1T0KA

Joint x-ray and nmr refinement of yeast l30e-mrna complex
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
365
structure length
365
Chain Sequence
GKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*GP*AP*CP*CP*GP*GP*AP*GP*UP*GP*UP*CP*C)-3'
publication title Joint X-Ray and NMR Refinement of the Yeast L30e-mRNA Complex
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 104
structure length 365
sequence length 365
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1t0kA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1t0kA01
4RJZA 1B05A 1N7WA 1JVXA 1R9LA 3IR1A 2XXTA 2F6GA 1O7TA 1MQDA 2UVGA 4RK9A 2UXAA 5ICTA 2HZLA 4KCDA 1MM7A 3M3KA 4F1UA 2Q88A 4H65A 2HZKA 4NTLA 3IOWA 3GLBA 4NWCA 1JVYA 4YKIA 3T9XB 3I5OA 1MS7A 3G3JA 4H5FA 3EHSA 4NF5B 3D4GA 3W9VA 4GRKA 4G4PA 4WEPA 5FHMA 1ATGA 1MH3A 2HAUA 4LQ5A 3TCFA 4GVOA 3W9WA 4X9TA 3RY3A 2GH9A 3M3FA 1B3HA 1VR5A 3VLVA 5CMCA 3QAXA 3MVXA 4KR5A 4QF9A 1MPDA 2FYIA 1BP5A 1J1NA 4RNSA 4BDQA 3IX1A 1B9JA 2VOZA 5TPAA 3TTMA 1IXCA 4QSDA 4FE8A 4XKQA 2R71A 3C33A 3ODBA 1F9BA 4QHQA 5L9OA 3MZ1A 4XKRA 2CMOA 5FHNA 5EYFA 3DELB 4IB2A 5LOMA 4DCXA 3CFXA 3KJ7A 1B0HA 2DQVA 4GLIA 4JB7A 3H6TA 4UACA 2PT1A 5JTYB 4DIGA 1MDQA 4H1XA 1UIUA 4LP2B 4OQOA 5FTIA 2VP1A 4LA9A 3FVGA 1Y20A 2V93A 3MZ9A 3GBBA 3KBRA 4KCCA 3Q25A 5BUUA 1ZBMA 3TAJA 5DYHA 1B3FA 2OWSA 3IL1B 3TTKA 5I84A 1H44A 3OEMA 1A99A 2RINA 2DWJA 4FORA 2R9JA 5HBCA 4GD5A 3WAFA 1XS5A 4NWDA 4ZEBA 2DE2A 4IGTA 1D9VA 3TQWA 2D21A 3N26A 1HSEA 3CG1A 3HHFA 3I6VA 4ELRA 2Y7PA 3CSGA 4HCYA 2O1LA 1SYIA 1XC1A 1B51A 3KJTA 3E9XA 3IO4A 1LFHA 4IGRA 4RYAA 4KYDA 3U93A 4R6KA 3U8QA 2DVZA 3PPRA 4U4XA 3QUJA 4KYSA 2G29A 2NOOA 4NF5A 4DCYA 4QFLA 4ZDMA 4R72A 2D5WA 1NKXA 1YAEA 2ANJA 2BJJX 2Z22A 5CMKA 1B52A 3KSXA 4ESXA 3RPWA 1FTOA 1PBPA 1S9TA 3EHUA 1M5FA 4RXLA 3FVKA 4EF1A 4GOTA 4EUOA 4OETA 1A8FA 1A55A 1WDNA 4N6PA 4BDLA 1MM6A 2I0CA 2KLFA 1IIWA 1IUDA 4XKNA 1QUJA 1JW5A 3WAEA 4BDMA 3SDFA 3MWBA 2DP8A 3H4ZA 2XX7A 4X1DA 3O6HA 3PD9A 3TTLA 4R75A 2DXYA 2ABHA 3B6TA 4FEBA 1LBBA 4U23A 1LSTA 1O64A 3K6UA 1MXXA 2V3UA 2H9BA 2DS9A 5KCJB 3PPQA 4O3CA 1ZLQA 4H8IA 2DOJA 2ESNA 3DP8A 3ZSFA 4UA8A 4Q8RA 1ZMGA 1Z7ME 1AMFA 4ZZEA 1R1NA 5JTYA 3N94A 4GXAA 3AXFA 1VSOA 3MP1A 3MUQA 1RYOA 4F31B 2Y7IA 3SEVA 4P0GA 2HAVA 3T22A 1TT1A 2FNCA 3IB0A 3ECRA 2REJA 1D3KA 3EHTA 2Q89A 1SI1A 3G3FA 3RTWB 1DTZA 2QMWA 1YTVA 1ZU0A 1JNFA 3RLFE 3THIA 3CIJA 4OYVA 2XXIA 3EF7A 1ZTYA 3U1OA 2RC7A 1CB6A 2RCAA 1IEJA 4I9DA 2RC9A 1NNKA 4YKJA 4R2BA 5L8DA 1PDAA 5I58B 1B4ZA 1FQCA 1B4HA 2V3QA 4PQJA 1FTJA 4R73A 3B6WA 3K02A 4ZEIA 4YMAA 4BLAA 1H3DA 4WXJA 1M5EA 4RPOA 4G8MA 4OENA 4QSEA 2DYXA 4LONB 4DDDA 5K2XA 3CI8A 4F1VA 2F7BA 2P1SA 4C1UA 1QVSA 3CR9A 2F7AA 1OMPA 3TPAA 1GTKA 1I6AA 3HV1A 1LAHE 4ZEFA 2NWJA 3Q28A 1NH7A 4OTEA 4IO4A 4NEDA 2V84A 2XHDA 4LZ7A 5L9MA 1Q35A 4BDNA 3VXBA 3VLWA 1OLAA 5CBRA 4ZEDA 1SQYA 1B7UA 2O7UA 4RK2A 2F34A 4OEUA 3S9MC 1T0KA 1B7HA 1PC3A 2RC8A 1OVBA 1LCTA 4Q30B 5CMBA 1S50A 1GVCA 3TODA 1IITA 3U72A 3PU5A 1MXVA 5TP9B 4PE5B 4TLLB 3A09A 1DPPA 4HCWA 3S9NC 3FATA 1D9YA 3FXUA 2OBGA 3FV1A 1RYXA 1I6QA 3VLUA 2Z8DA 2ONRA 3T9VA 3Q27A 1B1XA 1MY0A 1H43A 3MC2A 1EH3A 2HCAA 3TKDA 1MY2A 1P1OA 3MVZA 2WKYA 4YZZA 3S4UA 2NXOA 3PGFA 1TXFA 1XVXA 2M8CA 4QFNA 1D4NA 1TFAA 5KCJA 1B1HA 4F3SA 2XXRA 4DLDA 2Y84A 1EZPA 1IXGA 2Z8FA 2F8DA 1Y9UA 2P2AA 4IO2A 1ZKBA 1FTMA 3RGYA 4AB5A 4AB6A 2CZLA 4R9FA 5BWJA 4H5GA 5CC2A 3KOSA 3FJMA 3V8XB 3S2VA 1P1WA 3VVDA 3SETA 3FXRA 2QL3A 3GXAA 3LUYA 3CRBA 4IY6A 1JW4A 3JZJA 1Y1MA 4ISUA 2I6EA 1MQGA 3B6QA 3SEWA 3M3LA 4M4GA 1Z7NE 2F35A 3R26A 3OO6A 1IXIA 4ELPA 4RY1A 1UTHB 4OHNA 3H6VA 3A3UA 5I58A 2OZZA 1ANFA 5A5XB 4PFTA 2B65A 3UN6A 3OD7A 2H4IA 3G3HA 4TQUQ 3CVGA 3USDA 3KOTA 5AA4B 3ILUB 3TDJA 4R2FA 4DXBA 2NVUB 4R74A 1AL3A 5FTHA 2YLNA 4U22A 4G8NA 2XXXA 1VFDA 3VXCA 4R9GA 2OJTA 3KG2A 3FIRA 4OFOA 3IORA 3FVOA 2LAOA 1QW0A 1POTA 5EHSA 1FCKA 4PP0A 1ZIUA 4QFPA 4LUBA 2I0BA 3SEUA 2P0SA 1NNTA 4Z7EA 4AQ4A 1VFEA 2UYEA 4MH5A 5TP9A 2XXPA 1MXZA 3VFJA 3U94A 3H6UA 4DXUA 3M8UA 2XXHA 3KGCA 3H6WA 1B46A 5DT6A 3A3CA 4YU0A 3O29A 4Q0CA 4TOZA 5ICQA 1JEUA 2O6AA 1OLCA 2Q2AA 1SW4A 2I3VA 3SERA 3OXNA 3CFLA 4IO6A 4OESA 1LBCA 3IAZA 3GBAA 3UA8A 4PFYA 1AIVA 4H67A 3DP6A 3VDFA 5I59B 1NMUA 1NFTA 3UK4A 1ZJLA 3CSBA 3MBPA 4FECA 1OVTA 4F22A 4BDRA 4U4SA 4NF8B 5DVIA 1FQDA 5H8SA 3PUXE 3IJOB 2F78A 3PMVA 3D4CA 3E3KA 2UVHA 4G2ZA 4GIZA 4YMBA 4P11A 3IK6B 3DP4A 1A40A 3MQ9A 5ITOA 2OWTA 1MQIA 5AE4A 1UTHA 4NF6B 3H7MA 1JQFA 1NNPA 2PYYA 1O63A 1SDXA 3BFUA 5A5XA 3PMWA 3HSTA 1B58A 1N84A 3V89B 3RT6B 2V25A 1JETA 5HPQA 4FEDA 3RTFB 2VHAA 3R7XA 1P99A 3L6GA 3FZVA 4YICA 3QK6A 4YB7A 1N76A 5AA4A 3U92A 4N07A 3LR1A 4G68B 1A7LA 3MJNA 4I62A 2E0SA 3EPEA 2YPNA 2QS2A 1MQHA 1MXWA 1BKAA 4EXLA 2W7YA 2QS4A 4THIA 3O28A 1YPNA 1AH5A 4ONYA 4DE8A 2DWHA 4MLVA 1US4A 4ELQA 1Y4TA 3Q26A 4LVQA 4ZS9A 3G3KA 4ESWA 3F11A 2HQ0A 4OFLA 5DEXB 1MXYA 3C36A 4POWA 4EXKA 5F7VA 3IOVA 3RN8A 4DXCA 3SESA 1EZOA 3QUFA 1NL5A 2Q2CA 4EQ7A 5I56B 1II5A 3ONMA 1SYHA 4H6DA 3TMGA 4Q5TA 1FQAA 3O97A 3DM0A 3PUZE 1A8EA 1YCJA 2OLBA 2UVIA 4I8CA 5JEIA 2F6PA 5HM4B 1FQBA 1H45A 1Y4CA 3FXQA 4R6YA 4EQ9A 3PUYE 1B5HA 3S9LC 5IAIA 4PETA 4OWDA 3FUZA 3EN3A 4H0WA 1XOCA 5TU0A 5I59A 2I3WA 4KYEA 4C0RA 4JWOA 3I3VA 3PPOA 3TQLA 3LSWA 2B3FA 5CI5A 1B3EA 1B32A 4NF8A 4JXIA 3FJGA 5CRYA 3HCQA 4EQBA 2AL5A 4HTGA 4JWYA 1LB8A 1HSLA 2A5TB 3HHGA 3MZBA 1BLFA 5J1DA 3K00A 1MDP1 4BDOA 2XD3A 3IJXB 4NF6A 4KQPA 4R6HA 4GXSB 2O7IA 3IB2A 3ZKLA 1AOVA 3G3GA 4PFUA 3EQ1A 4F2OA 1WVJA 3H06B 1POY1 3MVYA 3S9EA 3RT8A 3MAMA 3PD8A 3HN0A 4C1TA 2HXWA 2DE3A 3LC8A 2F36A 4FAJA 4PFWA 4G68A 4JDFA 3O6IA 1IXHA 2VD3A 2QJEA 4GL8A 4DZ1A 1B7ZA 1FW0A 1LCFA 1B3LA 1DMBA 3FGSA 1MPCA 2IA4A 2F97A 1DPEA 1Y3PA 3LSFB 3BBRA 1EZ9A 4OXVA 2Q9TA 4MLQA 4U1ZA 1IQ7A 3PUWE 3SEXA 3IOUA 4RPNA 5DEXA 1UTBB 2ZYOA 3VV5A 5K2YA 1MXUA 3LSLA 2O69A 4HS7A 3KFMA 3K6VA 4OMBA 3C35A 3QXMA 2X26A 4GF8A 5H8NB 3OSQA 4X1BA 5I56A 2QRYA 3UP9A 1OQGA 4MF3A 2GFEA 5ITPA 1TWYA 2I48A 3T96B 3Q29A 2RF1A 1HSJA 4QRZA 5KDTB 3KSJA 4LZ8A 4ND9A 3RQTA 2H25A 4F3GA 4IY5A 1L5TA 3TCGA 1USYE 4ZEKA 3TTNA 5H8FB 3TEPA 1A54A 1S7YA 4F39A 4EDPA 1BIYA 4HW8A 3MP8A 2XXWA 4TLMB 2HEUA 4GFRA 5AA2B 3C34A 3TYHA 5DVFA 3K1NA 3KEIA 2Z23A 2E1SA 3FVNA 2OCUA 2A5TA 3H3GA 3KN8A 4YKKA 4LZ5A 2ZNUA 4F1YA 3VVEA 3VE1B 1GR2A 5AA1A 1OQHA 3K6XA 3OO9A 4NMYA 2ZXTA 2O1MA 3K1PA 2RKMA 3W15C 2REGA 4XKPA 1B6HA 1M5CA 2ZYMA 2F5XA 2PT2A 1I6BA 1UQWA 1R9QA 5DVJA 3C9HA 1MY3A 1LFGA 4ZZAA 5FHOA 2A5SA 4OERA 5DTBA 3SKPA 3FASA 3QSLA 2HFBA 5L9SA 1M5BA 4E0XA 4KD5A 5I2NB 5CMMA 3OEKA 1NNFA 1VE4A 1B5IA 2Z8EA 4EF2A 3C4MA 2I4BA 2QS1A 1B40A 2O51A 2QS3A 5H8QB 1DTGA 2ONKE 5B7DA 5H8HB 3FV2A 3PV0E 3MP6A 3PPPA 3ILTB 1UTBA 3TTRA 2DE4A 2ZYKA 4FIMA 3VVFA 1DSNA 2DSFA 5I2KB 5M2VA 1USYH 4K3FA 3FJ7A 3T9HB 5H8NA 1Y3QA 1QKBA 3O6GA 1N7XA 1FQFA 4U2RA 1N04A 1IZ1A 1R6ZA 3TUSA 3G3IA 4ZECA 4E0WA 1QKAA 2I49A 3O66A 2ZYNA 4YKPA 4OFJA 1P1UA 4QSCA 3T9UA 1N3WA 2I4CA 4MFIA 5KDTA 4IO7A 4F3BA 2GHAA 1CE2A 2Q8JA 3N6TA 3ZKKA 3JYRA 4YB5A 3C32A 4M1VA 4FJPA 4ELOA 4WEDA 5H8FA 1QUKA 5ISUA 5F1QA 2QSXA 3OMBA 4U21A 1JW1A 1US5A 5AA2A 2GHBA 1XT8A 4FATA 3V83A 4OZ9A 1TFDA 2B3BA 4G77A 3LBSA 1N0TA 3KN7A 2X7PA 3TELA 2Y7RA 3CFZA 1PBQA 1URGA 3RUMA 5AA2D 4JBZA 2XX8A 5B70A 2XXUA 4IO5A 2D3IA 2G93A 4ECFA 3GZGA 2ONSA 3IB1A 3OELA 4L17A 3SEYA 5ELVA 2QPQA 4KI0E 2ZMBA 3MVWA 4JSDA 3UORA 3K2DA 3TZAA 1Y3NA 2DWAA 4P0IA 1B0LA 3O2AA 3C31A 5IKBA 4JSOA 1XVYA 2FA7A 3PMXA 2UYFA 1URSA 3T93B 4GQOA 2AL4A 2X7QA 3TCHA 3TFLA 1PB8A 1LGBC 4F18A 4H8JA 2UVJA 5I2NA 2R6GE 1LAGE 2QMXA 5JK4A 1NH8A 3RNNA 4KFQA 1B5JA 2DWIA 1N3XA 3V5AA 1SI0A 5H8QA 1FTKA 1ELJA 3G7WA 5H8HA 3IOTA 1MQJA 3ZS6A 3O9PA 4MBPA 5I57B 1SBPA 2ZNSA 4Z0IA 5EHMA 5I2KA 1GV8A 3UGWA 4XIGQ 1SW5A 1LLSA 4OVJA 2AIXA 3PPNA 4NF4B 4OEVA 3QIMA 1QUIA 1FQEA 3PUVE 4N13A 1FTLA 1SVXB 2Y7KA 1P1QA 1PB7A 4KHZE 4LQ2A 4POXA 4ZE9A 5AA3A 3E13X 2RCBA 4GL0A 2F7CA 4I1DA 3OOAA 1LAFE 3H03A 3K6WA 4F3PA 1LAXA 4U1OA 3K1MA 1RKMA 3KZGA 1DOTA 1Q1KA 1SW2A 3HPIA 4NE4A 4F2QA 2XD2A 4O3BA 2THIA 4WKMA 1BTJA 4O3AA 2AYSA 4XTCQ 3UIFA 3KN3A 3N5LA 3IO6A 3K0VA 1MRPA 4LATA 2PVUA 4JWXA 4X48A 2XXVA 1QJMA 5KZTA 3OO8A 2IEEA 3B7DA 4G68C 1Y1ZA 5CBSA 1B3GA 5TPAB 1P1NA 1EU8A 4GWOA 3DLNA 1M5DA 2VGQA 3JV9A 1LFIA 4IO3A 1MY4A 1SD3A 1JEVA 5CM6A 3CG3A 2YJPA 1KWHA 4RA1A 2DVCA 2GRVA 2O84X 4YB6A 2XXYA 1GGGA 2ALUA 1PEBA 3BFTA 3T66A 1OIBA 3MPLA 2PMSA 3FD3A 2XXQA 2DXRA 1MY1A 3OO7A 3MW0A 1MH4A 1I69A 2H98A 1MG1A 4F19A 1H76A 4QFOA 1SW1A 4F29A 4G8HA 1XHYA 3LSXA 2H99A 1MPBA 1PB9A 2OK2A 2VD2A 2V3TA 1B2HA 3HO7A 3E4RA 3K4UA 4YAHX 3OENA 1WODA 2ZNTA 2I58A 2NUVA 2PBWA 4ZE8A 1URDA 3MPKA 3P7IA 2H5YA 5I57A 2PX1A 2O68A 4QFKA 3QYTA 4XXUA 3L6HA 1UIVA 2XX9A 3BKIB 3K01A 3N6UA 3R6UA 1LB9A 4NF4A 1QULA 3OSRA 2Y7WA 4KPTA
