYA 2H18A 1SVSA 1HYQA 1YRAA 2H17A 1NNEA 2PMKA 1LTQA 3NBXX 1OH8A 3B6EA 2ZSAA 4IEIA 1E9EA 4LCBA 3WYFA 4LJ4A 1FTSA 1SHKA 2NO9A 1NLZA 1LS6A 3IIMA 3JZAA 2H57A 2A5JA 4EQ6B 3IBGA 4RFSA 4IRUB 5ANRB 3K70B 1EFRA 3LRPA 5L3SB 3QENA 1GUAA 4M1TA 4B33A 1O87A 3QKUA 3WP1B 4AY2A 5DSZA 4NH0A 1NN3A 1MV5A 4GP7A 1UJ2A 3VHLB 1N6IA 3BE4A 2X8AA 3GJ6A 3Q8XB 4KVAA 2HV8A 3IHLA 3IO3A 1E9DA 1Z0IA 2VO1A 4ILEA 4R2IA 1B23P 2W0MA 1TF2A 4ZDJA 3GLHB 4ESHA 4QBGB 3FMFA 4KSCA 3T1QA 3WYGA 1QG4A 3J81k 3K09C 1G20E 3D31A 4W5WA 4XSHA 2MMGA 4FMCF 4AKGA 4TMKA 1XP8A 4CYMA 2W0SA 3QY0A 4RKFA 1ZUNB 5EP2A 3DZDA 4V02A 1S0UA 2H7VA 4XVRA 4ZIRB 1U8ZA 3PUVA 5BN4A 2RKOA 5KDDA 3WRYC 2QE7A 4DRZA 1NF3A 1RE0A 1Z6YA 3KKNA 3LV8A 3U7EB 2DFLA 4M1KA 4NCIA 4Q1CA 3RHFA 3ZS8A 2QSZA 4Q1AA 1FX0A 2ODNA 2A5DA 3THWA 1W36C 1M6NA 2IWHA 3GD7A 4UNQA 2OFOA 5KU1A 5TXGA 3AF4A 5KNDA 2ASEA 3RRNA 3CBQA 3T1VA 3THOA 1J8MF 2VSXA 1UBEA 2RGCA 2ZUCA 3QQ5A 1XEFA 3A58B 1EK0A 4HB3A 4C30A 3SU8A 3X1XA 1MO5A 4ARZB 4C0HA 3ONWA 1Q20A 4HAUA 2A78A 3H86A 5JI3E 2FSHA 3TBKA 1Z0FA 3UATA 4Z8XA 4A0GA 4L8GA 2ZR0A 1SXJB 1UDWA 3LBIA 1CTQA 2G1KA 1XXHE 1CJMA 4XSGA 4AYTA 4DWJA 4C7OB 2WIAA 2B8TA 2C9OA 4ITRC 2ZEJA 1G3QA 3OIUA 4CEHB 2AKYA 1T3HA 2OLJA 2FGKA 4IXMA 1V5WA 2QAJA 4EPYA 1W36D 1QHIA 3G5UA 3TIFA 1JXMA 1X8JA 2YJTD 1XDBA 2Y8EA 5B58C 4A2QA 2FZLA 2NOAA 2IEZA 3KTAB 3M4YA 4G1UC 3LQQA 3R9WA 1IM2A 2WWGA 5FTLA 3THYA 2FX3A 4JLPA 1COWA 4MYCA 3W8RA 5AUNB 2OO7A 3GLHE 2FV8A 3K8YA 1OXXK 1KZGB 3RS0A 1PV4A 1BIFA 4PQRA 3AVYA 4NYIQ 3U6BA 2EFDB 1EFCA 4IJMA 2I1VB 4YLGA 1SZPA 5DI9A 1NMYA 4OYHA 3X1WA 2FFQA 4JLNA 4TYWA 3LFUA 2A2ZA 4JYBA 4V03A 2Z0MA 1WE2A 4EAQA 2XEXA 1N6PA 1TNDA 4RD1A 4LX0A 1CIPA 1M2OB 2C9YA 1U8YA 1WRBA 5EP4A 5KSYA 1VCNA 1W4CA 3AB3A 1TMKA 4TQ9A 5M04A 3B85A 4KODA 1KSGA 5K8UA 3U7FB 2GXAA 1PVOA 2PLFA 2OE2A 1ODFA 1OYWA 5J4YA 1P2SA 1CP2A 4AK9A 4U00A 1KDPA 2D2FA 4OI2A 4DLXA 2B7BA 4KBFA 1S96A 1XXHB 1EWRA 4JBWA 4KSBA 2VA8A 2O8BB 4RZ2A 5AWFC 1SVIA 2ZQ5A 2QE7D 2GNOA 3SJZA 3SHFA 4DEYA 4Q19A 4TYYA 1DEKA 5C46F 4HUTA 1GNPA 4KLNA 3W90A 4WA7A 4BFWA 1TTTA 2RHMA 3BERA 3EZ6A 2EFEB 5TB5A 3ZQ6A 5J4LA 2JAQA 1GITA 1VG8A 5GJVC 3E2IA 4GNKA 1Z29A 2GXUA 3AV0B 4CGZA 5AJWA 1FPMA 5TV2A 1KI3A 1YHNA 2E87A 3L43A 1R6BX 1TEVA 2ORVA 4OQMA 1VIAA 4URYR 1RZ3A 4E5UA 4BLSA 4A6XA 1RPZA 1F2TB 1U8AA 1AKYA 2OCAA 4MITA 3B2EA 4LDJA 5EXPA 4DB2A 4OK3A 1KJZA 1GFIA 2NO0A 3Q7PA 1Z0JA 3TVDA 4LJ6A 3QBVA 3MLEA 3IIKA 1YZKA 3PV0A 4JLDA 3GLIA 2JLQA 3EPJA 4Q7MB 1SXJC 4L9WA 1MABB 1OFHA 2ZXUA 1NLFA 4I1SA 1FUUA 3RC3A 4F4JA 3TUZC 2BMDA 4IDNA 5AUPB 5DH9A 3LLUA 4KV9A 4DUGA 5LB4A 3T5DA 1Q0UA 2V1XA 5CDFE 1DO2A 1L2TA 1ZYUA 1YZQA 3BK7A 4E07A 1DADA 1N3BA 4V0KA 1XPOA 5JWHA 2WJYA 2HT6A 2A5GA 2AR7A 4PO9A 1T0JB 4TMTA 4B6EA 1IN5A 2ZRLA 2OHFA 5KDOA 1YKSA 3AVVA 3MWJA 2WWFA 3AVTA 4R7ZA 4PC1A 4XD7A 