chains in the Genus database with same CATH superfamily
4RJZA 1B05A 1N7WA 1JVXA 4DI3D 1R9LA 3IR1A 2XXTA 4N17A 1NUXA 2F6GA 4N81A 3KBZA 1RDYA 1O7TA 3HFUA 1MQDA 2UVGA 4RK9A 2UXAA 5ICTA 2HZLA 4KCDA 4OVQA 1MM7A 4GWZA 3M3KA 1YZ0A 2Q88A 4H65A 5IZ1A 4F1UA 2HZKA 4NTLA 3IOWA 3GLBA 4PCDA 4NWCA 4HE1A 1JVYA 4YKIA 3T9XB 3I5OA 2XWOA 1MS7A 3G3JA 4H5FA 3EHSA 4NF5B 3D4GA 2V4CA 3W9VA 4GRKA 4G4PA 4WEPA 1YXIA 5FHMA 1ATGA 1MH3A 2HAUA 4LQ5A 3TCFA 4GVOA 3W9WA 4X9TA 1FPFA 5IZ3A 3RY3A 2GH9A 3M3FA 1B3HA 1VR5A 1IMAA 3VLVA 5CMCA 3QAXA 3MVXA 4XEQA 4KR5A 4QF9A 4I3EA 1FJ6A 1MPDA 5T3JA 2FYIA 1BP5A 1J1NA 4RNSA 4BDQA 3T1BA 3IX1A 1B9JA 2VOZA 5TPAA 3TTMA 1IXCA 5EYGA 4QSDA 4FE8A 4XKQA 2R71A 3C33A 3ODBA 4PGPA 2F3DA 4PDHA 1F9BA 4QHQA 5L9OA 3MZ1A 4OVSA 4XKRA 2CMOA 5FHNA 5EYFA 3DELB 4IB2A 2FVZA 5LTCA 5LOMA 4I3YA 4DCXA 3CFXA 3KJ7A 1B0HA 2DQVA 4GLIA 4JB7A 4NX1A 3H6TA 4UACA 2PT1A 5JTYB 4MMPA 4DIGA 1MDQA 4H1XA 1UIUA 4LP2B 4OQOA 5FTIA 2VP1A 3MSTA 4LA9A 3FVGA 1Y20A 2V93A 3MZ9A 1FTAA 1FBGA 3FXBA 3GBBA 1DCUA 3KBRA 4KCCA 3Q25A 5BUUA 1ZBMA 2FHYA 3TAJA 5DYHA 1B3FA 2OWSA 1NV7A 4N6KA 3IL1B 1LEVA 3TTKA 5I84A 1H44A 1NV5A 3OEMA 1A99A 2RINA 4PAIA 2DWJA 4FORA 2QVVA 3RPLA 2R9JA 1Q9DA 4GD5A 5HBCA 3WAFA 4N6DA 4PFBA 4GWWA 1XS5A 4NWDA 4ZEBA 2DE2A 4IGTA 1D9VA 3TQWA 2D21A 3N26A 1HSEA 3CG1A 3HHFA 3I6VA 4ELRA 2Y7PA 3CSGA 4HCYA 2O1LA 4FBPA 1SYIA 1XC1A 1B51A 3KJTA 4JVDA 3E9XA 3IO4A 3IFCA 2QVUA 1LFHA 4IGRA 4RYAA 4KYDA 3U93A 4R6KA 3U8QA 2DVZA 3PPRA 4N8GA 4U4XA 3QUJA 4KYSA 2G29A 2NOOA 4NF5A 4DCYA 4QFLA 4ZDMA 4R72A 2D5WA 1NKXA 4PAKA 4PC9A 1YAEA 2ANJA 2BJJX 2Z22A 5CMKA 2WBBA 1B52A 1EYJA 2QFLA 3KSXA 4ESXA 3RPWA 1FTOA 4QBAA 1PBPA 1LBWA 1S9TA 3EHUA 1M5FA 1FBCA 4RXLA 3FVKA 2JJKA 4EF1A 4GOTA 4EUOA 5I3SA 4OETA 1A8FA 1NV1A 1A55A 1K9ZA 1WDNA 4N6PA 4BDLA 1MM6A 2I0CA 2KLFA 1IIWA 1IUDA 4XKNA 1QUJA 1JW5A 3WAEA 4BDMA 3SDFA 3MWBA 2DP8A 3H4ZA 2XX7A 4X1DA 3O6HA 3PD9A 3TTLA 4R75A 2DXYA 3MYUA 2ABHA 3B6TA 4FEBA 1LBBA 4KXPA 4U23A 1LSTA 1DBZA 1O64A 3K6UA 1MXXA 2V3UA 2H9BA 2DS9A 4HXVA 5KCJB 3PPQA 4O3CA 1ZLQA 4H8IA 1FBHA 2DOJA 2ESNA 3DP8A 3ZSFA 4UA8A 4Q8RA 1ZMGA 1Z7ME 1AMFA 5F24A 4ZZEA 1R1NA 5JTYA 3N94A 4GXAA 3AXFA 1VSOA 3MP1A 3MUQA 1RYOA 4F31B 2Y7IA 3SEVA 4P0GA 2HAVA 3T22A 1TT1A 2FNCA 4P1EA 3IB0A 3ECRA 2REJA 1D3KA 3EHTA 4PF6A 2Q89A 1SI1A 4PFIA 5IM2A 3G3FA 3RTWB 1DTZA 2QMWA 1YTVA 1ZU0A 1JNFA 3RLFE 3THIA 3CIJA 3KC0A 4OYVA 2XXIA 3EF7A 1ZTYA 3U1OA 2RC7A 1CB6A 2RCAA 1IEJA 4I9DA 2RC9A 1NNKA 4YKJA 2CZHA 4QXDA 4R2BA 5L8DA 1PDAA 5I58B 1B4ZA 1FQCA 1B4HA 2HHMA 2V3QA 4PQJA 4R73A 1FTJA 3B6WA 3K02A 4ZEIA 3D1RA 4YMAA 4BLAA 5J16A 1H3DA 4WXJA 1M5EA 4RPOA 4G8MA 4OENA 4QSEA 2DYXA 4LONB 4DDDA 5K2XA 3CI8A 4F1VA 4PDDA 2F7BA 2P1SA 4C1UA 1QVSA 3CR9A 2F7AA 1OMPA 3TPAA 1EYKA 1GTKA 1I6AA 4GWYA 2PFZA 3HV1A 4GWSA 1LAHE 4ZEFA 4AS4A 2WYPA 2NWJA 3Q28A 1NH7A 4OTEA 4IO4A 4NEDA 2V84A 2XHDA 4LZ7A 5L9MA 4OVRA 1Q35A 4BDNA 3VXBA 3VLWA 3U65A 1OLAA 5CBRA 4ZEDA 1SQYA 1B7UA 2O7UA 4RK2A 2R8TA 2CZKA 2F34A 4OEUA 3S9MC 1T0KA 1FPDA 1B7HA 1PC3A 2RC8A 1OVBA 1LCTA 4Q30B 5CMBA 1S50A 1GVCA 3TODA 1IMEA 1IITA 3U72A 3PU5A 1MXVA 5TP9B 4PE5B 4TLLB 3A09A 1DPPA 4HCWA 3S9NC 3FATA 1D9YA 3CHGA 3FXUA 2OBGA 3FV1A 1RYXA 1I6QA 3VLUA 2OX3A 2Z8DA 2ONRA 3T9VA 1K9YA 3Q27A 1B1XA 1MY0A 1H43A 3MC2A 1EH3A 2HCAA 3TKDA 1MY2A 1LBVA 1P1OA 2XA5A 3MVZA 2WKYA 4YZZA 2VPNA 3S4UA 2NXOA 3PGFA 1TXFA 2XWVA 1XVXA 2M8CA 4QFNA 1D4NA 1TFAA 3BIHA 5KCJA 1B1HA 1FJ9A 4F3SA 2XXRA 4DLDA 1FPLA 2Y84A 1EZPA 4OANA 1IXGA 2Z8FA 2F8DA 1Y9UA 2L5VA 2P2AA 4IO2A 1ZKBA 3LUZA 1FTMA 4I40A 3RGYA 4AB5A 4AB6A 2CZLA 4R9FA 4NG7A 5BWJA 4H5GA 5CC2A 3KOSA 3FJMA 4JVCA 3V8XB 3S2VA 1P1WA 4HE2A 3VVDA 2ZZXA 3FXRA 3SETA 2QL3A 3GXAA 3LUYA 3CRBA 3A29A 4IY6A 1JW4A 3JZJA 1Y1MA 4ISUA 2I6EA 5IZZA 1MQGA 3B6QA 3SEWA 3M3LA 4M4GA 1Z7NE 2F35A 3R26A 3OO6A 1IXIA 4ELPA 4RY1A 1UTHB 5ET8A 4OHNA 1NV2A 3H6VA 3A3UA 5I58A 2OZZA 1ANFA 5A5XB 4PFTA 2B65A 3UN6A 3OD7A 2H4IA 3G3HA 4TQUQ 3CVGA 3USDA 4H45A 2WEFA 4XF5A 2CEYA 3KOTA 5AA4B 3KC1A 1INPA 3ILUB 5EYHA 3TDJA 4R2FA 4DXBA 2NVUB 4R74A 1AL3A 5FTHA 2YLNA 4U22A 4G8NA 2XXXA 1VFDA 3VXCA 4R9GA 2OJTA 3KG2A 3B8BA 3FIRA 4OFOA 3IORA 1FBPA 3FVOA 2LAOA 1QW0A 1POTA 5EHSA 1FCKA 4GWXA 1NI9A 4PP0A 1ZIUA 4QFPA 4LUBA 2I0BA 3SEUA 5ET5A 2P0SA 4OVTA 1NNTA 4Z7EA 2FIXA 4AQ4A 4NQ8A 1VFEA 2UYEA 4MH5A 5TP9A 2XXPA 1MXZA 3VFJA 3U94A 3H6UA 4P3LA 4DXUA 3M8UA 2XXHA 3KGCA 3H6WA 1B46A 5DT6A 3A3CA 4YU0A 4O94A 3O29A 4Q0CA 4TOZA 1FBEA 5ICQA 1JEUA 2O6AA 1OLCA 2Q2AA 4X04A 1SW4A 1RDZA 2I3VA 3SERA 3OXNA 3CFLA 4IO6A 2WYKA 4OESA 1LBCA 3IAZA 3GBAA 3UA8A 4PFYA 1AIVA 4MCOA 4H67A 5IGAA 3DP6A 1XI6A 3VDFA 5I59B 3EKIA 1NMUA 1NFTA 3UK4A 1ZJLA 3CSBA 3MBPA 4FECA 1OVTA 5EQ8A 4F22A 2XXKA 1FRPA 4BDRA 4U4SA 4NF8B 5DVIA 1FQDA 4PBHA 5H8SA 2BJIA 3PUXE 3IJOB 2F78A 3PMVA 3D4CA 3E3KA 2UVHA 4G2ZA 2FIEA 4GIZA 4YMBA 4PE3A 4P11A 3IK6B 1VDWA 3DP4A 4NGUA 1A40A 3MQ9A 5ITOA 2OWTA 1MQIA 5AE4A 1UTHA 4NF6B 3H7MA 1JQFA 1NNPA 2PYYA 1O63A 2Y5KA 1SDXA 3BFUA 5A5XA 3PMWA 3HSTA 4GX6A 1B58A 1N84A 3V89B 3RT6B 2V25A 1JETA 5HPQA 4FEDA 1FBDA 3RTFB 2VHAA 3R7XA 5I7IA 1P99A 3L6GA 3FZVA 4YICA 3QK6A 4YB7A 1N76A 5AA4A 3U92A 4N07A 3LR1A 4G68B 1A7LA 3MJNA 4I62A 1RDXA 2E0SA 3EPEA 1NV0A 2YPNA 2QS2A 1MQHA 1MXWA 1NUYA 1BKAA 4EXLA 4GX4A 2W7YA 2QS4A 1NV3A 4THIA 3O28A 4O8MA 3T0JA 1YPNA 1AH5A 4ONYA 4DE8A 2DWHA 4MLVA 1US4A 4ELQA 1Y4TA 3Q26A 4LVQA 4ZS9A 3G3KA 4ESWA 3F11A 2HQ0A 4OFLA 5DEXB 1MXYA 3C36A 4POWA 4EXKA 5F7VA 3IOVA 3RN8A 2HPGA 4HE0A 4DXCA 3SESA 1EZOA 3QUFA 1NL5A 2Q2CA 5I5PA 4EQ7A 5I56B 1II5A 3ONMA 1SYHA 4H6DA 3TMGA 4Q5TA 1FQAA 2OWZA 3O97A 4OA4A 3DM0A 3PUZE 3ISPA 1A8EA 1YCJA 1NV4A 2OLBA 2UVIA 4I8CA 2PFYA 4MX6A 4UABA 5JEIA 2F6PA 5HM4B 1FQBA 1H45A 1Y4CA 3QMFA 3FXQA 4R6YA 4EQ9A 3PUYE 1B5HA 3S9LC 5IAIA 4PETA 4OWDA 3FUZA 3EN3A 1IMCA 4H0WA 1XOCA 1NUWA 5TU0A 5I59A 2I3WA 4KYEA 4C0RA 4JWOA 3I3VA 4N91A 3PPOA 3TQLA 3LSWA 2B3FA 5CI5A 1B3EA 1B32A 4NF8A 4JXIA 3FJGA 5CRYA 4NN3A 3HCQA 2Q8MA 4P56A 4EQBA 2AL5A 4HTGA 4JWYA 1LB8A 1LBZA 1HSLA 4N4UA 2A5TB 2VT5A 3HHGA 3MZBA 1BLFA 5J1DA 4N8YA 4NF0A 5LDZA 3K00A 1MDP1 4BDOA 2XD3A 1QGXA 3IJXB 4NF6A 4KQPA 1SPIA 4O7IA 4R6HA 4GXSB 2O7IA 3IB2A 3ZKLA 1AOVA 3G3GA 4PFUA 3EQ1A 5EQAA 4F2OA 1WVJA 3H06B 1POY1 3MVYA 3S9EA 3RT8A 3MAMA 3PD8A 3HN0A 4C1TA 2HXWA 2DE3A 3LC8A 2F36A 4FAJA 4PFWA 1DK4A 4G68A 3RYDA 4JDFA 3O6IA 1IXHA 2VD3A 2QJEA 4GL8A 4DZ1A 1B7ZA 1FW0A 1LCFA 1B3LA 1DMBA 2XWIA 3FGSA 1MPCA 2IA4A 2F97A 1IMFA 1DPEA 4P8BA 1Y3PA 1KA0A 3LSFB 3BBRA 1EZ9A 4OXVA 2Q9TA 2B4MA 4MLQA 4U1ZA 1IQ7A 3PUWE 3SEXA 1FBFA 3IOUA 2P3NA 4RPNA 5DEXA 1FSAA 1UTBB 2ZYOA 3VV5A 5K2YA 1MXUA 3LSLA 1KA1A 2O69A 4DI4B 4HS7A 4MNPA 3KFMA 3K6VA 4OMBA 4AS5A 3C35A 3QXMA 2X26A 4GF8A 5H8NB 3OSQA 4X1BA 5I56A 2QRYA 3UP9A 1OQGA 4MF3A 2GFEA 5ITPA 1TWYA 4P1LA 2I48A 3E78A 3T96B 3Q29A 3GYYA 1FPIA 2RF1A 1HSJA 2CZIA 4QRZA 5KDTB 2ZZWA 3KSJA 4GBWA 4LZ8A 4ND9A 3RQTA 2Q74A 3SZPA 2H25A 4F3GA 4IY5A 4MNIA 1L5TA 3TCGA 1USYE 4ZEKA 3TTNA 5H8FB 3TEPA 1A54A 1S7YA 4P9KA 4F39A 4EDPA 1BIYA 4HW8A 3MP8A 2XXWA 4TLMB 2HEUA 4GFRA 5AA2B 2F3BA 1NUZA 3C34A 3TYHA 1FPJA 5DVFA 3K1NA 3KEIA 1LBYA 2Z23A 2E1SA 4GBVA 3FVNA 2OCUA 2A5TA 3H3GA 3KN8A 2MKZA 4YKKA 4LZ5A 2ZNUA 4F1YA 4MAGA 3IFAA 3VVEA 3VE1B 1GR2A 5AA1A 1OQHA 3K6XA 3OO9A 4NMYA 2ZXTA 5DW8A 2O1MA 3K1PA 5ET6A 2RKMA 3W15C 2REGA 4XKPA 1B6HA 1M5CA 2ZYMA 1LBXA 2F5XA 2PT2A 1G0IA 1I6BA 1UQWA 1R9QA 5DVJA 3C9HA 1MY3A 1LFGA 4ZZAA 5FHOA 2A5SA 5FBPA 4OERA 5DTBA 3SKPA 3FASA 3QSLA 2HFBA 2HXRA 5L9SA 4LN5A 1M5BA 4E0XA 4KD5A 5I2NB 5CMMA 3OEKA 1NNFA 1VE4A 4PTKA 1B5IA 2Z8EA 4EF2A 3C4MA 2I4BA 2QS1A 1B40A 2O51A 2QS3A 5H8QB 1DTGA 2ONKE 3PTYA 5B7DA 5H8HB 3FV2A 3PV0E 3MP6A 3PPPA 3ILTB 1UTBA 3TTRA 2DE4A 2ZYKA 4FIMA 2P3VA 3VVFA 1DSNA 2DSFA 5I2KB 3NOHA 5M2VA 1USYH 4K3FA 3FJ7A 3T9HB 5H8NA 1Y3QA 1QKBA 3O6GA 1N7XA 1FQFA 4U2RA 1N04A 1IZ1A 1R6ZA 3TUSA 3G3IA 4ZECA 4E0WA 1BK4A 1QKAA 2I49A 4X8RA 2Y5LA 2KQZA 3O66A 2ZYNA 4YKPA 4OFJA 1P1UA 4G61A 4QSCA 1IMBA 3T9UA 1N3WA 2I4CA 4MFIA 5KDTA 4IO7A 2QVRA 4F3BA 2GHAA 1CE2A 2Q8JA 3N6TA 3ZKKA 3JYRA 4YB5A 4NHBA 3C32A 4M1VA 4MHFA 4FJPA 4ELOA 2ZZVA 4WEDA 5H8FA 2VPOA 1QUKA 4MIJA 5ISUA 5F1QA 2QSXA 3OMBA 4U21A 1JW1A 1US5A 5AA2A 1EYIA 1YYZA 1XT8A 2GHBA 4FATA 3V83A 4OZ9A 1KZ8A 2GQ1A 4PFRA 2CEXA 5ESYA 1TFDA 2B3BA 4G77A 3LBSA 1N0TA 3KN7A 2X7PA 3TELA 2Y7RA 3CFZA 4XFEA 1PBQA 2XWKA 1URGA 3RUMA 3E79A 5AA2D 4JBZA 2XX8A 4PGNA 3ROJA 5B70A 2XXUA 4IO5A 2D3IA 2G93A 1NV6A 4ECFA 3GZGA 2ONSA 3IB1A 3OELA 4L17A 3SEYA 5ELVA 2QPQA 4KI0E 2ZMBA 3MVWA 4JSDA 3UORA 3K2DA 3TZAA 1Y3NA 2DWAA 4P0IA 1B0LA 3O2AA 3C31A 5IKBA 4JSOA 1XVYA 2FA7A 3PMXA 2UYFA 1URSA 3T93B 4GQOA 2AL4A 2X7QA 3TCHA 3TFLA 1PB8A 1LGBC 4F18A 4H8JA 2UVJA 5I2NA 2R6GE 1LAGE 2QMXA 5JK4A 1NH8A 3RNNA 4KFQA 1B5JA 2DWIA 4N15A 1N3XA 3V5AA 1SI0A 5H8QA 1FTKA 1ELJA 3G7WA 4H46A 3FBPA 5H8HA 3IOTA 1MQJA 3ZS6A 3O9PA 4MBPA 5I57B 1SBPA 1D9QA 2ZNSA 4Z0IA 1JP4A 5EHMA 5I2KA 1GV8A 3UGWA 4XIGQ 1SW5A 1LLSA 4OVJA 2AIXA 3PPNA 4NF4B 4OEVA 3QIMA 1QUIA 1FPKA 1FQEA 3PUVE 4N13A 1FTLA 1SVXB 2WBDA 1FPBA 2Y7KA 3LV0A 1FPGA 4GWUA 1P1QA 1PB7A 4KHZE 4LQ2A 4POXA 4ZE9A 5AA3A 3E13X 2RCBA 4GL0A 4PAFA 2F7CA 4I1DA 3OOAA 1LAFE 3H03A 3K6WA 4F3PA 1LAXA 4MJOA 4U1OA 3KZGA 1RKMA 3K1MA 1DOTA 1Q1KA 1SW2A 3HPIA 4NE4A 4PF8A 4F2QA 4IR8A 2XD2A 4O3BA 2THIA 4WKMA 1BTJA 4O3AA 2AYSA 4XTCQ 3UIFA 3KN3A 4MNCA 3N5LA 3IO6A 3K0VA 5IZ3B 1MRPA 4LATA 2PVUA 4JWXA 4X48A 1IMDA 2XXVA 1QJMA 5KZTA 3OO8A 2IEEA 3B7DA 4G68C 1Y1ZA 5CBSA 1FPEA 1B3GA 5A5LA 5EQ7A 5TPAB 1P1NA 4JVIA 1EU8A 4GWOA 3DLNA 1M5DA 2VGQA 3JV9A 1LFIA 2PCRA 4IO3A 1MY4A 1SD3A 1JEVA 5ET7A 5CM6A 3CG3A 2YJPA 1KWHA 4RA1A 2DVCA 2GRVA 2O84X 2DDKA 3BIGA 2XXYA 4YB6A 4O7MA 1GGGA 4MEVA 2ALUA 1PEBA 3BFTA 3T66A 1OIBA 3MPLA 2PMSA 3FD3A 2XXQA 2DXRA 1MY1A 3OO7A 3MW0A 1MH4A 1I69A 2H98A 1MG1A 4F19A 1H76A 4QFOA 1SW1A 4F29A 4G8HA 1XHYA 3LSXA 2H99A 1MPBA 1PB9A 2OK2A 2VD2A 2V3TA 1B2HA 3HO7A 3E4RA 2KR0A 2B4LA 3K4UA 4GX3A 4YAHX 3OENA 1WODA 1CNQA 2ZNTA 2I58A 1AWBA 2NUVA 2PBWA 4PBQA 4ZE8A 1URDA 3MPKA 3P7IA 2H5YA 5I57A 2PX1A 2O68A 4QFKA 3QYTA 4XXUA 3L6HA 1UIVA 5EQ9A 2XX9A 3BKIB 3B50A 4P47A 2FBPA 3K01A 3N6UA 4NAPA 3RPLB 3R6UA 1G0HA 1LB9A 4OVPA 4NF4A 2WX9A 1QULA 3OSRA 2Y7WA 4KPTA
chains in the Genus database with same CATH topology
4RJZA 1B05A 1N7WA 1JVXA 1R9LA 3IR1A 2XXTA 2F6GA 1O7TA 1MQDA 2UVGA 4RK9A 2UXAA 5ICTA 2HZLA 4KCDA 1MM7A 3M3KA 4F1UA 2Q88A 4H65A 2HZKA 4NTLA 3IOWA 3GLBA 4NWCA 1JVYA 4YKIA 3T9XB 3I5OA 1MS7A 3G3JA 4H5FA 3EHSA 4NF5B 3D4GA 3W9VA 4GRKA 4G4PA 4WEPA 5FHMA 1ATGA 1MH3A 2HAUA 4LQ5A 3TCFA 4GVOA 3W9WA 4X9TA 3RY3A 2GH9A 3M3FA 1B3HA 1VR5A 3VLVA 5CMCA 3QAXA 3MVXA 4KR5A 4QF9A 1MPDA 2FYIA 1BP5A 1J1NA 4RNSA 4BDQA 3IX1A 1B9JA 2VOZA 5TPAA 3TTMA 1IXCA 4QSDA 4FE8A 4XKQA 2R71A 3C33A 3ODBA 1F9BA 4QHQA 5L9OA 3MZ1A 4XKRA 2CMOA 5FHNA 5EYFA 3DELB 4IB2A 5LOMA 4DCXA 3CFXA 3KJ7A 1B0HA 2DQVA 4GLIA 4JB7A 3H6TA 4UACA 2PT1A 5JTYB 4DIGA 1MDQA 4H1XA 1UIUA 4LP2B 4OQOA 5FTIA 2VP1A 4LA9A 3FVGA 1Y20A 2V93A 3MZ9A 3GBBA 3KBRA 4KCCA 3Q25A 5BUUA 1ZBMA 3TAJA 5DYHA 1B3FA 2OWSA 3IL1B 3TTKA 5I84A 1H44A 3OEMA 1A99A 2RINA 2DWJA 4FORA 2R9JA 5HBCA 4GD5A 3WAFA 1XS5A 4NWDA 4ZEBA 2DE2A 4IGTA 1D9VA 3TQWA 2D21A 3N26A 1HSEA 3CG1A 3HHFA 3I6VA 4ELRA 2Y7PA 3CSGA 4HCYA 2O1LA 1SYIA 1XC1A 1B51A 3KJTA 3E9XA 3IO4A 1LFHA 4IGRA 4RYAA 4KYDA 3U93A 4R6KA 3U8QA 2DVZA 3PPRA 4U4XA 3QUJA 4KYSA 2G29A 2NOOA 4NF5A 4DCYA 4QFLA 4ZDMA 4R72A 2D5WA 1NKXA 1YAEA 2ANJA 2BJJX 2Z22A 5CMKA 1B52A 3KSXA 4ESXA 3RPWA 1FTOA 1PBPA 1S9TA 3EHUA 1M5FA 4RXLA 3FVKA 4EF1A 4GOTA 4EUOA 4OETA 1A8FA 1A55A 1WDNA 4N6PA 4BDLA 1MM6A 2I0CA 2KLFA 1IIWA 1IUDA 4XKNA 1QUJA 1JW5A 3WAEA 4BDMA 3SDFA 3MWBA 2DP8A 3H4ZA 2XX7A 4X1DA 3O6HA 3PD9A 3TTLA 4R75A 2DXYA 2ABHA 3B6TA 4FEBA 1LBBA 4U23A 1LSTA 1O64A 3K6UA 1MXXA 2V3UA 2H9BA 2DS9A 5KCJB 3PPQA 4O3CA 1ZLQA 4H8IA 2DOJA 2ESNA 3DP8A 3ZSFA 4UA8A 4Q8RA 1ZMGA 1Z7ME 1AMFA 4ZZEA 1R1NA 5JTYA 3N94A 4GXAA 3AXFA 1VSOA 3MP1A 3MUQA 1RYOA 4F31B 2Y7IA 3SEVA 4P0GA 2HAVA 3T22A 1TT1A 2FNCA 3IB0A 3ECRA 2REJA 1D3KA 3EHTA 2Q89A 1SI1A 3G3FA 3RTWB 1DTZA 2QMWA 1YTVA 1ZU0A 1JNFA 3RLFE 3THIA 3CIJA 4OYVA 2XXIA 3EF7A 1ZTYA 3U1OA 2RC7A 1CB6A 2RCAA 1IEJA 4I9DA 2RC9A 1NNKA 4YKJA 4R2BA 5L8DA 1PDAA 5I58B 1B4ZA 1FQCA 1B4HA 2V3QA 4PQJA 1FTJA 4R73A 3B6WA 3K02A 4ZEIA 4YMAA 4BLAA 1H3DA 4WXJA 1M5EA 4RPOA 4G8MA 4OENA 4QSEA 2DYXA 4LONB 4DDDA 5K2XA 3CI8A 4F1VA 2F7BA 2P1SA 4C1UA 1QVSA 3CR9A 2F7AA 1OMPA 3TPAA 1GTKA 1I6AA 3HV1A 1LAHE 4ZEFA 2NWJA 3Q28A 1NH7A 4OTEA 4IO4A 4NEDA 2V84A 2XHDA 4LZ7A 5L9MA 1Q35A 4BDNA 3VXBA 3VLWA 1OLAA 5CBRA 4ZEDA 1SQYA 1B7UA 2O7UA 4RK2A 2F34A 4OEUA 3S9MC 1T0KA 1B7HA 1PC3A 2RC8A 1OVBA 1LCTA 4Q30B 5CMBA 1S50A 1GVCA 3TODA 1IITA 3U72A 3PU5A 1MXVA 5TP9B 4PE5B 4TLLB 3A09A 1DPPA 4HCWA 3S9NC 3FATA 1D9YA 3FXUA 2OBGA 3FV1A 1RYXA 1I6QA 3VLUA 2Z8DA 2ONRA 3T9VA 3Q27A 1B1XA 1MY0A 1H43A 3MC2A 1EH3A 2HCAA 3TKDA 1MY2A 1P1OA 3MVZA 2WKYA 4YZZA 3S4UA 2NXOA 3PGFA 1TXFA 1XVXA 2M8CA 4QFNA 1D4NA 1TFAA 5KCJA 1B1HA 4F3SA 2XXRA 4DLDA 2Y84A 1EZPA 1IXGA 2Z8FA 2F8DA 1Y9UA 2P2AA 4IO2A 1ZKBA 1FTMA 3RGYA 4AB5A 4AB6A 2CZLA 4R9FA 5BWJA 4H5GA 5CC2A 3KOSA 3FJMA 3V8XB 3S2VA 1P1WA 3VVDA 3SETA 3FXRA 2QL3A 3GXAA 3LUYA 3CRBA 4IY6A 1JW4A 3JZJA 1Y1MA 4ISUA 2I6EA 1MQGA 3B6QA 3SEWA 3M3LA 4M4GA 1Z7NE 2F35A 3R26A 3OO6A 1IXIA 4ELPA 4RY1A 1UTHB 4OHNA 3H6VA 3A3UA 5I58A 2OZZA 1ANFA 5A5XB 4PFTA 2B65A 3UN6A 3OD7A 2H4IA 3G3HA 4TQUQ 3CVGA 3USDA 3KOTA 5AA4B 3ILUB 3TDJA 4R2FA 4DXBA 2NVUB 4R74A 1AL3A 5FTHA 2YLNA 4U22A 4G8NA 2XXXA 1VFDA 3VXCA 4R9GA 2OJTA 3KG2A 3FIRA 4OFOA 3IORA 3FVOA 2LAOA 1QW0A 1POTA 5EHSA 1FCKA 4PP0A 1ZIUA 4QFPA 4LUBA 2I0BA 3SEUA 2P0SA 1NNTA 4Z7EA 4AQ4A 1VFEA 2UYEA 4MH5A 5TP9A 2XXPA 1MXZA 3VFJA 3U94A 3H6UA 4DXUA 3M8UA 2XXHA 3KGCA 3H6WA 1B46A 5DT6A 3A3CA 4YU0A 3O29A 4Q0CA 4TOZA 5ICQA 1JEUA 2O6AA 1OLCA 2Q2AA 1SW4A 2I3VA 3SERA 3OXNA 3CFLA 4IO6A 4OESA 1LBCA 3IAZA 3GBAA 3UA8A 4PFYA 1AIVA 4H67A 3DP6A 3VDFA 5I59B 1NMUA 1NFTA 3UK4A 1ZJLA 3CSBA 3MBPA 4FECA 1OVTA 4F22A 4BDRA 4U4SA 4NF8B 5DVIA 1FQDA 5H8SA 3PUXE 3IJOB 2F78A 3PMVA 3D4CA 3E3KA 2UVHA 4G2ZA 4GIZA 4YMBA 4P11A 3IK6B 3DP4A 1A40A 3MQ9A 5ITOA 2OWTA 1MQIA 5AE4A 1UTHA 4NF6B 3H7MA 1JQFA 1NNPA 2PYYA 1O63A 1SDXA 3BFUA 5A5XA 3PMWA 3HSTA 1B58A 1N84A 3V89B 3RT6B 2V25A 1JETA 5HPQA 4FEDA 3RTFB 2VHAA 3R7XA 1P99A 3L6GA 3FZVA 4YICA 3QK6A 4YB7A 1N76A 5AA4A 3U92A 4N07A 3LR1A 4G68B 1A7LA 3MJNA 4I62A 2E0SA 3EPEA 2YPNA 2QS2A 1MQHA 1MXWA 1BKAA 4EXLA 2W7YA 2QS4A 4THIA 3O28A 1YPNA 1AH5A 4ONYA 4DE8A 2DWHA 4MLVA 1US4A 4ELQA 1Y4TA 3Q26A 4LVQA 4ZS9A 3G3KA 4ESWA 3F11A 2HQ0A 4OFLA 5DEXB 1MXYA 3C36A 4POWA 4EXKA 5F7VA 3IOVA 3RN8A 4DXCA 3SESA 1EZOA 3QUFA 1NL5A 2Q2CA 4EQ7A 5I56B 1II5A 3ONMA 1SYHA 4H6DA 3TMGA 4Q5TA 1FQAA 3O97A 3DM0A 3PUZE 1A8EA 1YCJA 2OLBA 2UVIA 4I8CA 5JEIA 2F6PA 5HM4B 1FQBA 1H45A 1Y4CA 3FXQA 4R6YA 4EQ9A 3PUYE 1B5HA 3S9LC 5IAIA 4PETA 4OWDA 3FUZA 3EN3A 4H0WA 1XOCA 5TU0A 5I59A 2I3WA 4KYEA 4C0RA 4JWOA 3I3VA 3PPOA 3TQLA 3LSWA 2B3FA 5CI5A 1B3EA 1B32A 4NF8A 4JXIA 3FJGA 5CRYA 3HCQA 4EQBA 2AL5A 4HTGA 4JWYA 1LB8A 1HSLA 2A5TB 3HHGA 3MZBA 1BLFA 5J1DA 3K00A 1MDP1 4BDOA 2XD3A 3IJXB 4NF6A 4KQPA 4R6HA 4GXSB 2O7IA 3IB2A 3ZKLA 1AOVA 3G3GA 4PFUA 3EQ1A 4F2OA 1WVJA 3H06B 1POY1 3MVYA 3S9EA 3RT8A 3MAMA 3PD8A 3HN0A 4C1TA 2HXWA 2DE3A 3LC8A 2F36A 4FAJA 4PFWA 4G68A 4JDFA 3O6IA 1IXHA 2VD3A 2QJEA 4GL8A 4DZ1A 1B7ZA 1FW0A 1LCFA 1B3LA 1DMBA 3FGSA 1MPCA 2IA4A 2F97A 1DPEA 1Y3PA 3LSFB 3BBRA 1EZ9A 4OXVA 2Q9TA 4MLQA 4U1ZA 1IQ7A 3PUWE 3SEXA 3IOUA 4RPNA 5DEXA 1UTBB 2ZYOA 3VV5A 5K2YA 1MXUA 3LSLA 2O69A 4HS7A 3KFMA 3K6VA 4OMBA 3C35A 3QXMA 2X26A 4GF8A 5H8NB 3OSQA 4X1BA 5I56A 2QRYA 3UP9A 1OQGA 4MF3A 2GFEA 5ITPA 1TWYA 2I48A 3T96B 3Q29A 2RF1A 1HSJA 4QRZA 5KDTB 3KSJA 4LZ8A 4ND9A 3RQTA 2H25A 4F3GA 4IY5A 1L5TA 3TCGA 1USYE 4ZEKA 3TTNA 5H8FB 3TEPA 1A54A 1S7YA 4F39A 4EDPA 1BIYA 4HW8A 3MP8A 2XXWA 4TLMB 2HEUA 4GFRA 5AA2B 3C34A 3TYHA 5DVFA 3K1NA 3KEIA 2Z23A 2E1SA 3FVNA 2OCUA 2A5TA 3H3GA 3KN8A 4YKKA 4LZ5A 2ZNUA 4F1YA 3VVEA 3VE1B 1GR2A 5AA1A 1OQHA 3K6XA 3OO9A 4NMYA 2ZXTA 2O1MA 3K1PA 2RKMA 3W15C 2REGA 4XKPA 1B6HA 1M5CA 2ZYMA 2F5XA 2PT2A 1I6BA 1UQWA 1R9QA 5DVJA 3C9HA 1MY3A 1LFGA 4ZZAA 5FHOA 2A5SA 4OERA 5DTBA 3SKPA 3FASA 3QSLA 2HFBA 5L9SA 1M5BA 4E0XA 4KD5A 5I2NB 5CMMA 3OEKA 1NNFA 1VE4A 1B5IA 2Z8EA 4EF2A 3C4MA 2I4BA 2QS1A 1B40A 2O51A 2QS3A 5H8QB 1DTGA 2ONKE 5B7DA 5H8HB 3FV2A 3PV0E 3MP6A 3PPPA 3ILTB 1UTBA 3TTRA 2DE4A 2ZYKA 4FIMA 3VVFA 1DSNA 2DSFA 5I2KB 