4NPHA 5J4HA 1L4UA 1ZD9A 4IDQA 3ICQB 1Z0DA 5BN5A 4MDFA 2ZIAA 2QORA 1E4YA 2QMUA 5FOUA 5IHPA 3SQXA 1ESNA 5CIWA 1QHHB 2B92A 2GCPA 1OPXA 2WKRA 2YWEA 1SGWA 4DLRA 3ZVRA 3K53A 1OW3B 3PUZA 1JPNA 1NJFA 3CZPA 1E0AA 2OBMA 1P2UA 1GIAA 2EYUA 3ZQJA 2GK6A 5JJLA 2ZJZA 1CXZA 3EC1A 2UKDA 3B82A 3E70C 3RS3A 4BLRA 2WAXA 3QSYA 1I4DD 1T8UA 2G6BA 4N0EA 3BH7A 4KLZA 2F3TA 2IYUA 3B13B 1D6JA 3AEZA 2RGGA 1AJEA 1XEWY 2QBYB 3H0KA 2LKDA 2AX4A 2F7SA 4FN5A 4B2PA 4AI6A 1TAGA 5FR1A 4PSVA 4TL9A 5TY0A 1Q1QA 1Q21A 3ZS9A 2D7DA 1M8PA 5CYPA 5FUYA 4YMVA 3GCGA 4KBGA 1PLLA 4DBLC 4LJAA 2VIIA 3K9NA 3TSZA 4F7WA 3O8CA 5KPDA 2VF8A 3B1XA 4H9GA 2HYDA 4URXR 2GZDA 4LBZA 3NIBA 2E9SA 4US1R 2WMOB 3H1TA 3SJBA 1FQJA 2GJSA 1KDRA 1TF7A 2D74A 2G83A 4YQFA 3TAHA 3BRWD 4MGZR 1D2NA 1JNYA 1TQ4A 2FSFA 4KYUA 1GSIA 4Q1BA 4DDTA 1E94E 3QXXA 4DT1B 2O8FB 1DOAA 4QL3A 1UAAA 3CH5A 1JALA 3OEEA 4RZUA 4ACBA 1G7TA 1OFUX 4PPQA 2WOJA 2BBOA 1NL3A 1J7KA 3LA6A 2JJ2D 2ZRJA 3ADKA 4HAYA 2CK3A 3TK1A 3PITA 1A1VA 2X1VA 4C0LA 1KZ7B 4LGMA 3U44B 4URZR 1E2EA 1OHHD 4PO8A 5EP1A 2ZYTX 2KSQA 4ZKEA 4P31A 1HY3A 1W5SA 2ZRHA 4QC2A 2EWVA 1AM4D 1EFTA 2JLUA 1XRJA 4NTZA 4DSNA 4M22A 2FFHA 3SJAA 1G18A 2H16A 1NVVQ 5JHGB 2QL6A 1FX0B 4V0OA 4URVR 3ADBA 1ZU5A 3AM1A 1F60A 1YR8A 2R65A 1YR6A 1UKYA 4UJ3A 1KMQA 4A36A 1R0WA 3A1SA 2VTKA 4M9ZA 2H8KA 3QKRB 2ZITA 3WYAA 1HURA 2ZRMA 2WSSD 1CJTC 2D62A 3B5JA 1KI8A 1Z5ZA 4JVLA 4ARZA 1Z08A 1CS4C 2WV9A 1YE8A 4IVPA 1W47A 1CLUA 4D0GA 3L82B 4QBFA 3GLFB 2VPPA 1H8ED 1W2HA 4ZCLA 4IW3B 4TMVA 3CO5A 1XF9A 1WCV1 4O25A 1E9FA 4CRWB 4D82A 621PA 4YMSA 1P6XA 4RCZA 3K70C 3R7WA 3LX8A 3W9YA 1TU4A 3CNOA 1M7BA 2AL7A 1ANKA 5CIQA 1D2EA 2IYQA 1MKYA 5IRCD 4G5QA 2FU5C 5JEEA 1XU4A 4HLUA 2QGNA 1ZVQA 4TLDA
chains in the Genus database with same CATH superfamily
2LIPA 3PGJA 4KQCA 2BH2A 5CMLA 3QU4A 5JSYA 2X2OA 3QLEA 2GH1A 4UARA 3SSOA 3O95A 1U0SY 2PKYX 1V9SA 4URFA 4B71A 5CM8B 3V1UA 2XAUA 4XGNA 4AXBA 4CV2A 4C5BA 2BDEA 2VSQA 5T67A 1IN4A 4O4HA 3K5WA 3PPYA 2QG9A 3B1FA 2QZ4A 2ZUVA 2YVUA 1YFKA 1W19A 4WBXC 1NF8A 3S28A 2WIBA 2VP9A 1L5GB 4BUZA 2BWJA 3G0HA 1W85B 1PTJA 2ZTSA 1YR1A 2JI8A 3S8EA 2IV3A 2GUGA 2J67A 4ZZ2A 5F4BA 4ALMA 2B5VA 1Y1QA 4RKYA 4XR4A 5ADHA 2ID8A 3AUTA 5AM3A 1G21B 1A27A 2KQUA 2GMWA 3L8HA 2ZRGA 4GLFA 4B76A 2FSVA 1JJIA 4D3SA 2YVAA 3BE6A 3QFHA 1Q92A 1XZKA 4IINA 4UUBA 4TZ0A 2BFEA 2VJQA 2FPSA 3PS9A 5B1YA 3ESZA 3HO6A 3ADDA 4GW3A 2P27A 3IULA 3I9LA 3QG5A 4K3VA 3ZDQA 3OLWA 4TX1A 2QJOA 3FI0A 5DGCA 1GNRA 4DHEA 3PFIA 1FNMA 5A0VA 1KL7A 3BGIA 2ZPTX 4LYDA 2P79A 1K5HA 3L0SA 3H5RA 4REOA 1PJQA 2QDXA 3ZJUA 4GOXA 1KNXA 3UG7A 1YKFA 1Z7YA 2B0CA 3CH6A 4FKBA 1L7DA 3R9IA 3REGA 3GBVA 2OBLA 2HJWA 4V38A 5HW0A 2FUCA 2QPLA 2V58A 5DI3A 3VR6A 2G5TA 5KYUB 1S9DA 2I2CA 2WFZA 5LLTA 3RBVA 2DOKA 3LOUA 3O2NA 2FQYA 4YR9A 1AMUA 1W0JA 1J2JA 2P4EA 2O7SA 