5M2VA 1USYH 4K3FA 3FJ7A 3T9HB 5H8NA 1Y3QA 1QKBA 3O6GA 1N7XA 1FQFA 4U2RA 1N04A 1IZ1A 1R6ZA 3TUSA 3G3IA 4ZECA 4E0WA 1QKAA 2I49A 3O66A 2ZYNA 4YKPA 4OFJA 1P1UA 4QSCA 3T9UA 1N3WA 2I4CA 4MFIA 5KDTA 4IO7A 4F3BA 2GHAA 1CE2A 2Q8JA 3N6TA 3ZKKA 3JYRA 4YB5A 3C32A 4M1VA 4FJPA 4ELOA 4WEDA 5H8FA 1QUKA 5ISUA 5F1QA 2QSXA 3OMBA 4U21A 1JW1A 1US5A 5AA2A 2GHBA 1XT8A 4FATA 3V83A 4OZ9A 1TFDA 2B3BA 4G77A 3LBSA 1N0TA 3KN7A 2X7PA 3TELA 2Y7RA 3CFZA 1PBQA 1URGA 3RUMA 5AA2D 4JBZA 2XX8A 5B70A 2XXUA 4IO5A 2D3IA 2G93A 4ECFA 3GZGA 2ONSA 3IB1A 3OELA 4L17A 3SEYA 5ELVA 2QPQA 4KI0E 2ZMBA 3MVWA 4JSDA 3UORA 3K2DA 3TZAA 1Y3NA 2DWAA 4P0IA 1B0LA 3O2AA 3C31A 5IKBA 4JSOA 1XVYA 2FA7A 3PMXA 2UYFA 1URSA 3T93B 4GQOA 2AL4A 2X7QA 3TCHA 3TFLA 1PB8A 1LGBC 4F18A 4H8JA 2UVJA 5I2NA 2R6GE 1LAGE 2QMXA 5JK4A 1NH8A 3RNNA 4KFQA 1B5JA 2DWIA 1N3XA 3V5AA 1SI0A 5H8QA 1FTKA 1ELJA 3G7WA 5H8HA 3IOTA 1MQJA 3ZS6A 3O9PA 4MBPA 5I57B 1SBPA 2ZNSA 4Z0IA 5EHMA 5I2KA 1GV8A 3UGWA 4XIGQ 1SW5A 1LLSA 4OVJA 2AIXA 3PPNA 4NF4B 4OEVA 3QIMA 1QUIA 1FQEA 3PUVE 4N13A 1FTLA 1SVXB 2Y7KA 1P1QA 1PB7A 4KHZE 4LQ2A 4POXA 4ZE9A 5AA3A 3E13X 2RCBA 4GL0A 2F7CA 4I1DA 3OOAA 1LAFE 3H03A 3K6WA 4F3PA 1LAXA 4U1OA 3K1MA 1RKMA 3KZGA 1DOTA 1Q1KA 1SW2A 3HPIA 4NE4A 4F2QA 2XD2A 4O3BA 2THIA 4WKMA 1BTJA 4O3AA 2AYSA 4XTCQ 3UIFA 3KN3A 3N5LA 3IO6A 3K0VA 1MRPA 4LATA 2PVUA 4JWXA 4X48A 2XXVA 1QJMA 5KZTA 3OO8A 2IEEA 3B7DA 4G68C 1Y1ZA 5CBSA 1B3GA 5TPAB 1P1NA 1EU8A 4GWOA 3DLNA 1M5DA 2VGQA 3JV9A 1LFIA 4IO3A 1MY4A 1SD3A 1JEVA 5CM6A 3CG3A 2YJPA 1KWHA 4RA1A 2DVCA 2GRVA 2O84X 4YB6A 2XXYA 1GGGA 2ALUA 1PEBA 3BFTA 3T66A 1OIBA 3MPLA 2PMSA 3FD3A 2XXQA 2DXRA 1MY1A 3OO7A 3MW0A 1MH4A 1I69A 2H98A 1MG1A 4F19A 1H76A 4QFOA 1SW1A 4F29A 4G8HA 1XHYA 3LSXA 2H99A 1MPBA 1PB9A 2OK2A 2VD2A 2V3TA 1B2HA 3HO7A 3E4RA 3K4UA 4YAHX 3OENA 1WODA 2ZNTA 2I58A 2NUVA 2PBWA 4ZE8A 1URDA 3MPKA 3P7IA 2H5YA 5I57A 2PX1A 2O68A 4QFKA 3QYTA 4XXUA 3L6HA 1UIVA 2XX9A 3BKIB 3K01A 3N6UA 3R6UA 1LB9A 4NF4A 1QULA 3OSRA 2Y7WA 4KPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RJZ A;  1B05 A;  1N7W A;  1JVX A;  1R9L A;  3IR1 A;  2XXT A;  2F6G A;  1O7T A;  1MQD A;  2UVG A;  4RK9 A;  2UXA A;  5ICT A;  2HZL A;  4KCD A;  1MM7 A;  3M3K A;  4F1U A;  2Q88 A;  4H65 A;  2HZK A;  4NTL A;  3IOW A;  3GLB A;  4NWC A;  1JVY A;  4YKI A;  3T9X B;  3I5O A;  1MS7 A;  3G3J A;  4H5F A;  3EHS A;  4NF5 B;  3D4G A;  3W9V A;  4GRK A;  4G4P A;  4WEP A;  5FHM A;  1ATG A;  1MH3 A;  2HAU A;  4LQ5 A;  3TCF A;  4GVO A;  3W9W A;  4X9T A;  3RY3 A;  2GH9 A;  3M3F A;  1B3H A;  1VR5 A;  3VLV A;  5CMC A;  3QAX A;  3MVX A;  4KR5 A;  4QF9 A;  1MPD A;  2FYI A;  1BP5 A;  1J1N A;  4RNS A;  4BDQ A;  3IX1 A;  1B9J A;  2VOZ A;  5TPA A;  3TTM A;  1IXC A;  4QSD A;  4FE8 A;  4XKQ A;  2R71 A;  3C33 A;  3ODB A;  1F9B A;  4QHQ A;  5L9O A;  3MZ1 A;  4XKR A;  2CMO A;  5FHN A;  5EYF A;  3DEL B;  4IB2 A;  5LOM A;  4DCX A;  3CFX A;  3KJ7 A;  1B0H A;  2DQV A;  4GLI A;  4JB7 A;  3H6T A;  4UAC A;  2PT1 A;  5JTY B;  4DIG A;  1MDQ A;  4H1X A;  1UIU A;  4LP2 B;  4OQO A;  5FTI A;  2VP1 A;  4LA9 A;  3FVG A;  1Y20 A;  2V93 A;  3MZ9 A;  3GBB A;  3KBR A;  4KCC A;  3Q25 A;  5BUU A;  1ZBM A;  3TAJ A;  5DYH A;  1B3F A;  2OWS A;  3IL1 B;  3TTK A;  5I84 A;  1H44 A;  3OEM A;  1A99 A;  2RIN A;  2DWJ A;  4FOR A;  2R9J A;  5HBC A;  4GD5 A;  3WAF A;  1XS5 A;  4NWD A;  4ZEB A;  2DE2 A;  4IGT A;  1D9V A;  3TQW A;  2D21 A;  3N26 A;  1HSE A;  3CG1 A;  3HHF A;  3I6V A;  4ELR A;  2Y7P A;  3CSG A;  4HCY A;  2O1L A;  1SYI A;  1XC1 A;  1B51 A;  3KJT A;  3E9X A;  3IO4 A;  1LFH A;  4IGR A;  4RYA A;  4KYD A;  3U93 A;  4R6K A;  3U8Q A;  2DVZ A;  3PPR A;  4U4X A;  3QUJ A;  4KYS A;  2G29 A;  2NOO A;  4NF5 A;  4DCY A;  4QFL A;  4ZDM A;  4R72 A;  2D5W A;  1NKX A;  1YAE A;  2ANJ A;  2BJJ X;  2Z22 A;  5CMK A;  1B52 A;  3KSX A;  4ESX A;  3RPW A;  1FTO A;  1PBP A;  1S9T A;  3EHU A;  1M5F A;  4RXL A;  3FVK A;  4EF1 A;  4GOT A;  4EUO A;  4OET A;  1A8F A;  1A55 A;  1WDN A;  4N6P A;  4BDL A;  1MM6 A;  2I0C A;  2KLF A;  1IIW A;  1IUD A;  4XKN A;  1QUJ A;  1JW5 A;  3WAE A;  4BDM A;  3SDF A;  3MWB A;  2DP8 A;  3H4Z A;  2XX7 A;  4X1D A;  3O6H A;  3PD9 A;  3TTL A;  4R75 A;  2DXY A;  2ABH A;  3B6T A;  4FEB A;  1LBB A;  4U23 A;  1LST A;  1O64 A;  3K6U A;  1MXX A;  2V3U A;  2H9B A;  2DS9 A;  5KCJ B;  3PPQ A;  4O3C A;  1ZLQ A;  4H8I A;  2DOJ A;  2ESN A;  3DP8 A;  3ZSF A;  4UA8 A;  4Q8R A;  1ZMG A;  1Z7M E;  1AMF A;  4ZZE A;  1R1N A;  5JTY A;  3N94 A;  4GXA A;  3AXF A;  1VSO A;  3MP1 A;  3MUQ A;  1RYO A;  4F31 B;  2Y7I A;  3SEV A;  4P0G A;  2HAV A;  3T22 A;  1TT1 A;  2FNC A;  3IB0 A;  3ECR A;  2REJ A;  1D3K A;  3EHT A;  2Q89 A;  1SI1 A;  3G3F A;  3RTW B;  1DTZ A;  2QMW A;  1YTV A;  1ZU0 A;  1JNF A;  3RLF E;  3THI A;  3CIJ A;  4OYV A;  2XXI A;  3EF7 A;  1ZTY A;  3U1O A;  2RC7 A;  1CB6 A;  2RCA A;  1IEJ A;  4I9D A;  2RC9 A;  1NNK A;  4YKJ A;  4R2B A;  5L8D A;  1PDA A;  5I58 B;  1B4Z A;  1FQC A;  1B4H A;  2V3Q A;  4PQJ A;  1FTJ A;  4R73 A;  3B6W A;  3K02 A;  4ZEI A;  4YMA A;  4BLA A;  1H3D A;  4WXJ A;  1M5E A;  4RPO A;  4G8M A;  4OEN A;  4QSE A;  2DYX A;  4LON B;  4DDD A;  5K2X A;  3CI8 A;  4F1V A;  2F7B A;  2P1S A;  4C1U A;  1QVS A;  3CR9 A;  2F7A A;  1OMP A;  3TPA A;  1GTK A;  1I6A A;  3HV1 A;  1LAH E;  4ZEF A;  2NWJ A;  3Q28 A;  1NH7 A;  4OTE A;  4IO4 A;  4NED A;  2V84 A;  2XHD A;  4LZ7 A;  5L9M A;  1Q35 A;  4BDN A;  3VXB A;  3VLW A;  1OLA A;  5CBR A;  4ZED A;  1SQY A;  1B7U A;  2O7U A;  4RK2 A;  2F34 A;  4OEU A;  3S9M C;  1T0K A;  1B7H A;  1PC3 A;  2RC8 A;  1OVB A;  1LCT A;  4Q30 B;  5CMB A;  1S50 A;  1GVC A;  3TOD A;  1IIT A;  3U72 A;  3PU5 A;  1MXV A;  5TP9 B;  4PE5 B;  4TLL B;  3A09 A;  1DPP A;  4HCW A;  3S9N C;  3FAT A;  1D9Y A;  3FXU A;  2OBG A;  3FV1 A;  1RYX A;  1I6Q A;  3VLU A;  2Z8D A;  2ONR A;  3T9V A;  3Q27 A;  1B1X A;  1MY0 A;  1H43 A;  3MC2 A;  1EH3 A;  2HCA A;  3TKD A;  1MY2 A;  1P1O A;  3MVZ A;  2WKY A;  4YZZ A;  3S4U A;  2NXO A;  3PGF A;  1TXF A;  1XVX A;  2M8C A;  4QFN A;  1D4N A;  1TFA A;  5KCJ A;  1B1H A;  4F3S A;  2XXR A;  4DLD A;  2Y84 A;  1EZP A;  1IXG A;  2Z8F A;  2F8D A;  1Y9U A;  2P2A A;  4IO2 A;  1ZKB A;  1FTM A;  3RGY A;  4AB5 A;  4AB6 A;  2CZL A;  4R9F A;  5BWJ A;  4H5G A;  5CC2 A;  3KOS A;  3FJM A;  3V8X B;  3S2V A;  1P1W A;  3VVD A;  3SET A;  3FXR A;  2QL3 A;  3GXA A;  3LUY A;  3CRB A;  4IY6 A;  1JW4 A;  3JZJ A;  1Y1M A;  4ISU A;  2I6E A;  1MQG A;  3B6Q A;  3SEW A;  3M3L A;  4M4G A;  1Z7N E;  2F35 A;  3R26 A;  3OO6 A;  1IXI A;  4ELP A;  4RY1 A;  1UTH B;  4OHN A;  3H6V A;  3A3U A;  5I58 A;  2OZZ A;  1ANF A;  5A5X B;  4PFT A;  2B65 A;  3UN6 A;  3OD7 A;  2H4I A;  3G3H A;  4TQU Q;  3CVG A;  3USD A;  3KOT A;  5AA4 B;  3ILU B;  3TDJ A;  4R2F A;  4DXB A;  2NVU B;  4R74 A;  1AL3 A;  5FTH A;  2YLN A;  4U22 A;  4G8N A;  2XXX A;  1VFD A;  3VXC A;  4R9G A;  2OJT A;  3KG2 A;  3FIR A;  4OFO A;  3IOR A;  3FVO A;  2LAO A;  1QW0 A;  1POT A;  5EHS A;  1FCK A;  4PP0 A;  1ZIU A;  4QFP A;  4LUB A;  2I0B A;  3SEU A;  2P0S A;  1NNT A;  4Z7E A;  4AQ4 A;  1VFE A;  2UYE A;  4MH5 A;  5TP9 A;  2XXP A;  1MXZ A;  3VFJ A;  3U94 A;  3H6U A;  4DXU A;  3M8U A;  2XXH A;  3KGC A;  3H6W A;  1B46 A;  5DT6 A;  3A3C A;  4YU0 A;  3O29 A;  4Q0C A;  4TOZ A;  5ICQ A;  1JEU A;  2O6A A;  1OLC A;  2Q2A A;  1SW4 A;  2I3V A;  3SER A;  3OXN A;  3CFL A;  4IO6 A;  4OES A;  1LBC A;  3IAZ A;  3GBA A;  3UA8 A;  4PFY A;  1AIV A;  4H67 A;  3DP6 A;  3VDF A;  5I59 B;  1NMU A;  1NFT A;  3UK4 A;  1ZJL A;  3CSB A;  3MBP A;  4FEC A;  1OVT A;  4F22 A;  4BDR A;  4U4S A;  4NF8 B;  5DVI A;  1FQD A;  5H8S A;  3PUX E;  3IJO B;  2F78 A;  3PMV A;  3D4C A;  3E3K A;  2UVH A;  4G2Z A;  4GIZ A;  4YMB A;  4P11 A;  3IK6 B;  3DP4 A;  1A40 A;  3MQ9 A;  5ITO A;  2OWT A;  1MQI A;  5AE4 A;  1UTH A;  4NF6 B;  3H7M A;  1JQF A;  1NNP A;  2PYY A;  1O63 A;  1SDX A;  3BFU A;  5A5X A;  3PMW A;  3HST A;  1B58 A;  1N84 A;  3V89 B;  3RT6 B;  2V25 A;  1JET A;  5HPQ A;  4FED A;  3RTF B;  2VHA A;  3R7X A;  1P99 A;  3L6G A;  3FZV A;  4YIC A;  3QK6 A;  4YB7 A;  1N76 A;  5AA4 A;  3U92 A;  4N07 A;  3LR1 A;  4G68 B;  1A7L A;  3MJN A;  4I62 A;  2E0S A;  3EPE A;  2YPN A;  2QS2 A;  1MQH A;  1MXW A;  1BKA A;  4EXL A;  2W7Y A;  2QS4 A;  4THI A;  3O28 A;  1YPN A;  1AH5 A;  4ONY A;  4DE8 