3TMYA 1VMEA 2PX0A 4CMBA 4DDKA 2G0TA 5E6SB 3WRXA 1XCPA 2Q3CA 1WW2A 3D0RA 4HZUB 3N7TA 3OE5A 1A0OA 2YMPA 2QAIA 1GKLA 4EGQA 1JEDA 2QTAA 3CCBA 5I4CA 2DSTA 1W73A 3FX2A 1CUIA 1QX4A 2HIGA 2ZOSA 3F47A 4HAZA 4I4NA 4IDAA 3T5GA 1ULUA 2CYCA 2ZBRA 3HNPA 5D3QA 2C78A 2J7KA 4EW3A 2ZSFA 1JYEA 3T3GA 6REQB 1GQYA 3CRW1 1C9YA 2CSXA 3SF0A 4HUQB 4KQEA 3ZCUA 4GSKA 4WRRA 3E1GA 4O4LA 2J9YB 3IERA 3O2JA 2VFAA 4FIDA 3VR2A 3KLBA 3RS9A 3VTZA 5BSHA 1UPCA 2AMLA 5EHNA 4RVOA 3E05A 3T95A 3I6QA 2QSJA 4RORA 3RS4A 3FWHA 2XADA 5LP6F 4MRAA 4KQIA 1CRWG 3FA2A 3VKUA 1BDHA 1XRNA 4HZIA 2BZ1A 1PI3A 2OPBA 3Q3JB 4NV3A 1NM5C 2PH7A 4R0NA 3ZDRA 2J3EA 1P1CA 4NMLA 1U3CA 1T0UA 3B1VA 2EEZA 2FR0A 1OWMA 1JLMA 4TXLA 2DYKA 3I05A 3WL3A 3ZK9A 4UVIA 1Q83A 4DMUB 2X2PA 3L06A 1JQDA 4KR6A 4BNJA 3CT4A 4UNIA 3WRYA 1X1BA 2Y66A 3JAKA 4EO7A 4DLKA 3FWZA 4CDMA 2XKJE 3U3DA 1V2HE 4IF6A 2QUZA 4PPNA 3TEFA 3ZU5A 1L6RA 3KLNA 4DLNA 3GQVA 4HNAB 4MAFA 2ZSDA 4R2XA 1C0LA 1RE1A 5KOJB 2J6BA 3GI1A 521PA 1NW8A 5CYGA 5DOZA 5J43A 2NV2B 5CUQA 3H2KA 1P0CA 3CZ9A 4KGZA 2R84A 3SZ3A 2QMQA 3ZDFA 3PQ6A 1BGVA 2PX3A 4ZKDA 5HPYB 3DZGA 3OQOA 1GT6A 3IKLA 3UH1A 4IJQA 4R54A 3OQBA 4FWTA 2H00A 1CJVC 1M1XB 3VAAA 3VU8A 2IH4A 3R8CA 2JI4A 2QVCA 1EESA 1I36A 2L19A 2G8NA 4Y7DA 3WSVA 4Z4CA 1QV6A 4FTWA 3VU0A 1T35A 3EQ8A 4BCDA 1VTKA 4MK4A 3NTUA 1O89A 1ZOIA 4Y6LA 1SVKA 4JC4A 2QQ0A 4GI1A 3N2IA 3UOWA 1JLKA 1DQNA 2HPHA 4BFSA 3FPBA 1B1CA 1D1SA 3LGXA 3VX4A 2J85A 2OENG 1ISRA 4BHTA 1P62B 5LA6B 1P81A 5BOVA 3O7MA 2H0QA 2MJLA 4QQ8A 4DCUA 3IX7A 1C9JA 3RYIA 4CL0A 4DZRA 4MQ4A 3A4TA 4PZPA 5EWMA 3QXHA 3B5IA 3H5AA 1G8AA 1VLLA 1GRNA 4N5IX 1LVHA 3F3KA 4TSRA 1RZUA 1XLVA 3II6X 3BAFA 3DFUA 2CUZA 5E0OA 2NPFA 2TSYB 2CD7A 2FZGA 1P5ZB 4C7MA 3PXGA 1P0IA 3IUNA 1K27A 2CCGA 3IPCA 1QHSA 5JC1A 3I9MA 2B1JA 3PTZA 4X45A 4QELA 4AY4A 1YCGA 2W2VA 3R3UA 1RKXA 1CR1A 2FVYA 4WLUA 4ZI5A 1JEQB 4F3TA 4FDAA 1EX6A 3O4RA 3QMPA 1K88A 2PVPA 5CNJA 2X4LA 2FMKA 2JLRA 3KXLA 4G0NA 2N3ZA 5IKXA 2QL9A 2ZBVA 3BHJA 4S3MA 4E12A 2BGIA 3L6DA 3HU3A 1SC3A 2BGTA 3WYNA 3OTHA 4GUDA 4PIPA 3NP7A 1KK1A 4ML3A 1JSXA 3SKVA 4FLMA 1SHZA 3DDOA 1BOOA 3L9WA 2FEWB 1ZCFA 2WVJA 4WT7A 4UW9A 4E13A 1PCXA 3E5HA 3E5MA 2J31A 3M4ZA 1IOVA 4FHGA 1JDTA 4Y30A 3E22A 2GESA 2H7YA 3PCTA 2IP1A 4QU9A 2CL7X 2HLHA 2I7CA 2D06A 1FXSA 3N70A 1QF6A 3QYJA 1VIYA 1OQAA 4BFLA 3OWHA 4MO2A 4W7HA 4EWLA 2K7ZA 1LLFA 3EQZA 1LJ8A 3MCUA 2Q6OA 4FCTA 5DGHA 1LGYA 1R1DA 3W8FA 5J2UA 1C9NA 4BRZA 3L4JA 2HRDA 2X3UA 2QAGA 2DUMA 2RGAA 2PGJA 4KP7A 1LJLA 1QV9A 2PLRA 10MHA 3TLYA 1DEHA 4BX3A 5JYBA 2QLJA 5ESDA 2AYXA 2NZVG 3ANYB 1R0BA 4OH1A 1SZCA 3VO8A 4BRWA 3O5AA 2CLLB 1F48A 5ECWA 2CLIB 4CHGA 3C8MA 2YWCA 4E94A 1N36B 5A2QA 5HS6A 1P1RA 1J5XA 2ZT6A 3OH8A 5J2TF 2B98A 3SC3A 5IZCA 4ABYA 1WUTA 1J0XO 1KYWA 3WRXC 4DCCA 4RL6A 4O1MA 1PL6A 1BN7A 4EJSC 5AQ1A 1A5ZA 