A;  2DWH A;  4MLV A;  1US4 A;  4ELQ A;  1Y4T A;  3Q26 A;  4LVQ A;  4ZS9 A;  3G3K A;  4ESW A;  3F11 A;  2HQ0 A;  4OFL A;  5DEX B;  1MXY A;  3C36 A;  4POW A;  4EXK A;  5F7V A;  3IOV A;  3RN8 A;  4DXC A;  3SES A;  1EZO A;  3QUF A;  1NL5 A;  2Q2C A;  4EQ7 A;  5I56 B;  1II5 A;  3ONM A;  1SYH A;  4H6D A;  3TMG A;  4Q5T A;  1FQA A;  3O97 A;  3DM0 A;  3PUZ E;  1A8E A;  1YCJ A;  2OLB A;  2UVI A;  4I8C A;  5JEI A;  2F6P A;  5HM4 B;  1FQB A;  1H45 A;  1Y4C A;  3FXQ A;  4R6Y A;  4EQ9 A;  3PUY E;  1B5H A;  3S9L C;  5IAI A;  4PET A;  4OWD A;  3FUZ A;  3EN3 A;  4H0W A;  1XOC A;  5TU0 A;  5I59 A;  2I3W A;  4KYE A;  4C0R A;  4JWO A;  3I3V A;  3PPO A;  3TQL A;  3LSW A;  2B3F A;  5CI5 A;  1B3E A;  1B32 A;  4NF8 A;  4JXI A;  3FJG A;  5CRY A;  3HCQ A;  4EQB A;  2AL5 A;  4HTG A;  4JWY A;  1LB8 A;  1HSL A;  2A5T B;  3HHG A;  3MZB A;  1BLF A;  5J1D A;  3K00 A;  1MDP 1;  4BDO A;  2XD3 A;  3IJX B;  4NF6 A;  4KQP A;  4R6H A;  4GXS B;  2O7I A;  3IB2 A;  3ZKL A;  1AOV A;  3G3G A;  4PFU A;  3EQ1 A;  4F2O A;  1WVJ A;  3H06 B;  1POY 1;  3MVY A;  3S9E A;  3RT8 A;  3MAM A;  3PD8 A;  3HN0 A;  4C1T A;  2HXW A;  2DE3 A;  3LC8 A;  2F36 A;  4FAJ A;  4PFW A;  4G68 A;  4JDF A;  3O6I A;  1IXH A;  2VD3 A;  2QJE A;  4GL8 A;  4DZ1 A;  1B7Z A;  1FW0 A;  1LCF A;  1B3L A;  1DMB A;  3FGS A;  1MPC A;  2IA4 A;  2F97 A;  1DPE A;  1Y3P A;  3LSF B;  3BBR A;  1EZ9 A;  4OXV A;  2Q9T A;  4MLQ A;  4U1Z A;  1IQ7 A;  3PUW E;  3SEX A;  3IOU A;  4RPN A;  5DEX A;  1UTB B;  2ZYO A;  3VV5 A;  5K2Y A;  1MXU A;  3LSL A;  2O69 A;  4HS7 A;  3KFM A;  3K6V A;  4OMB A;  3C35 A;  3QXM A;  2X26 A;  4GF8 A;  5H8N B;  3OSQ A;  4X1B A;  5I56 A;  2QRY A;  3UP9 A;  1OQG A;  4MF3 A;  2GFE A;  5ITP A;  1TWY A;  2I48 A;  3T96 B;  3Q29 A;  2RF1 A;  1HSJ A;  4QRZ A;  5KDT B;  3KSJ A;  4LZ8 A;  4ND9 A;  3RQT A;  2H25 A;  4F3G A;  4IY5 A;  1L5T A;  3TCG A;  1USY E;  4ZEK A;  3TTN A;  5H8F B;  3TEP A;  1A54 A;  1S7Y A;  4F39 A;  4EDP A;  1BIY A;  4HW8 A;  3MP8 A;  2XXW A;  4TLM B;  2HEU A;  4GFR A;  5AA2 B;  3C34 A;  3TYH A;  5DVF A;  3K1N A;  3KEI A;  2Z23 A;  2E1S A;  3FVN A;  2OCU A;  2A5T A;  3H3G A;  3KN8 A;  4YKK A;  4LZ5 A;  2ZNU A;  4F1Y A;  3VVE A;  3VE1 B;  1GR2 A;  5AA1 A;  1OQH A;  3K6X A;  3OO9 A;  4NMY A;  2ZXT A;  2O1M A;  3K1P A;  2RKM A;  3W15 C;  2REG A;  4XKP A;  1B6H A;  1M5C A;  2ZYM A;  2F5X A;  2PT2 A;  1I6B A;  1UQW A;  1R9Q A;  5DVJ A;  3C9H A;  1MY3 A;  1LFG A;  4ZZA A;  5FHO A;  2A5S A;  4OER A;  5DTB A;  3SKP A;  3FAS A;  3QSL A;  2HFB A;  5L9S A;  1M5B A;  4E0X A;  4KD5 A;  5I2N B;  5CMM A;  3OEK A;  1NNF A;  1VE4 A;  1B5I A;  2Z8E A;  4EF2 A;  3C4M A;  2I4B A;  2QS1 A;  1B40 A;  2O51 A;  2QS3 A;  5H8Q B;  1DTG A;  2ONK E;  5B7D A;  5H8H B;  3FV2 A;  3PV0 E;  3MP6 A;  3PPP A;  3ILT B;  1UTB A;  3TTR A;  2DE4 A;  2ZYK A;  4FIM A;  3VVF A;  1DSN A;  2DSF A;  5I2K B;  5M2V A;  1USY H;  4K3F A;  3FJ7 A;  3T9H B;  5H8N A;  1Y3Q A;  1QKB A;  3O6G A;  1N7X A;  1FQF A;  4U2R A;  1N04 A;  1IZ1 A;  1R6Z A;  3TUS A;  3G3I A;  4ZEC A;  4E0W A;  1QKA A;  2I49 A;  3O66 A;  2ZYN A;  4YKP A;  4OFJ A;  1P1U A;  4QSC A;  3T9U A;  1N3W A;  2I4C A;  4MFI A;  5KDT A;  4IO7 A;  4F3B A;  2GHA A;  1CE2 A;  2Q8J A;  3N6T A;  3ZKK A;  3JYR A;  4YB5 A;  3C32 A;  4M1V A;  4FJP A;  4ELO A;  4WED A;  5H8F A;  1QUK A;  5ISU A;  5F1Q A;  2QSX A;  3OMB A;  4U21 A;  1JW1 A;  1US5 A;  5AA2 A;  2GHB A;  1XT8 A;  4FAT A;  3V83 A;  4OZ9 A;  1TFD A;  2B3B A;  4G77 A;  3LBS A;  1N0T A;  3KN7 A;  2X7P A;  3TEL A;  2Y7R A;  3CFZ A;  1PBQ A;  1URG A;  3RUM A;  5AA2 D;  4JBZ A;  2XX8 A;  5B70 A;  2XXU A;  4IO5 A;  2D3I A;  2G93 A;  4ECF A;  3GZG A;  2ONS A;  3IB1 A;  3OEL A;  4L17 A;  3SEY A;  5ELV A;  2QPQ A;  4KI0 E;  2ZMB A;  3MVW A;  4JSD A;  3UOR A;  3K2D A;  3TZA A;  1Y3N A;  2DWA A;  4P0I A;  1B0L A;  3O2A A;  3C31 A;  5IKB A;  4JSO A;  1XVY A;  2FA7 A;  3PMX A;  2UYF A;  1URS A;  3T93 B;  4GQO A;  2AL4 A;  2X7Q A;  3TCH A;  3TFL A;  1PB8 A;  1LGB C;  4F18 A;  4H8J A;  2UVJ A;  5I2N A;  2R6G E;  1LAG E;  2QMX A;  5JK4 A;  1NH8 A;  3RNN A;  4KFQ A;  1B5J A;  2DWI A;  1N3X A;  3V5A A;  1SI0 A;  5H8Q A;  1FTK A;  1ELJ A;  3G7W A;  5H8H A;  3IOT A;  1MQJ A;  3ZS6 A;  3O9P A;  4MBP A;  5I57 B;  1SBP A;  2ZNS A;  4Z0I A;  5EHM A;  5I2K A;  1GV8 A;  3UGW A;  4XIG Q;  1SW5 A;  1LLS A;  4OVJ A;  2AIX A;  3PPN A;  4NF4 B;  4OEV A;  3QIM A;  1QUI A;  1FQE A;  3PUV E;  4N13 A;  1FTL A;  1SVX B;  2Y7K A;  1P1Q A;  1PB7 A;  4KHZ E;  4LQ2 A;  4POX A;  4ZE9 A;  5AA3 A;  3E13 X;  2RCB A;  4GL0 A;  2F7C A;  4I1D A;  3OOA A;  1LAF E;  3H03 A;  3K6W A;  4F3P A;  1LAX A;  4U1O A;  3K1M A;  1RKM A;  3KZG A;  1DOT A;  1Q1K A;  1SW2 A;  3HPI A;  4NE4 A;  4F2Q A;  2XD2 A;  4O3B A;  2THI A;  4WKM A;  1BTJ A;  4O3A A;  2AYS A;  4XTC Q;  3UIF A;  3KN3 A;  3N5L A;  3IO6 A;  3K0V A;  1MRP A;  4LAT A;  2PVU A;  4JWX A;  4X48 A;  2XXV A;  1QJM A;  5KZT A;  3OO8 A;  2IEE A;  3B7D A;  4G68 C;  1Y1Z A;  5CBS A;  1B3G A;  5TPA B;  1P1N A;  1EU8 A;  4GWO A;  3DLN A;  1M5D A;  2VGQ A;  3JV9 A;  1LFI A;  4IO3 A;  1MY4 A;  1SD3 A;  1JEV A;  5CM6 A;  3CG3 A;  2YJP A;  1KWH A;  4RA1 A;  2DVC A;  2GRV A;  2O84 X;  4YB6 A;  2XXY A;  1GGG A;  2ALU A;  1PEB A;  3BFT A;  3T66 A;  1OIB A;  3MPL A;  2PMS A;  3FD3 A;  2XXQ A;  2DXR A;  1MY1 A;  3OO7 A;  3MW0 A;  1MH4 A;  1I69 A;  2H98 A;  1MG1 A;  4F19 A;  1H76 A;  4QFO A;  1SW1 A;  4F29 A;  4G8H A;  1XHY A;  3LSX A;  2H99 A;  1MPB A;  1PB9 A;  2OK2 A;  2VD2 A;  2V3T A;  1B2H A;  3HO7 A;  3E4R A;  3K4U A;  4YAH X;  3OEN A;  1WOD A;  2ZNT A;  2I58 A;  2NUV A;  2PBW A;  4ZE8 A;  1URD A;  3MPK A;  3P7I A;  2H5Y A;  5I57 A;  2PX1 A;  2O68 A;  4QFK A;  3QYT A;  4XXU A;  3L6H A;  1UIV A;  2XX9 A;  3BKI B;  3K01 A;  3N6U A;  3R6U A;  1LB9 A;  4NF4 A;  1QUL A;  3OSR A;  2Y7W A;  4KPT A; 
#chains in the Genus database with same CATH topology
 4RJZ A;  1B05 A;  1N7W A;  1JVX A;  4DI3 D;  1R9L A;  3IR1 A;  2XXT A;  4N17 A;  1NUX A;  2F6G A;  4N81 A;  3KBZ A;  1RDY A;  1O7T A;  3HFU A;  1MQD A;  2UVG A;  4RK9 A;  2UXA A;  5ICT A;  2HZL A;  4KCD A;  4OVQ A;  1MM7 A;  4GWZ A;  3M3K A;  1YZ0 A;  2Q88 A;  4H65 A;  5IZ1 A;  4F1U A;  2HZK A;  4NTL A;  3IOW A;  3GLB A;  4PCD A;  4NWC A;  4HE1 A;  1JVY A;  4YKI A;  3T9X B;  3I5O A;  2XWO A;  1MS7 A;  3G3J A;  4H5F A;  3EHS A;  4NF5 B;  3D4G A;  2V4C A;  3W9V A;  4GRK A;  4G4P A;  4WEP A;  1YXI A;  5FHM A;  1ATG A;  1MH3 A;  2HAU A;  4LQ5 A;  3TCF A;  4GVO A;  3W9W A;  4X9T A;  1FPF A;  5IZ3 A;  3RY3 A;  2GH9 A;  3M3F A;  1B3H A;  1VR5 A;  1IMA A;  3VLV A;  5CMC A;  3QAX A;  3MVX A;  4XEQ A;  4KR5 A;  4QF9 A;  4I3E A;  1FJ6 A;  1MPD A;  5T3J A;  2FYI A;  1BP5 A;  1J1N A;  4RNS A;  4BDQ A;  3T1B A;  3IX1 A;  1B9J A;  2VOZ A;  5TPA A;  3TTM A;  1IXC A;  5EYG A;  4QSD A;  4FE8 A;  4XKQ A;  2R71 A;  3C33 A;  3ODB A;  4PGP A;  2F3D A;  4PDH A;  1F9B A;  4QHQ A;  5L9O A;  3MZ1 A;  4OVS A;  4XKR A;  2CMO A;  5FHN A;  5EYF A;  3DEL B;  4IB2 A;  2FVZ A;  5LTC A;  5LOM A;  4I3Y A;  4DCX A;  3CFX A;  3KJ7 A;  1B0H A;  2DQV A;  4GLI A;  4JB7 A;  4NX1 A;  3H6T A;  4UAC A;  2PT1 A;  5JTY B;  4MMP A;  4DIG A;  1MDQ A;  4H1X A;  1UIU A;  4LP2 B;  4OQO A;  5FTI A;  2VP1 A;  3MST A;  4LA9 A;  3FVG A;  1Y20 A;  2V93 A;  3MZ9 A;  1FTA A;  1FBG A;  3FXB A;  3GBB A;  1DCU A;  3KBR A;  4KCC A;  3Q25 A;  5BUU A;  1ZBM A;  2FHY A;  3TAJ A;  5DYH A;  1B3F A;  2OWS A;  1NV7 A;  4N6K A;  3IL1 B;  1LEV A;  3TTK A;  5I84 A;  1H44 A;  1NV5 A;  3OEM A;  1A99 A;  2RIN A;  4PAI A;  2DWJ A;  4FOR A;  2QVV A;  3RPL A;  2R9J A;  1Q9D A;  4GD5 A;  5HBC A;  3WAF A;  4N6D A;  4PFB A;  4GWW A;  1XS5 A;  4NWD A;  4ZEB A;  2DE2 A;  4IGT A;  1D9V A;  3TQW A;  2D21 A;  3N26 A;  1HSE A;  3CG1 A;  3HHF A;  3I6V A;  4ELR A;  2Y7P A;  3CSG A;  4HCY A;  2O1L A;  4FBP A;  1SYI A;  1XC1 A;  1B51 A;  3KJT A;  4JVD A;  3E9X A;  3IO4 A;  3IFC A;  2QVU A;  1LFH A;  4IGR A;  4RYA A;  4KYD A;  3U93 A;  4R6K A;  3U8Q A;  2DVZ A;  3PPR A;  4N8G A;  4U4X A;  3QUJ A;  4KYS A;  2G29 A;  2NOO A;  4NF5 A;  4DCY A;  4QFL A;  4ZDM A;  4R72 A;  2D5W A;  1NKX A;  4PAK A;  4PC9 A;  1YAE A;  2ANJ A;  2BJJ X;  2Z22 A;  5CMK A;  2WBB A;  1B52 A;  1EYJ A;  2QFL A;  3KSX A;  