1FMJA 2JH3A 3TLGA 5AJHA 2PD4A 2Q2NA 5JH7A 2FZCA 2OD9A 1E1QD 3ESXA 3R0XA 4PRZA 4M1SA 4BJ3A 4X6YA 2FJUA 3RUHA 3OWXA 2O9JA 4HLQB 5DHAA 1ZLXA 3UF0A 4IFEA 4JBXA 1JDZA 3WIUA 2QK4A 2HT1A 3QVSA 4L5YA 2B25A 1NONA 3TQRA 1LDYA 1JG1A 3LQYA 3MGCA 2C5BA 3FZEA 3QW4B 4Q3LA 5JNWA 2XX3A 3P0EA 5AW2A 3AF0A 2WD7B 1FLVA 3U3OA 2Q28A 4NECA 2E89A 4NEQA 3OHMA 1M74A 1GUDA 1QZTA 2Y99A 3DO5A 5DWQA 3BDAA 1ZI8A 5D5HA 1GZVA 1ZRMA 3MB8A 4ZPXA 4ZT3A 2E18A 3MTIA 2QF7A 4D4MA 4CCAA 5F77A 4HVAA 3BK1A 4M0LA 2C54A 4XWYA 1QRRA 3FLBA 5CVTA 4PZ0A 1SVUA 5KTOA 2DY1A 1JI0A 1JMVA 3ZXXA 4N9WA 1UOOA 2P9ZA 2FMIA 1R10A 4GI3A 4OXQA 4EVRA 4CIBA 1XZIA 1UDCA 4S1NA 1E1RD 4W8GA 4HLCA 4PS0A 4AG6A 4BBAA 1T5BA 3TG8A 4UUPA 3ZWPA 3R7BA 2YWBA 1V3QE 3RWMB 3VOTA 4BQQA 2IH2A 1PV2A 2HUNA 1VYVA 1H4QA 4DBZA 2FB9A 4YP6A 1Y1KE 4OQEA 2GN6A 4AC9A 4FQ5A 3AIIA 3SY8A 5HYVA 1JZTA 4AECA 4ENQA 4XOIA 2KWIA 2OCPA 3R40A 2P9GA 3KHUA 4MAMA 3SQOA 4XX0B 4XIFA 4HGQA 2QN6A 5JCPA 4H3HB 4N3GA 4RZIA 5AI8A 5K0TA 3SLGA 1GL6A 3LO5A 1T1JA 1I5EA 2XMGA 3I04M 3KC2A 3NWPA 3FFBA 5DLYA 4B6QA 5BPHA 1VXOA 3N8DA 1F7VA 1EUQA 1IAVA 1E1LA 4L07A 2JFQA 4ZODA 1Q5PA 2VBGA 1N7IA 4QRHA 5DX0A 2HW8A 2AJDA 2I8LA 2C5FA 2ZTUA 1CR0A 4R1UA 5FQNA 2PGOA 3P9IA 1PU2A 1K7XB 2CE7A 2H31A 2PKQO 2V6JA 2FPOA 2XNDD 5CA0F 3LUFA 1VRCA 2W43A 4OHBA 3FNQA 3MS4A 4IMRA 1YJCA 1G2OA 1XGKA 2HQRA 4DANA 1R6AA 4EELA 1JEYA 1P0QA 5DWDA 3TL6A 3B52X 3RC7A 1STOA 2AG6A 3GMIA 2ZR8A 3NBYC 3R5FA 4ENWA 5JNRA 3QVLA 2WE8A 3TR6A 3CNNA 3RYCA 3IP9A 4M53A 4EQZA 4C0JA 1GZ7A 4G36A 3R3VA 3R0ZA 3KPWA 2PX2A 1J1IA 1RWMA 4DLUA 3HRIA 1FF9A 1MT0A 3CNHA 1K63A 3M6WA 1V11A 1PK8A 5BVHA 1FVOA 4YAIA 3K9HA 1DRVA 4Q12A 3MQ4A 1YBHA 4FNMA 2JGLA 4A91A 3PEYA 2FPUA 3EGIA 3H05A 4O33A 2ZVQX 3C5CA 3VZSA 4Z0TA 2JI6A 2P9TA 3HWX1 1TT5B 3SEFA 3G9UA 3CVWA 3KD3A 1NT2A 2RG7A 3UAXA 4C06A 2YFKA 4BCBA 1JDNA 2P3QA 3AWIA 1SCAA 3F0TA 3WGOA 3BZWA 3OETA 3COYA 4CM4A 4E4YA 2BONA 3C41J 4G67A 5F35A 5TQVA 2QRQA 1XQXA 2V9CA 1QJ4A 2QMZA 4PANA 3CPJB 5A05A 3KZOA 1MVLA 3OKPA 5CH5A 4ADSG 1NSFA 1WCIA 1X92A 5DI3B 5AW8A 5IULC 3KOOA 4TKVB 5EJ7A 5F23A 1HLFA 1RYDA 1C7QA 5IH7A 1Z39A 2AC2A 5C7IO 2AN3A 1GPKA 1KP3A 2O8CB 4WBNB 2GERA 2VDKB 3VQTA 1BS1A 5K8TA 3LVQE 1FC0A 4P3XA 4P7FA 1V7QA 3AHJA 1JJBA 2ODEA 3AR2A 4BC0A 4PAOA 1L5SA 1YB6A 4GHWA 2JFZA 5FPSA 3KJQA 1XZPA 1Z0UA 1C30A 4TRRA 1RJEA 4MPJA 2YW9A 4D2IA 3ZK8A 3BTUA 3GB9A 4Q0MA 1TVMA 2BFBB 4YR7A 2NPIA 3NOXA 2DFDA 2OYRA 5KTSA 1QGOA 2JGEA 3OZXA 3OKFA 4WBSA 3R7WB 3E9DA 3RVJA 3OLYA 5A0FA 3RS8A 4C2AA 3CB2A 2JI7A 2QX8A 2IY8A 3RKUA 2E4AA 2X86A 2HA5A 1J24A 3KG2A 3I6YA 4M9XA 1SWVA 3UK6A 1CNMA 1IDN1 1QZ3A 2OFPA 4JLOA 4TKLA 1US8A 1KO8A 1OKKD 1Y8RA 3G23A 1UMCA 3AESB 5JCJD 1TVKA 3H9JA 2JIZA 1KYZA 3LW8A 4RCVA 3OT4A 4ICIA 1I7SB 2VRWA 1AGYA 2J6IA 1UK8A 2X2EA 4P80A 2QI9F 4YCNA 1T4GA 3PRJA 