4ESX A;  3RPW A;  1FTO A;  4QBA A;  1PBP A;  1LBW A;  1S9T A;  3EHU A;  1M5F A;  1FBC A;  4RXL A;  3FVK A;  2JJK A;  4EF1 A;  4GOT A;  4EUO A;  5I3S A;  4OET A;  1A8F A;  1NV1 A;  1A55 A;  1K9Z A;  1WDN A;  4N6P A;  4BDL A;  1MM6 A;  2I0C A;  2KLF A;  1IIW A;  1IUD A;  4XKN A;  1QUJ A;  1JW5 A;  3WAE A;  4BDM A;  3SDF A;  3MWB A;  2DP8 A;  3H4Z A;  2XX7 A;  4X1D A;  3O6H A;  3PD9 A;  3TTL A;  4R75 A;  2DXY A;  3MYU A;  2ABH A;  3B6T A;  4FEB A;  1LBB A;  4KXP A;  4U23 A;  1LST A;  1DBZ A;  1O64 A;  3K6U A;  1MXX A;  2V3U A;  2H9B A;  2DS9 A;  4HXV A;  5KCJ B;  3PPQ A;  4O3C A;  1ZLQ A;  4H8I A;  1FBH A;  2DOJ A;  2ESN A;  3DP8 A;  3ZSF A;  4UA8 A;  4Q8R A;  1ZMG A;  1Z7M E;  1AMF A;  5F24 A;  4ZZE A;  1R1N A;  5JTY A;  3N94 A;  4GXA A;  3AXF A;  1VSO A;  3MP1 A;  3MUQ A;  1RYO A;  4F31 B;  2Y7I A;  3SEV A;  4P0G A;  2HAV A;  3T22 A;  1TT1 A;  2FNC A;  4P1E A;  3IB0 A;  3ECR A;  2REJ A;  1D3K A;  3EHT A;  4PF6 A;  2Q89 A;  1SI1 A;  4PFI A;  5IM2 A;  3G3F A;  3RTW B;  1DTZ A;  2QMW A;  1YTV A;  1ZU0 A;  1JNF A;  3RLF E;  3THI A;  3CIJ A;  3KC0 A;  4OYV A;  2XXI A;  3EF7 A;  1ZTY A;  3U1O A;  2RC7 A;  1CB6 A;  2RCA A;  1IEJ A;  4I9D A;  2RC9 A;  1NNK A;  4YKJ A;  2CZH A;  4QXD A;  4R2B A;  5L8D A;  1PDA A;  5I58 B;  1B4Z A;  1FQC A;  1B4H A;  2HHM A;  2V3Q A;  4PQJ A;  4R73 A;  1FTJ A;  3B6W A;  3K02 A;  4ZEI A;  3D1R A;  4YMA A;  4BLA A;  5J16 A;  1H3D A;  4WXJ A;  1M5E A;  4RPO A;  4G8M A;  4OEN A;  4QSE A;  2DYX A;  4LON B;  4DDD A;  5K2X A;  3CI8 A;  4F1V A;  4PDD A;  2F7B A;  2P1S A;  4C1U A;  1QVS A;  3CR9 A;  2F7A A;  1OMP A;  3TPA A;  1EYK A;  1GTK A;  1I6A A;  4GWY A;  2PFZ A;  3HV1 A;  4GWS A;  1LAH E;  4ZEF A;  4AS4 A;  2WYP A;  2NWJ A;  3Q28 A;  1NH7 A;  4OTE A;  4IO4 A;  4NED A;  2V84 A;  2XHD A;  4LZ7 A;  5L9M A;  4OVR A;  1Q35 A;  4BDN A;  3VXB A;  3VLW A;  3U65 A;  1OLA A;  5CBR A;  4ZED A;  1SQY A;  1B7U A;  2O7U A;  4RK2 A;  2R8T A;  2CZK A;  2F34 A;  4OEU A;  3S9M C;  1T0K A;  1FPD A;  1B7H A;  1PC3 A;  2RC8 A;  1OVB A;  1LCT A;  4Q30 B;  5CMB A;  1S50 A;  1GVC A;  3TOD A;  1IME A;  1IIT A;  3U72 A;  3PU5 A;  1MXV A;  5TP9 B;  4PE5 B;  4TLL B;  3A09 A;  1DPP A;  4HCW A;  3S9N C;  3FAT A;  1D9Y A;  3CHG A;  3FXU A;  2OBG A;  3FV1 A;  1RYX A;  1I6Q A;  3VLU A;  2OX3 A;  2Z8D A;  2ONR A;  3T9V A;  1K9Y A;  3Q27 A;  1B1X A;  1MY0 A;  1H43 A;  3MC2 A;  1EH3 A;  2HCA A;  3TKD A;  1MY2 A;  1LBV A;  1P1O A;  2XA5 A;  3MVZ A;  2WKY A;  4YZZ A;  2VPN A;  3S4U A;  2NXO A;  3PGF A;  1TXF A;  2XWV A;  1XVX A;  2M8C A;  4QFN A;  1D4N A;  1TFA A;  3BIH A;  5KCJ A;  1B1H A;  1FJ9 A;  4F3S A;  2XXR A;  4DLD A;  1FPL A;  2Y84 A;  1EZP A;  4OAN A;  1IXG A;  2Z8F A;  2F8D A;  1Y9U A;  2L5V A;  2P2A A;  4IO2 A;  1ZKB A;  3LUZ A;  1FTM A;  4I40 A;  3RGY A;  4AB5 A;  4AB6 A;  2CZL A;  4R9F A;  4NG7 A;  5BWJ A;  4H5G A;  5CC2 A;  3KOS A;  3FJM A;  4JVC A;  3V8X B;  3S2V A;  1P1W A;  4HE2 A;  3VVD A;  2ZZX A;  3FXR A;  3SET A;  2QL3 A;  3GXA A;  3LUY A;  3CRB A;  3A29 A;  4IY6 A;  1JW4 A;  3JZJ A;  1Y1M A;  4ISU A;  2I6E A;  5IZZ A;  1MQG A;  3B6Q A;  3SEW A;  3M3L A;  4M4G A;  1Z7N E;  2F35 A;  3R26 A;  3OO6 A;  1IXI A;  4ELP A;  4RY1 A;  1UTH B;  5ET8 A;  4OHN A;  1NV2 A;  3H6V A;  3A3U A;  5I58 A;  2OZZ A;  1ANF A;  5A5X B;  4PFT A;  2B65 A;  3UN6 A;  3OD7 A;  2H4I A;  3G3H A;  4TQU Q;  3CVG A;  3USD A;  4H45 A;  2WEF A;  4XF5 A;  2CEY A;  3KOT A;  5AA4 B;  3KC1 A;  1INP A;  3ILU B;  5EYH A;  3TDJ A;  4R2F A;  4DXB A;  2NVU B;  4R74 A;  1AL3 A;  5FTH A;  2YLN A;  4U22 A;  4G8N A;  2XXX A;  1VFD A;  3VXC A;  4R9G A;  2OJT A;  3KG2 A;  3B8B A;  3FIR A;  4OFO A;  3IOR A;  1FBP A;  3FVO A;  2LAO A;  1QW0 A;  1POT A;  5EHS A;  1FCK A;  4GWX A;  1NI9 A;  4PP0 A;  1ZIU A;  4QFP A;  4LUB A;  2I0B A;  3SEU A;  5ET5 A;  2P0S A;  4OVT A;  1NNT A;  4Z7E A;  2FIX A;  4AQ4 A;  4NQ8 A;  1VFE A;  2UYE A;  4MH5 A;  5TP9 A;  2XXP A;  1MXZ A;  3VFJ A;  3U94 A;  3H6U A;  4P3L A;  4DXU A;  3M8U A;  2XXH A;  3KGC A;  3H6W A;  1B46 A;  5DT6 A;  3A3C A;  4YU0 A;  4O94 A;  3O29 A;  4Q0C A;  4TOZ A;  1FBE A;  5ICQ A;  1JEU A;  2O6A A;  1OLC A;  2Q2A A;  4X04 A;  1SW4 A;  1RDZ A;  2I3V A;  3SER A;  3OXN A;  3CFL A;  4IO6 A;  2WYK A;  4OES A;  1LBC A;  3IAZ A;  3GBA A;  3UA8 A;  4PFY A;  1AIV A;  4MCO A;  4H67 A;  5IGA A;  3DP6 A;  1XI6 A;  3VDF A;  5I59 B;  3EKI A;  1NMU A;  1NFT A;  3UK4 A;  1ZJL A;  3CSB A;  3MBP A;  4FEC A;  1OVT A;  5EQ8 A;  4F22 A;  2XXK A;  1FRP A;  4BDR A;  4U4S A;  4NF8 B;  5DVI A;  1FQD A;  4PBH A;  5H8S A;  2BJI A;  3PUX E;  3IJO B;  2F78 A;  3PMV A;  3D4C A;  3E3K A;  2UVH A;  4G2Z A;  2FIE A;  4GIZ A;  4YMB A;  4PE3 A;  4P11 A;  3IK6 B;  1VDW A;  3DP4 A;  4NGU A;  1A40 A;  3MQ9 A;  5ITO A;  2OWT A;  1MQI A;  5AE4 A;  1UTH A;  4NF6 B;  3H7M A;  1JQF A;  1NNP A;  2PYY A;  1O63 A;  2Y5K A;  1SDX A;  3BFU A;  5A5X A;  3PMW A;  3HST A;  4GX6 A;  1B58 A;  1N84 A;  3V89 B;  3RT6 B;  2V25 A;  1JET A;  5HPQ A;  4FED A;  1FBD A;  3RTF B;  2VHA A;  3R7X A;  5I7I A;  1P99 A;  3L6G A;  3FZV A;  4YIC A;  3QK6 A;  4YB7 A;  1N76 A;  5AA4 A;  3U92 A;  4N07 A;  3LR1 A;  4G68 B;  1A7L A;  3MJN A;  4I62 A;  1RDX A;  2E0S A;  3EPE A;  1NV0 A;  2YPN A;  2QS2 A;  1MQH A;  1MXW A;  1NUY A;  1BKA A;  4EXL A;  4GX4 A;  2W7Y A;  2QS4 A;  1NV3 A;  4THI A;  3O28 A;  4O8M A;  3T0J A;  1YPN A;  1AH5 A;  4ONY A;  4DE8 A;  2DWH A;  4MLV A;  1US4 A;  4ELQ A;  1Y4T A;  3Q26 A;  4LVQ A;  4ZS9 A;  3G3K A;  4ESW A;  3F11 A;  2HQ0 A;  4OFL A;  5DEX B;  1MXY A;  3C36 A;  4POW A;  4EXK A;  5F7V A;  3IOV A;  3RN8 A;  2HPG A;  4HE0 A;  4DXC A;  3SES A;  1EZO A;  3QUF A;  1NL5 A;  2Q2C A;  5I5P A;  4EQ7 A;  5I56 B;  1II5 A;  3ONM A;  1SYH A;  4H6D A;  3TMG A;  4Q5T A;  1FQA A;  2OWZ A;  3O97 A;  4OA4 A;  3DM0 A;  3PUZ E;  3ISP A;  1A8E A;  1YCJ A;  1NV4 A;  2OLB A;  2UVI A;  4I8C A;  2PFY A;  4MX6 A;  4UAB A;  5JEI A;  2F6P A;  5HM4 B;  1FQB A;  1H45 A;  1Y4C A;  3QMF A;  3FXQ A;  4R6Y A;  4EQ9 A;  3PUY E;  1B5H A;  3S9L C;  5IAI A;  4PET A;  4OWD A;  3FUZ A;  3EN3 A;  1IMC A;  4H0W A;  1XOC A;  1NUW A;  5TU0 A;  5I59 A;  2I3W A;  4KYE A;  4C0R A;  4JWO A;  3I3V A;  4N91 A;  3PPO A;  3TQL A;  3LSW A;  2B3F A;  5CI5 A;  1B3E A;  1B32 A;  4NF8 A;  4JXI A;  3FJG A;  5CRY A;  4NN3 A;  3HCQ A;  2Q8M A;  4P56 A;  4EQB A;  2AL5 A;  4HTG A;  4JWY A;  1LB8 A;  1LBZ A;  1HSL A;  4N4U A;  2A5T B;  2VT5 A;  3HHG A;  3MZB A;  1BLF A;  5J1D A;  4N8Y A;  4NF0 A;  5LDZ A;  3K00 A;  1MDP 1;  4BDO A;  2XD3 A;  1QGX A;  3IJX B;  4NF6 A;  4KQP A;  1SPI A;  4O7I A;  4R6H A;  4GXS B;  2O7I A;  3IB2 A;  3ZKL A;  1AOV A;  3G3G A;  4PFU A;  3EQ1 A;  5EQA A;  4F2O A;  1WVJ A;  3H06 B;  1POY 1;  3MVY A;  3S9E A;  3RT8 A;  3MAM A;  3PD8 A;  3HN0 A;  4C1T A;  2HXW A;  2DE3 A;  3LC8 A;  2F36 A;  4FAJ A;  4PFW A;  1DK4 A;  4G68 A;  3RYD A;  4JDF A;  3O6I A;  1IXH A;  2VD3 A;  2QJE A;  4GL8 A;  4DZ1 A;  1B7Z A;  1FW0 A;  1LCF A;  1B3L A;  1DMB A;  2XWI A;  3FGS A;  1MPC A;  2IA4 A;  2F97 A;  1IMF A;  1DPE A;  4P8B A;  1Y3P A;  1KA0 A;  3LSF B;  3BBR A;  1EZ9 A;  4OXV A;  2Q9T A;  2B4M A;  4MLQ A;  4U1Z A;  1IQ7 A;  3PUW E;  3SEX A;  1FBF A;  3IOU A;  2P3N A;  4RPN A;  5DEX A;  1FSA A;  1UTB B;  2ZYO A;  3VV5 A;  5K2Y A;  1MXU A;  3LSL A;  1KA1 A;  2O69 A;  4DI4 B;  4HS7 A;  4MNP A;  3KFM A;  3K6V A;  4OMB A;  4AS5 A;  3C35 A;  3QXM A;  2X26 A;  4GF8 A;  5H8N B;  3OSQ A;  4X1B A;  5I56 A;  2QRY A;  3UP9 A;  1OQG A;  4MF3 A;  2GFE A;  5ITP A;  1TWY A;  4P1L A;  2I48 A;  3E78 A;  3T96 B;  3Q29 A;  3GYY A;  1FPI A;  2RF1 A;  1HSJ A;  2CZI A;  4QRZ A;  5KDT B;  2ZZW A;  3KSJ A;  4GBW A;  4LZ8 A;  4ND9 A;  3RQT A;  2Q74 A;  3SZP A;  2H25 A;  4F3G A;  4IY5 A;  4MNI A;  1L5T A;  3TCG A;  1USY E;  4ZEK A;  3TTN A;  5H8F B;  3TEP A;  1A54 A;  1S7Y A;  4P9K A;  4F39 A;  4EDP A;  1BIY A;  4HW8 A;  3MP8 A;  2XXW A;  4TLM B;  2HEU A;  4GFR A;  5AA2 B;  2F3B A;  1NUZ A;  3C34 A;  3TYH A;  1FPJ A;  5DVF A;  3K1N A;  3KEI A;  1LBY A;  2Z23 A;  2E1S A;  4GBV A;  3FVN A;  2OCU A;  2A5T A;  3H3G A;  3KN8 A;  2MKZ A;  4YKK A;  4LZ5 A;  2ZNU A;  4F1Y A;  4MAG A;  3IFA A;  3VVE A;  3VE1 B;  1GR2 A;  5AA1 A;  1OQH A;  3K6X A;  3OO9 A;  4NMY