5IKPA 1E58A 4L7QA 2WJIA 1PZEA 1MDBA 2ZTHA 1G8YA 3DMHA 1A5TA 2QNRA 4K8RB 2Y2UA 3DH0A 3RC2A 3VR4H 3AJ9A 3L0YA 4B44A 2WTUA 1G8JA 1TO2E 4R69A 1BEZA 3BILA 1Y7HA 1EVJA 4RSRA 1YQGA 1TM1E 1ZOSA 3Q7QA 4O2AA 3BSFA 5JXHA 5HZHA 2EL9A 4G5SA 1KQFA 3P0IA 3OFNA 4EHBA 4UAGA 1JKMA 7GPBA 3O0DA 2G1PA 1ZGCA 1NSTA 2GPWA 4WXPA 4DPLA 5JWOA 2W2KA 3RYFA 1G38A 1YZLA 2ZJYA 1V8OA 5DYNA 3GFGA 1N77A 1NZJA 2ZAOA 5CA0A 4X6LA 2P2LA 2XT0A 5SICE 4FM9A 2EKQA 2OT3B 4HCJA 2NW6A 1DEOA 4IKOA 4MW5A 4OX9B 2W90A 1SHUX 1ZO8A 4J29A 2EFGA 5CJ2A 6ADHA 2JDIA 3KBOA 1U7OA 1HZZC 4LI0A 2GPSA 3KYBA 5A3VA 1SH7A 2VP2A 1DELA 1VJTA 5HFNA 4X64B 1YS2X 4EYOA 1G6KA 3PXXA 3M83A 3ZH2A 3X1YA 1VG1A 2CNLA 3GMSA 1H5UA 1IEVA 2QMOA 2OHIA 3DMTC 4IQ8A 4EW1A 5MN6A 5A4JA 2DHQA 1YNOA 1KHHA 1KYXA 4FI3F 2J0SA 2FWNA 4M9RA 4MVJA 1BKSB 1E3LA 2CBXA 3P9YA 4Y2QA 1P7PA 1I2AA 3GBSA 1XSEA 3PQ4A 4N39A 1DIHA 3N07A 2D13A 3GFPA 4LUCA 4XGKA 3ZDAA 3O8RA 1SVOA 5JAIA 4BP9A 1ADCA 3OTQA 2EXXA 5H5JA 1DWUA 3I2GA 4DA0A 2QP3A 4M1MA 3FRJA 3TRKA 1E0KA 4W63A 2WUVA 2A1TR 2ZYGA 4L4ZA 5TQ2B 3RREA 2SECE 3C2QA 4DSUA 1B3BA 4ETNA 2BGGA 4OKSA 1F2UA 4IDDA 2AKEA 2PRKA 4I9HA 3AUUA 1COZA 2JIPA 3FYUC 3FMPB 4I4TB 3S3TA 4DR6B 4LWPA 1QMPA 2EP5A 2KPOA 3LZDA 4GMGA 3JZFA 1C1XB 5KX5F 4CNQA 4JLVA 4ARCA 4HXGA 5DM0A 1WPXA 1SBCA 3UJ6A 5HZGA 1DOZA 4KPUB 4CDGA 1YI1A 1OBFO 2EX0A 2ZI7A 1LK5A 2XNSA 4OO3A 4RVDA 1BGXT 2JD0A 1NN1A 2X22A 3EGWA 3DFFA 3AETB 5KSZA 4K9KA 1EHCA 4OHPA 1SY7A 4O63O 1QGUA 1P7WA 3V4VB 3FLEA 1TIBA 3B70A 3LPMA 5ECGC 4YRRA 3WK5A 1WDTA 3HEAA 2J8ZA 1D2MA 3PVSA 5ICFA 1LPMA 2PUAA 3RGGA 1EYZA 3CF2A 4ZZIA 1OXVA 5JH7F 3PQ7A 3SP1A 1LNSA 5LNK1 4KR2A 1LQTA 1YR7A 3EBPA 3NYRA 1Q0SA 5A6SB 4CMIB 1Z7BA 1JEEA 3DEAA 1EK5A 1YD7A 3RVDA 3ZR4B 2E1PA 4AJ9A 4ZGBA 5BN1A 3CF4G 3HA7A 4G5OA 3KR9A 1G64A 3TLCA 1RAHA 2H1IA 5CB0A 3F78A 4IMJB 4U2DA 1NI5A 1XZCA 3D5QA 3IJ5A 4POAA 3QBDA 4WZBA 4FE3A 2P4SA 4I14A 4CMCA 4X00A 4F9FA 2OKGA 1FFGA 1H0RA 3W0LB 1T5DX 4L8LA 2V65A 2E6KA 4L4SA 1LF0A 1X7GA 3BFKA 4RZ3A 1I2BA 2OGTA 1VZ2A 2R8OA 4HG2A 4C03A 1KMHB 1Z7GA 1VG9B 2JFFA 3QWHA 1AU9A 1GV1A 1Q7BA 3SHOA 3PIIA 4A2CA 3QXGA 4QGSA 4I1IA 4RBNA 4AMVA 4BE4A 2GCEA 1ZRSA 2EL7A 2B99A 2DGDA 1Z5WA 3IBCA 4HB4A 1UJNA 3GMTA 3VSAA 4KZKA 4E08A 1NHWA 1VSTA 3UWPA 1XNGA 1SXGA 2R87A 3WGNA 1KWKA 1IOWA 1UJCA 4Z8YA 3S0JA 2G5CA 3M9WA 4AIIA 3PD1A 1HPLA 1T36B 4CJXA 1SCKA 3ORQA 5AW4A 4RM3A 2HU8A 5L9AA 2DF8A 4DMCA 2PX5A 1CERA 4YO8A 4YRFA 1FS5A 2DR3A 2NTEA 4Z6KA 1BXRB 4K9SA 2X9LA 2FNAA 1QB8A 1VECA 3I8SA 2VJAA 4HDQB 4U3JA 5JCOA 5LYYA 1GDDA 5DVZA 1B41A 2ZROA 4H1WA 2PQ6A 2L82A 3LP6A 4CMGA 1P5JA 2J0VA 2OAEA 1TVEA 1QHXA 5CGQB 5PGMA 1K5PA 3C1OA 1DXHA 3BD6A 4DSOA 1IY2A 4HAWA 2XR1A 4Q7JB 4M76B 5K0CA 1QK4A 1PQYA 5HUQA 1RRKA 4L72A 1OIVA 3M4NA 3O91A 5BYKA 2KYRA 1AKTA 2IC5A 2I4IA 1N34B 1DUSA 2W4IA 3EZ7A 