A;  2ZXT A;  5DW8 A;  2O1M A;  3K1P A;  5ET6 A;  2RKM A;  3W15 C;  2REG A;  4XKP A;  1B6H A;  1M5C A;  2ZYM A;  1LBX A;  2F5X A;  2PT2 A;  1G0I A;  1I6B A;  1UQW A;  1R9Q A;  5DVJ A;  3C9H A;  1MY3 A;  1LFG A;  4ZZA A;  5FHO A;  2A5S A;  5FBP A;  4OER A;  5DTB A;  3SKP A;  3FAS A;  3QSL A;  2HFB A;  2HXR A;  5L9S A;  4LN5 A;  1M5B A;  4E0X A;  4KD5 A;  5I2N B;  5CMM A;  3OEK A;  1NNF A;  1VE4 A;  4PTK A;  1B5I A;  2Z8E A;  4EF2 A;  3C4M A;  2I4B A;  2QS1 A;  1B40 A;  2O51 A;  2QS3 A;  5H8Q B;  1DTG A;  2ONK E;  3PTY A;  5B7D A;  5H8H B;  3FV2 A;  3PV0 E;  3MP6 A;  3PPP A;  3ILT B;  1UTB A;  3TTR A;  2DE4 A;  2ZYK A;  4FIM A;  2P3V A;  3VVF A;  1DSN A;  2DSF A;  5I2K B;  3NOH A;  5M2V A;  1USY H;  4K3F A;  3FJ7 A;  3T9H B;  5H8N A;  1Y3Q A;  1QKB A;  3O6G A;  1N7X A;  1FQF A;  4U2R A;  1N04 A;  1IZ1 A;  1R6Z A;  3TUS A;  3G3I A;  4ZEC A;  4E0W A;  1BK4 A;  1QKA A;  2I49 A;  4X8R A;  2Y5L A;  2KQZ A;  3O66 A;  2ZYN A;  4YKP A;  4OFJ A;  1P1U A;  4G61 A;  4QSC A;  1IMB A;  3T9U A;  1N3W A;  2I4C A;  4MFI A;  5KDT A;  4IO7 A;  2QVR A;  4F3B A;  2GHA A;  1CE2 A;  2Q8J A;  3N6T A;  3ZKK A;  3JYR A;  4YB5 A;  4NHB A;  3C32 A;  4M1V A;  4MHF A;  4FJP A;  4ELO A;  2ZZV A;  4WED A;  5H8F A;  2VPO A;  1QUK A;  4MIJ A;  5ISU A;  5F1Q A;  2QSX A;  3OMB A;  4U21 A;  1JW1 A;  1US5 A;  5AA2 A;  1EYI A;  1YYZ A;  1XT8 A;  2GHB A;  4FAT A;  3V83 A;  4OZ9 A;  1KZ8 A;  2GQ1 A;  4PFR A;  2CEX A;  5ESY A;  1TFD A;  2B3B A;  4G77 A;  3LBS A;  1N0T A;  3KN7 A;  2X7P A;  3TEL A;  2Y7R A;  3CFZ A;  4XFE A;  1PBQ A;  2XWK A;  1URG A;  3RUM A;  3E79 A;  5AA2 D;  4JBZ A;  2XX8 A;  4PGN A;  3ROJ A;  5B70 A;  2XXU A;  4IO5 A;  2D3I A;  2G93 A;  1NV6 A;  4ECF A;  3GZG A;  2ONS A;  3IB1 A;  3OEL A;  4L17 A;  3SEY A;  5ELV A;  2QPQ A;  4KI0 E;  2ZMB A;  3MVW A;  4JSD A;  3UOR A;  3K2D A;  3TZA A;  1Y3N A;  2DWA A;  4P0I A;  1B0L A;  3O2A A;  3C31 A;  5IKB A;  4JSO A;  1XVY A;  2FA7 A;  3PMX A;  2UYF A;  1URS A;  3T93 B;  4GQO A;  2AL4 A;  2X7Q A;  3TCH A;  3TFL A;  1PB8 A;  1LGB C;  4F18 A;  4H8J A;  2UVJ A;  5I2N A;  2R6G E;  1LAG E;  2QMX A;  5JK4 A;  1NH8 A;  3RNN A;  4KFQ A;  1B5J A;  2DWI A;  4N15 A;  1N3X A;  3V5A A;  1SI0 A;  5H8Q A;  1FTK A;  1ELJ A;  3G7W A;  4H46 A;  3FBP A;  5H8H A;  3IOT A;  1MQJ A;  3ZS6 A;  3O9P A;  4MBP A;  5I57 B;  1SBP A;  1D9Q A;  2ZNS A;  4Z0I A;  1JP4 A;  5EHM A;  5I2K A;  1GV8 A;  3UGW A;  4XIG Q;  1SW5 A;  1LLS A;  4OVJ A;  2AIX A;  3PPN A;  4NF4 B;  4OEV A;  3QIM A;  1QUI A;  1FPK A;  1FQE A;  3PUV E;  4N13 A;  1FTL A;  1SVX B;  2WBD A;  1FPB A;  2Y7K A;  3LV0 A;  1FPG A;  4GWU A;  1P1Q A;  1PB7 A;  4KHZ E;  4LQ2 A;  4POX A;  4ZE9 A;  5AA3 A;  3E13 X;  2RCB A;  4GL0 A;  4PAF A;  2F7C A;  4I1D A;  3OOA A;  1LAF E;  3H03 A;  3K6W A;  4F3P A;  1LAX A;  4MJO A;  4U1O A;  3KZG A;  1RKM A;  3K1M A;  1DOT A;  1Q1K A;  1SW2 A;  3HPI A;  4NE4 A;  4PF8 A;  4F2Q A;  4IR8 A;  2XD2 A;  4O3B A;  2THI A;  4WKM A;  1BTJ A;  4O3A A;  2AYS A;  4XTC Q;  3UIF A;  3KN3 A;  4MNC A;  3N5L A;  3IO6 A;  3K0V A;  5IZ3 B;  1MRP A;  4LAT A;  2PVU A;  4JWX A;  4X48 A;  1IMD A;  2XXV A;  1QJM A;  5KZT A;  3OO8 A;  2IEE A;  3B7D A;  4G68 C;  1Y1Z A;  5CBS A;  1FPE A;  1B3G A;  5A5L A;  5EQ7 A;  5TPA B;  1P1N A;  4JVI A;  1EU8 A;  4GWO A;  3DLN A;  1M5D A;  2VGQ A;  3JV9 A;  1LFI A;  2PCR A;  4IO3 A;  1MY4 A;  1SD3 A;  1JEV A;  5ET7 A;  5CM6 A;  3CG3 A;  2YJP A;  1KWH A;  4RA1 A;  2DVC A;  2GRV A;  2O84 X;  2DDK A;  3BIG A;  2XXY A;  4YB6 A;  4O7M A;  1GGG A;  4MEV A;  2ALU A;  1PEB A;  3BFT A;  3T66 A;  1OIB A;  3MPL A;  2PMS A;  3FD3 A;  2XXQ A;  2DXR A;  1MY1 A;  3OO7 A;  3MW0 A;  1MH4 A;  1I69 A;  2H98 A;  1MG1 A;  4F19 A;  1H76 A;  4QFO A;  1SW1 A;  4F29 A;  4G8H A;  1XHY A;  3LSX A;  2H99 A;  1MPB A;  1PB9 A;  2OK2 A;  2VD2 A;  2V3T A;  1B2H A;  3HO7 A;  3E4R A;  2KR0 A;  2B4L A;  3K4U A;  4GX3 A;  4YAH X;  3OEN A;  1WOD A;  1CNQ A;  2ZNT A;  2I58 A;  1AWB A;  2NUV A;  2PBW A;  4PBQ A;  4ZE8 A;  1URD A;  3MPK A;  3P7I A;  2H5Y A;  5I57 A;  2PX1 A;  2O68 A;  4QFK A;  3QYT A;  4XXU A;  3L6H A;  1UIV A;  5EQ9 A;  2XX9 A;  3BKI B;  3B50 A;  4P47 A;  2FBP A;  3K01 A;  3N6U A;  4NAP A;  3RPL B;  3R6U A;  1G0H A;  1LB9 A;  4OVP A;  4NF4 A;  2WX9 A;  1QUL A;  3OSR A;  2Y7W A;  4KPT A; 
#chains in the Genus database with same CATH homology
 4RJZ A;  1B05 A;  1N7W A;  1JVX A;  1R9L A;  3IR1 A;  2XXT A;  2F6G A;  1O7T A;  1MQD A;  2UVG A;  4RK9 A;  2UXA A;  5ICT A;  2HZL A;  4KCD A;  1MM7 A;  3M3K A;  4F1U A;  2Q88 A;  4H65 A;  2HZK A;  4NTL A;  3IOW A;  3GLB A;  4NWC A;  1JVY A;  4YKI A;  3T9X B;  3I5O A;  1MS7 A;  3G3J A;  4H5F A;  3EHS A;  4NF5 B;  3D4G A;  3W9V A;  4GRK A;  4G4P A;  4WEP A;  5FHM A;  1ATG A;  1MH3 A;  2HAU A;  4LQ5 A;  3TCF A;  4GVO A;  3W9W A;  4X9T A;  3RY3 A;  2GH9 A;  3M3F A;  1B3H A;  1VR5 A;  3VLV A;  5CMC A;  3QAX A;  3MVX A;  4KR5 A;  4QF9 A;  1MPD A;  2FYI A;  1BP5 A;  1J1N A;  4RNS A;  4BDQ A;  3IX1 A;  1B9J A;  2VOZ A;  5TPA A;  3TTM A;  1IXC A;  4QSD A;  4FE8 A;  4XKQ A;  2R71 A;  3C33 A;  3ODB A;  1F9B A;  4QHQ A;  5L9O A;  3MZ1 A;  4XKR A;  2CMO A;  5FHN A;  5EYF A;  3DEL B;  4IB2 A;  5LOM A;  4DCX A;  3CFX A;  3KJ7 A;  1B0H A;  2DQV A;  4GLI A;  4JB7 A;  3H6T A;  4UAC A;  2PT1 A;  5JTY B;  4DIG A;  1MDQ A;  4H1X A;  1UIU A;  4LP2 B;  4OQO A;  5FTI A;  2VP1 A;  4LA9 A;  3FVG A;  1Y20 A;  2V93 A;  3MZ9 A;  3GBB A;  3KBR A;  4KCC A;  3Q25 A;  5BUU A;  1ZBM A;  3TAJ A;  5DYH A;  1B3F A;  2OWS A;  3IL1 B;  3TTK A;  5I84 A;  1H44 A;  3OEM A;  1A99 A;  2RIN A;  2DWJ A;  4FOR A;  2R9J A;  5HBC A;  4GD5 A;  3WAF A;  1XS5 A;  4NWD A;  4ZEB A;  2DE2 A;  4IGT A;  1D9V A;  3TQW A;  2D21 A;  3N26 A;  1HSE A;  3CG1 A;  3HHF A;  3I6V A;  4ELR A;  2Y7P A;  3CSG A;  4HCY A;  2O1L A;  1SYI A;  1XC1 A;  1B51 A;  3KJT A;  3E9X A;  3IO4 A;  1LFH A;  4IGR A;  4RYA A;  4KYD A;  3U93 A;  4R6K A;  3U8Q A;  2DVZ A;  3PPR A;  4U4X A;  3QUJ A;  4KYS A;  2G29 A;  2NOO A;  4NF5 A;  4DCY A;  4QFL A;  4ZDM A;  4R72 A;  2D5W A;  1NKX A;  1YAE A;  2ANJ A;  2BJJ X;  2Z22 A;  5CMK A;  1B52 A;  3KSX A;  4ESX A;  3RPW A;  1FTO A;  1PBP A;  1S9T A;  3EHU A;  1M5F A;  4RXL A;  3FVK A;  4EF1 A;  4GOT A;  4EUO A;  4OET A;  1A8F A;  1A55 A;  1WDN A;  4N6P A;  4BDL A;  1MM6 A;  2I0C A;  2KLF A;  1IIW A;  1IUD A;  4XKN A;  1QUJ A;  1JW5 A;  3WAE A;  4BDM A;  3SDF A;  3MWB A;  2DP8 A;  3H4Z A;  2XX7 A;  4X1D A;  3O6H A;  3PD9 A;  3TTL A;  4R75 A;  2DXY A;  2ABH A;  3B6T A;  4FEB A;  1LBB A;  4U23 A;  1LST A;  1O64 A;  3K6U A;  1MXX A;  2V3U A;  2H9B A;  2DS9 A;  5KCJ B;  3PPQ A;  4O3C A;  1ZLQ A;  4H8I A;  2DOJ A;  2ESN A;  3DP8 A;  3ZSF A;  4UA8 A;  4Q8R A;  1ZMG A;  1Z7M E;  1AMF A;  4ZZE A;  1R1N A;  5JTY A;  3N94 A;  4GXA A;  3AXF A;  1VSO A;  3MP1 A;  3MUQ A;  1RYO A;  4F31 B;  2Y7I A;  3SEV A;  4P0G A;  2HAV A;  3T22 A;  1TT1 A;  2FNC A;  3IB0 A;  3ECR A;  2REJ A;  1D3K A;  3EHT A;  2Q89 A;  1SI1 A;  3G3F A;  3RTW B;  1DTZ A;  2QMW A;  1YTV A;  1ZU0 A;  1JNF A;  3RLF E;  3THI A;  3CIJ A;  4OYV A;  2XXI A;  3EF7 A;  1ZTY A;  3U1O A;  2RC7 A;  1CB6 A;  2RCA A;  1IEJ A;  4I9D A;  2RC9 A;  1NNK A;  4YKJ A;  4R2B A;  5L8D A;  1PDA A;  5I58 B;  1B4Z A;  1FQC A;  1B4H A;  2V3Q A;  4PQJ A;  1FTJ A;  4R73 A;  3B6W A;  3K02 A;  4ZEI A;  4YMA A;  4BLA A;  1H3D A;  4WXJ A;  1M5E A;  4RPO A;  4G8M A;  4OEN A;  4QSE A;  2DYX A;  4LON B;  4DDD A;  5K2X A;  3CI8 A;  4F1V A;  2F7B A;  2P1S A;  4C1U A;  1QVS A;  3CR9 A;  2F7A A;  1OMP A;  3TPA A;  1GTK A;  1I6A A;  3HV1 A;  1LAH E;  4ZEF A;  2NWJ A;  3Q28 A;  1NH7 A;  4OTE A;  4IO4 A;  4NED A;  2V84 A;  2XHD A;  4LZ7 A;  5L9M A;  1Q35 A;  4BDN A;  3VXB A;  3VLW A;  1OLA A;  5CBR A;  4ZED A;  1SQY A;  1B7U A;  2O7U A;  4RK2 A;  2F34 A;  4OEU A;  3S9M C;  1T0K A;  1B7H A;  1PC3 A;  2RC8 A;  1OVB A;  1LCT A;  4Q30 B;  5CMB A;  1S50 A;  1GVC A;  3TOD A;  1IIT A;  3U72 A;  3PU5 A;  1MXV A;  5TP9 B;  4PE5 B;  4TLL B;  3A09 A;  1DPP A;  4HCW A;  3S9N C;  3FAT A;  1D9Y A;  3FXU A;  2OBG A;  3FV1 A;  1RYX A;  1I6Q A;  3VLU A;  2Z8D A;  2ONR A;  3T9V A;  3Q27 A;  1B1X A;  1MY0 A;  1H43 A;  3MC2 A;  1EH3 A;  2HCA A;  3TKD A;  1MY2 A;  1P1O A;  3MVZ A;  