2E3JA 3ZVLA 1B0AA 3UPUA 3GAAA 1NA5A 5DV9A 2Q62A 1DGQA 3BFVA 1BX0A 2ZSUA 4BL5A 2GD2A 4R1SA 4DDVA 2AOVA 4K26A 1E6LA 4BLTA 5JHHB 1YA4A 3PWTA 1AKRA 1PS8A 2JLCA 2VAMA 5JFOA 1OC2A 3OOSA 4C04A 5KTKA 2B61A 5TS2A 1JQ3A 2VT7A 3TSWA 1WQ1R 1TMOA 3K0FA 1CZLA 2X1MA 1DC4A 1HETA 5JS8A 1KYTA 1WMSA 3PQCA 3MYYA 3LRXA 2EP8A 2VTBA 1OGIA 4RIGA 4RVCA 1E2FA 3SQMA 4F4DA 1CY2A 1ZGZA 2GBCA 3AIMA 1T8SA 2J08A 3Q6NA 4OAQA 1H23A 4KNWA 1WXGA 1RWVA 2F2TA 4GOKA 4DLWA 1YK1A 3HJCA 3H5LA 4GLOA 2WU4A 3F2IA 4MKHA 4TWIA 1HT3A 3BB4A 3JVEA 4ZVNA 2DU8A 3DNFA 4ES6A 1UJ6A 2HF8A 4AO7A 4CM9D 2GPBA 1QK3A 2H4YA 1NBIA 2IZOA 3SYKA 6Q21A 2FETA 1Y34E 1L7VC 3F90A 3IQDB 4DL9A 2PYZA 3P9ZA 4OGKA 2FEMA 5JECA 3U37A 5DSXA 3Q10A 3RSHA 5I7RA 3VJKA 3ZU2A 4K6HA 3WG9A 1FUYB 1MC5A 4X7BA 1L7RA 3U56A 4D25A 3JALA 1YQDA 1RMQA 3IOYA 3KEGA 4O4HB 121PA 4QGHA 1Y6ZA 2ZIXA 4RQUA 4XQ9A 5CM2Z 1L7EA 3ZIAA 4BJHB 4GKKB 1TMGE 2UUAB 3HXTA 2ZE7A 2PYDA 3DHYA 5DBEX 4NFHA 3JYPA 5BVHB 3RIHA 3OM1A 2C8VA 1DQRA 2ZIUB 3K8ZA 1VMAA 1JIXA 4AJKA 1FP4B 1OX4B 2XEDA 1JA0A 3AXTA 2ZYRA 2ZUUA 2IBSA 1YZTA 4BEJA 3WGVA 3HN2A 2ORED 3IOMA 4DHWA 1KVRA 3LI2A 2OBXA 3PI7A 3QF4A 1F06A 3U5TA 3VKVA 4A92A 1EXMA 2Y1OA 3PXDA 3PX2A 5AI9A 2QQGA 5DLPA 2HL6A 2QR2A 2R97A 1Z45A 3BQ9A 3O3MB 3KVNA 4GG1A 4QJ5A 2A9KA 2C82A 1YH3A 2OY0A 3HCPA 4MOWA 5JI2E 5BUCA 3EVBA 1UINA 2WNHA 5B64A 2IHBA 3FOFC 5JASA 3L77A 1E8MA 3RFXA 2ZXFA 3IKJA 2HNBA 1F6DA 2O07A 1K98A 2QRLA 2Q21A 1LX6A 4LYFA 1V37A 3I73A 1DUVG 1KFEB 3MSCA 4PG6A 4AJJA 3DFKA 4HPWA 2IPOA 2JJ8A 3E23A 5G0VA 3CNBA 2GBLA 2Q41A 3BXHA 3OAAA 3A1EA 4MWCA 4AU1A 4ZCRA 1EFAA 1PW5A 4EDFA 1YJQA 4EI2A 1LBEA 2H4HA 3F4BA 1W4LA 1CDZA 3PTLA 5CLLA 3VNSA 1V9LA 1YRBA 2CK3D 1MVNA 4NCJA 5JAZA 3NDRA 4LHEA 1KVTA 1Q50A 4PHGA 4XX0A 5FD8A 5FTMA 4ER6A 1RWNA 5FV7A 4DBLE 1S4QA 3PFWO 1QR2A 5GJBA 1EE1A 2X9VA 2R25B 5LZ4A 2ODTX 1AT1A 3MC1A 3CQ9A 1JFTA 4E88A 1ZIYA 4OAPA 2WMDA 4X7MA 1HR0B 3M5DA 2QM0A 3HCRA 4LECA 3N2ZB 1WEHA 3R24A 4FSXA 5CA1B 2W48A 1GP2A 5ICEA 2G0NA 2B7CA 1K9VF 1LRKA 3IPRA 2DAPA 4DVGA 1XJWA 4HQRA 1YI8A 2GAJA 3D81A 3FRIA 4JT4A 1I3OA 2XUGA 3LVFO 4KVGA 4CQMA 1EP9A 3G82C 3PR1A 3DD1A 3NHPA 1H66A 4R8MA 1JDSA 3J7TA 4DUZB 5EHXA 1H1LA 1SVWA 2IHJA 2IXAA 4Q4LA 5TVKA 4BMXA 3EXG2 2DEUA 2PUDA 1P60A 2HK9A 2IU4A 2FWPA 2JZNA 4D56A 2GPNA 2OESA 3NM5A 4U6QA 5HFJA 4BZQA 4NG4A 3WB2A 1NAIA 2YXPX 3C98A 1SU4A 2VDJA 3B7PA 4YRQA 3V42A 1WDKA 2BR4A 4AFNA 1VE3A 4YJHA 2CF6A 2EKDA 3CLSD 2AW3A 3D0QA 4BZWA 2WYUA 4F06A 2ZM5A 2ZDGA 4WAUA 5ED4A 3A1CA 4QUBA 1C7IA 3FUVA 4DTCA 3BBLA 3HKDB 2ZM6B 3G85A 3CNLA 4NHEA 1KR5A 3OUUA 3ADCA 2CZCA 4FYIA 4ZVPA 2ZE5A 1DRUA 4LAFA 1DAMA 3AU9A 4LGVA 5DN6D 3MWKA 2NO6A 4TYMA 5AKYA 3EMDA 3L7NA 2E55A 2FW6A 4UBNA 3DBRB 1C3OB 1IZZA 1P18A 3GLVA 3M70A 3ASVA 1RPNA 4C87A 4WKCA 1ESMA 5T41A 4OATA 4A0HA 4C0SA 4EAQA 3IUQA 