2WKY A;  4YZZ A;  3S4U A;  2NXO A;  3PGF A;  1TXF A;  1XVX A;  2M8C A;  4QFN A;  1D4N A;  1TFA A;  5KCJ A;  1B1H A;  4F3S A;  2XXR A;  4DLD A;  2Y84 A;  1EZP A;  1IXG A;  2Z8F A;  2F8D A;  1Y9U A;  2P2A A;  4IO2 A;  1ZKB A;  1FTM A;  3RGY A;  4AB5 A;  4AB6 A;  2CZL A;  4R9F A;  5BWJ A;  4H5G A;  5CC2 A;  3KOS A;  3FJM A;  3V8X B;  3S2V A;  1P1W A;  3VVD A;  3SET A;  3FXR A;  2QL3 A;  3GXA A;  3LUY A;  3CRB A;  4IY6 A;  1JW4 A;  3JZJ A;  1Y1M A;  4ISU A;  2I6E A;  1MQG A;  3B6Q A;  3SEW A;  3M3L A;  4M4G A;  1Z7N E;  2F35 A;  3R26 A;  3OO6 A;  1IXI A;  4ELP A;  4RY1 A;  1UTH B;  4OHN A;  3H6V A;  3A3U A;  5I58 A;  2OZZ A;  1ANF A;  5A5X B;  4PFT A;  2B65 A;  3UN6 A;  3OD7 A;  2H4I A;  3G3H A;  4TQU Q;  3CVG A;  3USD A;  3KOT A;  5AA4 B;  3ILU B;  3TDJ A;  4R2F A;  4DXB A;  2NVU B;  4R74 A;  1AL3 A;  5FTH A;  2YLN A;  4U22 A;  4G8N A;  2XXX A;  1VFD A;  3VXC A;  4R9G A;  2OJT A;  3KG2 A;  3FIR A;  4OFO A;  3IOR A;  3FVO A;  2LAO A;  1QW0 A;  1POT A;  5EHS A;  1FCK A;  4PP0 A;  1ZIU A;  4QFP A;  4LUB A;  2I0B A;  3SEU A;  2P0S A;  1NNT A;  4Z7E A;  4AQ4 A;  1VFE A;  2UYE A;  4MH5 A;  5TP9 A;  2XXP A;  1MXZ A;  3VFJ A;  3U94 A;  3H6U A;  4DXU A;  3M8U A;  2XXH A;  3KGC A;  3H6W A;  1B46 A;  5DT6 A;  3A3C A;  4YU0 A;  3O29 A;  4Q0C A;  4TOZ A;  5ICQ A;  1JEU A;  2O6A A;  1OLC A;  2Q2A A;  1SW4 A;  2I3V A;  3SER A;  3OXN A;  3CFL A;  4IO6 A;  4OES A;  1LBC A;  3IAZ A;  3GBA A;  3UA8 A;  4PFY A;  1AIV A;  4H67 A;  3DP6 A;  3VDF A;  5I59 B;  1NMU A;  1NFT A;  3UK4 A;  1ZJL A;  3CSB A;  3MBP A;  4FEC A;  1OVT A;  4F22 A;  4BDR A;  4U4S A;  4NF8 B;  5DVI A;  1FQD A;  5H8S A;  3PUX E;  3IJO B;  2F78 A;  3PMV A;  3D4C A;  3E3K A;  2UVH A;  4G2Z A;  4GIZ A;  4YMB A;  4P11 A;  3IK6 B;  3DP4 A;  1A40 A;  3MQ9 A;  5ITO A;  2OWT A;  1MQI A;  5AE4 A;  1UTH A;  4NF6 B;  3H7M A;  1JQF A;  1NNP A;  2PYY A;  1O63 A;  1SDX A;  3BFU A;  5A5X A;  3PMW A;  3HST A;  1B58 A;  1N84 A;  3V89 B;  3RT6 B;  2V25 A;  1JET A;  5HPQ A;  4FED A;  3RTF B;  2VHA A;  3R7X A;  1P99 A;  3L6G A;  3FZV A;  4YIC A;  3QK6 A;  4YB7 A;  1N76 A;  5AA4 A;  3U92 A;  4N07 A;  3LR1 A;  4G68 B;  1A7L A;  3MJN A;  4I62 A;  2E0S A;  3EPE A;  2YPN A;  2QS2 A;  1MQH A;  1MXW A;  1BKA A;  4EXL A;  2W7Y A;  2QS4 A;  4THI A;  3O28 A;  1YPN A;  1AH5 A;  4ONY A;  4DE8 A;  2DWH A;  4MLV A;  1US4 A;  4ELQ A;  1Y4T A;  3Q26 A;  4LVQ A;  4ZS9 A;  3G3K A;  4ESW A;  3F11 A;  2HQ0 A;  4OFL A;  5DEX B;  1MXY A;  3C36 A;  4POW A;  4EXK A;  5F7V A;  3IOV A;  3RN8 A;  4DXC A;  3SES A;  1EZO A;  3QUF A;  1NL5 A;  2Q2C A;  4EQ7 A;  5I56 B;  1II5 A;  3ONM A;  1SYH A;  4H6D A;  3TMG A;  4Q5T A;  1FQA A;  3O97 A;  3DM0 A;  3PUZ E;  1A8E A;  1YCJ A;  2OLB A;  2UVI A;  4I8C A;  5JEI A;  2F6P A;  5HM4 B;  1FQB A;  1H45 A;  1Y4C A;  3FXQ A;  4R6Y A;  4EQ9 A;  3PUY E;  1B5H A;  3S9L C;  5IAI A;  4PET A;  4OWD A;  3FUZ A;  3EN3 A;  4H0W A;  1XOC A;  5TU0 A;  5I59 A;  2I3W A;  4KYE A;  4C0R A;  4JWO A;  3I3V A;  3PPO A;  3TQL A;  3LSW A;  2B3F A;  5CI5 A;  1B3E A;  1B32 A;  4NF8 A;  4JXI A;  3FJG A;  5CRY A;  3HCQ A;  4EQB A;  2AL5 A;  4HTG A;  4JWY A;  1LB8 A;  1HSL A;  2A5T B;  3HHG A;  3MZB A;  1BLF A;  5J1D A;  3K00 A;  1MDP 1;  4BDO A;  2XD3 A;  3IJX B;  4NF6 A;  4KQP A;  4R6H A;  4GXS B;  2O7I A;  3IB2 A;  3ZKL A;  1AOV A;  3G3G A;  4PFU A;  3EQ1 A;  4F2O A;  1WVJ A;  3H06 B;  1POY 1;  3MVY A;  3S9E A;  3RT8 A;  3MAM A;  3PD8 A;  3HN0 A;  4C1T A;  2HXW A;  2DE3 A;  3LC8 A;  2F36 A;  4FAJ A;  4PFW A;  4G68 A;  4JDF A;  3O6I A;  1IXH A;  2VD3 A;  2QJE A;  4GL8 A;  4DZ1 A;  1B7Z A;  1FW0 A;  1LCF A;  1B3L A;  1DMB A;  3FGS A;  1MPC A;  2IA4 A;  2F97 A;  1DPE A;  1Y3P A;  3LSF B;  3BBR A;  1EZ9 A;  4OXV A;  2Q9T A;  4MLQ A;  4U1Z A;  1IQ7 A;  3PUW E;  3SEX A;  3IOU A;  4RPN A;  5DEX A;  1UTB B;  2ZYO A;  3VV5 A;  5K2Y A;  1MXU A;  3LSL A;  2O69 A;  4HS7 A;  3KFM A;  3K6V A;  4OMB A;  3C35 A;  3QXM A;  2X26 A;  4GF8 A;  5H8N B;  3OSQ A;  4X1B A;  5I56 A;  2QRY A;  3UP9 A;  1OQG A;  4MF3 A;  2GFE A;  5ITP A;  1TWY A;  2I48 A;  3T96 B;  3Q29 A;  2RF1 A;  1HSJ A;  4QRZ A;  5KDT B;  3KSJ A;  4LZ8 A;  4ND9 A;  3RQT A;  2H25 A;  4F3G A;  4IY5 A;  1L5T A;  3TCG A;  1USY E;  4ZEK A;  3TTN A;  5H8F B;  3TEP A;  1A54 A;  1S7Y A;  4F39 A;  4EDP A;  1BIY A;  4HW8 A;  3MP8 A;  2XXW A;  4TLM B;  2HEU A;  4GFR A;  5AA2 B;  3C34 A;  3TYH A;  5DVF A;  3K1N A;  3KEI A;  2Z23 A;  2E1S A;  3FVN A;  2OCU A;  2A5T A;  3H3G A;  3KN8 A;  4YKK A;  4LZ5 A;  2ZNU A;  4F1Y A;  3VVE A;  3VE1 B;  1GR2 A;  5AA1 A;  1OQH A;  3K6X A;  3OO9 A;  4NMY A;  2ZXT A;  2O1M A;  3K1P A;  2RKM A;  3W15 C;  2REG A;  4XKP A;  1B6H A;  1M5C A;  2ZYM A;  2F5X A;  2PT2 A;  1I6B A;  1UQW A;  1R9Q A;  5DVJ A;  3C9H A;  1MY3 A;  1LFG A;  4ZZA A;  5FHO A;  2A5S A;  4OER A;  5DTB A;  3SKP A;  3FAS A;  3QSL A;  2HFB A;  5L9S A;  1M5B A;  4E0X A;  4KD5 A;  5I2N B;  5CMM A;  3OEK A;  1NNF A;  1VE4 A;  1B5I A;  2Z8E A;  4EF2 A;  3C4M A;  2I4B A;  2QS1 A;  1B40 A;  2O51 A;  2QS3 A;  5H8Q B;  1DTG A;  2ONK E;  5B7D A;  5H8H B;  3FV2 A;  3PV0 E;  3MP6 A;  3PPP A;  3ILT B;  1UTB A;  3TTR A;  2DE4 A;  2ZYK A;  4FIM A;  3VVF A;  1DSN A;  2DSF A;  5I2K B;  5M2V A;  1USY H;  4K3F A;  3FJ7 A;  3T9H B;  5H8N A;  1Y3Q A;  1QKB A;  3O6G A;  1N7X A;  1FQF A;  4U2R A;  1N04 A;  1IZ1 A;  1R6Z A;  3TUS A;  3G3I A;  4ZEC A;  4E0W A;  1QKA A;  2I49 A;  3O66 A;  2ZYN A;  4YKP A;  4OFJ A;  1P1U A;  4QSC A;  3T9U A;  1N3W A;  2I4C A;  4MFI A;  5KDT A;  4IO7 A;  4F3B A;  2GHA A;  1CE2 A;  2Q8J A;  3N6T A;  3ZKK A;  3JYR A;  4YB5 A;  3C32 A;  4M1V A;  4FJP A;  4ELO A;  4WED A;  5H8F A;  1QUK A;  5ISU A;  5F1Q A;  2QSX A;  3OMB A;  4U21 A;  1JW1 A;  1US5 A;  5AA2 A;  2GHB A;  1XT8 A;  4FAT A;  3V83 A;  4OZ9 A;  1TFD A;  2B3B A;  4G77 A;  3LBS A;  1N0T A;  3KN7 A;  2X7P A;  3TEL A;  2Y7R A;  3CFZ A;  1PBQ A;  1URG A;  3RUM A;  5AA2 D;  4JBZ A;  2XX8 A;  5B70 A;  2XXU A;  4IO5 A;  2D3I A;  2G93 A;  4ECF A;  3GZG A;  2ONS A;  3IB1 A;  3OEL A;  4L17 A;  3SEY A;  5ELV A;  2QPQ A;  4KI0 E;  2ZMB A;  3MVW A;  4JSD A;  3UOR A;  3K2D A;  3TZA A;  1Y3N A;  2DWA A;  4P0I A;  1B0L A;  3O2A A;  3C31 A;  5IKB A;  4JSO A;  1XVY A;  2FA7 A;  3PMX A;  2UYF A;  1URS A;  3T93 B;  4GQO A;  2AL4 A;  2X7Q A;  3TCH A;  3TFL A;  1PB8 A;  1LGB C;  4F18 A;  4H8J A;  2UVJ A;  5I2N A;  2R6G E;  1LAG E;  2QMX A;  5JK4 A;  1NH8 A;  3RNN A;  4KFQ A;  1B5J A;  2DWI A;  1N3X A;  3V5A A;  1SI0 A;  5H8Q A;  1FTK A;  1ELJ A;  3G7W A;  5H8H A;  3IOT A;  1MQJ A;  3ZS6 A;  3O9P A;  4MBP A;  5I57 B;  1SBP A;  2ZNS A;  4Z0I A;  5EHM A;  5I2K A;  1GV8 A;  3UGW A;  4XIG Q;  1SW5 A;  1LLS A;  4OVJ A;  2AIX A;  3PPN A;  4NF4 B;  4OEV A;  3QIM A;  1QUI A;  1FQE A;  3PUV E;  4N13 A;  1FTL A;  1SVX B;  2Y7K A;  1P1Q A;  1PB7 A;  4KHZ E;  4LQ2 A;  4POX A;  4ZE9 A;  5AA3 A;  3E13 X;  2RCB A;  4GL0 A;  2F7C A;  4I1D A;  3OOA A;  1LAF E;  3H03 A;  3K6W A;  4F3P A;  1LAX A;  4U1O A;  3K1M A;  1RKM A;  3KZG A;  1DOT A;  1Q1K A;  1SW2 A;  3HPI A;  4NE4 A;  4F2Q A;  2XD2 A;  4O3B A;  2THI A;  4WKM A;  1BTJ A;  4O3A A;  2AYS A;  4XTC Q;  3UIF A;  3KN3 A;  3N5L A;  3IO6 A;  3K0V A;  1MRP A;  4LAT A;  2PVU A;  4JWX A;  4X48 A;  2XXV A;  1QJM A;  5KZT A;  3OO8 A;  2IEE A;  3B7D A;  4G68 C;  1Y1Z A;  5CBS A;  1B3G A;  5TPA B;  1P1N A;  1EU8 A;  4GWO A;  3DLN A;  1M5D A;  2VGQ A;  3JV9 A;  1LFI A;  4IO3 A;  1MY4 A;  1SD3 A;  1JEV A;  5CM6 A;  3CG3 A;  2YJP A;  1KWH A;  4RA1 A;  2DVC A;  2GRV A;  2O84 X;  4YB6 A;  2XXY A;  1GGG A;  2ALU A;  1PEB A;  3BFT A;  3T66 A;  1OIB A;  3MPL A;  2PMS A;  3FD3 A;  2XXQ A;  2DXR A;  1MY1 A;  3OO7 A;  3MW0 A;  1MH4 A;  1I69 A;  2H98 A;  1MG1 A;  4F19 A;  1H76 A;  4QFO A;  1SW1 A;  4F29 A;  4G8H A;  1XHY A;  3LSX A;  2H99 A;  1MPB A;  1PB9 A;  2OK2 A;  2VD2 A;  2V3T A;  1B2H A;  3HO7 A;  3E4R A;  3K4U A;  4YAH X;  3OEN A;  1WOD A;  2ZNT A;  2I58 A;  2NUV A;  2PBW A;  4ZE8 A;  1URD A;  3MPK A;  3P7I A;  2H5Y A;  5I57 A;  2PX1 A;  2O68 A;  4QFK A;  3QYT A;  4XXU A;  3L6H A;  1UIV A;  2XX9 A;  3BKI B;  3K01 A;  3N6U A;  3R6U A;  1LB9 A;  4NF4 A;  1QUL A;  3OSR A;  2Y7W A;  4KPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...