5JNLA 3PEEA 1QF7A 3EJWA 3KE8A 4WK2B 5I5GA 5E9JA 1HKHA 3CWCA 1WCIB 2B20A 2CZGA 2HWUA 3D8RA 2PZEA 3NATA 4I4IA 2ZRIA 5IAJA 5SV2A 5H0IA 4CV3A 4EJFA 5A4FS 1OIWA 1OAKA 3EGDB 3MT9A 3K0CC 4PGGA 1KRXA 1LBSA 1XJ0A 1ZHOA 5A5GA 4Z2YA 3ZW8A 1PVVA 1EK1A 4B9EA 3RIEA 3N39C 2HAEA 4CKBB 2QLNA 5I4IA 1QS0A 4MLZA 3TOZA 4DDHA 2G9UA 4YJGA 3QLJA 3KAQA 3PCRB 4E03A 1I6KA 2BH9A 2OAQ1 1F1BA 3JWGA 3TM5A 2AIRA 2DSNA 1FFAA 3UUGA 4DSTA 1GZHB 3CRMA 3IEXA 1O94A 2IYTA 1WEKA 1HE2A 1ZIOA 3LHIA 1NQOA 3MAAC 5BR7A 5JXWA 2XOKA 3U4QA 4S1TA 3C5HA 3G2LA 4JYMA 3H17A 1NC3A 2HSGA 5LZ7A 2CVFA 1VM6A 3TZQA 1ZOOA 5EWMB 3KT0A 5DDIP 1OC4A 2X9QA 4E5MA 4HLNA 1PNVA 2ACWA 2AFIE 4YJDA 5EGNA 4D98A 4IKEA 1FNBA 1L4KA 2FSGA 3HYCA 1EHYA 5CBPB 2ILTA 5IDXA 3OQJA 3MJVA 5TF0A 1Z26A 1BHSA 2FH5B 4LXGA 2L2QA 3FZYA 4OM7A 2ZS9A 2FE1A 4RC9A 2DPLA 2FA9A 2WU0A 1HFKA 4OLBA 1VRWA 2J1LA 3B38A 4MVXA 3THXB 2A88A 3CU5A 3QXSA 2G88A 2NXEA 5DXFA 3UMFA 2R1VB 1GQQA 4JEHA 4PTZA 4KK4A 1P72A 1LB1B 1RAEA 2D2EA 4PLGA 1K7CA 2QSYA 1N5IA 4R1LA 4KXVA 3RVLA 4OXXA 3V4RA 5CXQA 4RJIA 2O5EA 1BCSA 5E7MA 1LWNA 3WHLA 4B82A 3DQQA 4KR7A 2BFCB 3ZWCA 1YFJA 3HBLA 1IY9A 4ER0A 3WZMA 1FS4A 2GJ9A 4BQIA 4F0JA 4LXQA 1E2LA 3QUQA 1FXWF 4XVQA 3QTTA 3WNBA 1SXJE 4RL4A 2OZLA 5DYIA 3OT1B 3WKDA 2PTHA 3GFSA 1X70A 5CX4A 2DWPA 2G5PA 5CDYA 4YDQA 1R88A 1U0EA 5J2UB 1PQUA 4HWTA 2BAGA 4CF6A 2EHJA 3F4KA 2QTFA 2W00A 4AULA 3Q7EA 4URWR 3CSUA 4DCTA 5HOQA 3N8KA 3H4MA 4IX1A 4LBVA 1DTWB 1FRFS 4QUDA 5CGZA 5DXJA 4K03A 4R31A 4D0NA 1ID8A 1EMDA 2ZRFA 3NORA 3P26A 2GZAA 3NAQA 1XCJA 4W9MC 3TTWA 3GNQA 5EMLA 3ROKA 5AW1A 4G3XA 2NO1A 3EA4A 4QZVA 1K89A 2ATVA 2FWAA 1TX4B 3L0CA 3LS2A 5GP1A 5ALGA 1FRNA 5FWYA 3T0FA 3ZQUA 5BOSA 3IV9A 4RTJA 5FL7D 2YJGA 1F20A 1CEXA 2IEGA 3T3DA 3C4JA 3IOEA 4HWOA 1EQ2A 1LVGA 2B8EA 2ZR9A 4FN4A 4YACA 5T4BA 1ADYA 1LUAA 1AGNA 1R0SA 4GKAA 5CURA 5EFOA 5ESWA 5ELXA 2EVWX 3A10A 2J5XA 4GMFA 3A32A 2M9MA 5EHZA 2YX1A 3ECCA 5CG1A 4QGAA 5KQMA 4C4RA 4YCLA 2Q1XA 2WD7A 3IUYA 4JHXA 5BO5A 5HS4A 4UHKA 2PWZA 2PZFA 2XUQA 3C3DA 2BEUB 3DT6A 4FOLA 3WP0A 5BV7A 3VR0A 5AKHA 5TQ0A 1A3CA 5DHRA 3V8QA 2BELA 3VFDA 3UWDA 3L1IA 1J06A 1QGYA 1TPZA 2OHHA 5B57C 4RD6A 1XOIA 4NCHA 5B1IA 1ISHA 5LQSA 4GQBA 3ZIDA 1O95D 5EMHA 3MPUA 1T8WA 1NBWB 3ONEA 3I53A 3Q1KA 5FFMA 2C9BA 3A04A 5ICGA 3QW2A 2XRZA 4D81A 3IEVA 2HMYB 2VHUA 4XEHA 5CCEA 3D2LA 2PNJA 1G5RA 4ZVUA 4CCWA 1KKLA 3H2BA 1I9GA 4P2GA 1DARA 2O8DA 4X62B 4NVRA 5LC1A 5LOVA 2O8CA 1CEEA 1B0ZA 1E96A 2EAUA 2NNLD 4HNHA 5E6RB 1XRMA 3OPYA 2C95A 3MPOA 1R4NB 2VTBB 4MV4A 1DDOA 3E9RA 3ORYA 2I66A 4ZAGA 1SQ5A 2AR0A 2WKWA 5SY4A 2P6OA 3VYSB 3L49A 4EL0A 2GZ1A 4UM9B 4U7GA 4UC0A 2Y2VA 4O2BF 1VKRA 5ED0A 5L3RA 2WJWA 1DSSG 2FY8A 3PDUA 4KMRA 4HLUC 4KQ9A 3RU7A 2PMCA 3VR1A 3BXEA 4QDUA 1SXQA 1K97A 1JEJA 1I4WA 2R7MA 1QONA 1WS6A 2A57A 3M6XA 1D4AA 2FMFA 1PJ4A 2I1LA 3C7KA 2UVQA 1TJNA 1Y8RB 3EPPA 3OVMA 4ZOQI 1TM5E 1DBRA 3PYXA 4PBTA 3VHRA 2V7EA 3DTTA 1NE2A 3VV3A 4B85A 1HNZB 5KQRA 3KYJB 1C9MA 3AG6A 3C8UA 1Y6RA 1KDYA 4GXRA 4G25A 1RMTA 1SCBA 1NXVA 2Y1GA 1MB2A 3N7UA 1WULS 5F1PA 3Q5EA 2RHRA 1ZM7A 5KJFA 4I5EA 3WQHA 4H7IA 4NBTA 3QNWA 2IYSA 4C22A 1SU6A 1XTUA 3QHPA 4CT5A 1UFVA 2QX6A 4NIMA 1VL1A 3ESBA 4YA6A 1EJ2A 1PT9A 3JAMA 3TOXA 2A3NA 3E53A 4P3PA 3VYWA 3BEDA 3DHWC 4G5RA 3MSXA 4N5NA 5BPFA 2QVGA 4NULA 3CUYA 2AUMA 4Z7OB 2FKAA 2IOQA 5LYJF 2I3GA 4JLMA 5BW8A 1ZBQA 4W5JA 3I1IA 3NTQA 4OQYA 4F9EA 3LTEA 2YYSA 1NVKA 2P0AA 2YY7A 3IMFA 3NBMA 1N5DA 1CX9B 1AS0A 2IJGX 3VNBA 3EVZA 2H07A 1U3WA 1SRQA 2C1EA 3VYVA 5DIFA 3NIFB 2PO7A 5BNTA 3CUTA 3HSSA 4FDLA 3A2NA 2XCRB 1Q1BA 4BPBA 5HEKA 3KCNA 4R0MA 2CNBA 2PPVA 3JQ6A 1HG0A 1JAHA 1Y4ZA 4J7XA 2FDXA 4CM1A 4Y1RB 1O9BA 3MJHA 1XL1A 1IATA 1Q0ZA 3R0IA 1XELA 1W2GA 2R8ZA 3FDZB 3ZNQA 4O6VA 3ZI7A 1JAZA 1WY7A 3MG9A 3ZE9A 1XXHA 3DBLB 3R7LA 3ZKWB 3OF2A 3DEKA 5K0GA 1C8KA 1QWSA 1SC4A 3GDHA 4YALA 5FPHA 5U9CA 2C8LA 3EARA 3OE4A 4G8CA 1SOMA 4NZ9A 5B2ZA 5J2UF 1TADA 1WF6A 1S2MA 5AICA 5TT1A 5I9IA 4ETIA 3FKSD 3TNYA 4JLSA 1T10A 1Y81A 2F43B 1ENZA 3L01A 2PT7A 4IIVA 4NH4A 5DYYA 5LDDC 3VKGA 1QH8B 4HGPA 3HLKA 2C5SA 2W6IA 3HJHA 5BRNA 3USZA 5K45A 5ALNA 1Y82A 2FPLA 5CCDA 2YWXA 4W7IA 1AZSC 1N2EA 3CF6R 4MHOA 4TLLB 4FXPA 2O8EB 4CUZA 4J0DA 2D7CA 1DC7A 2GGSA 2FMTA 2VT2A 1Y5LA 4DB2A 2ENWA 4UXIA 1PUJA 1GSOA 1JAYA 1EWTA 3FGOA 3RBZA 1YK0A 4ZALA 1I3NA 5C1PA 4WGGA 2PG3A 2PSHA 3CRZA 3IC5A 1YDHA 3GCZA 4FFPA 4X44A 3MA0A 1DTEA 3KAPA 3COSA 4IO0A 3E03A 4J16C 5FNZA 3ITDA 2BD0A 2IHVA 4YC7A 4BC1A 3R0QA 4PPGA 2PX4A 4UMFA 3CISA 3ZD6A 4ZAXA 1ZJZA 3AW8A 4AKEA 4J6EA 4LQ4A 5DOVA 1RBZA 3BB3A 2XE8A 1U0LA 5D7BA 5CBKA 1BMFD 3MTAA 1VLQA 2BY4A 4D8TA 4QVGA 3EISA 1ONPA 5LDGA 3UYLA 5KTYA 3WMFA 4EIWA 1RQXA 2SCUA 4MX8A 4HDNA 4PGFA 3O90A 4DJFC 4QLBA 4C4OA 3D02A 3FM9A 4WLFA 4JAVC 5TMDA 2CY0A 4FVTA 4ZO6A 1M2VA 1WOMA 4AAYA 4G0QA 4FFVA 3BHNA 3JY6A 4LNUB 3UCXA 4TKZA 2AMYA 3SZRA 2XBUA 4Z7QB 4KQXA 3IUMA 2H1FA 2XNDA 4OEHA 4RF3A 4RDXA 2Q1SA 4TOIA 2N47A 2IYOA 3SHWA 3SDZA 3I92A 1M6YA 1OGYA 2Q5IA 4LV6A 1XEXB 4NV1A 1IXZA 1HRKA 4F04A 5CFRA 1GPUA 1IXSB 1H2YA 3CWQA 2GVDC 3CB4A 1CFJA 4GFDA 4UTZA 4CIYA 2HRBA 1DJOA 3FRHA 1NNLA 5ITWA 2AW5A 2VP4A 3DOUA 4JY7A 2C77A 2VHWA 3QH4A 5B58T 4X1OA 1OLUA 2ZTLA 4U7WA 4D02A 3GH1A 1I5OA 3MCVA 1Q3HA 3BM5A 2AFHE 4FHFA 4R05A 4TXHA 2P2YA 4UE2A 2DQYA 3U19A 2CEKA 3S29A 4TT3D 1DQYA 1TVCA 2XYGA 2DUUA 1RI1A 2MYNA 1B16A 1IJKA 1JIVA 2CL6X 3I52A 1T8TA 1X7ZB 1I2MA 3LOQA 2PH1A 3HNRA 5JMWA 3WGLA 1MV8A 1NQTA 1PR4A 2AB0A 2IXFA 1FDUA 4YJ3A 3KYCB 5G4KB 3DVAB 3LUKA 3HJGA 4TTPA 5FNVA 3OD5A 4D4JA 1WPQA 1A2KC 2WKPA 3NTLA 4G0ZA 4YMTA 4LXXA 1ULZA 3FPGA 1R16A 1UK9A 2ZE8A 3C85A 3QKTA 4IMIB 5BV8A 3EQ2A 3TLMA 3RTBA 2G72A 3GFBA