1T0MA

Conformational switch in polymorphic h-2k molecules containing an hsv peptide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
278
structure length
278
Chain Sequence
b'GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title The structure of H-2K(b) and K(bm8) complexed to a herpes simplex virus determinant: evidence for a conformational switch that governs T cell repertoire selection and viral resistance
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t0mA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1t0mA01
3QXWA 5D7IF 3ULUE 3MV7D 1CE1L 1PEZA 4BUHA 5KVGL 4KI5C 3BZEB 4RBPK 1ES0B 2V7HB 5I1CH 1QA9A 3EGSA 4KQ3H 3DETC 1I7UA 1EFXB 2YPLE 4K7FB 3LVEA 2IALA 5J12C 4ENEC 2J8HA 4R4FH 5JOEA 5ESVB 3QDMB 2ZSWA 4AJ0A 3T4YB 4UDTA 4RAUB 5HHQA 5HGDB 3OKMB 4QXUH 5JMOC 2RB8A 2UZYB 4QXGL 4LSVL 2NY0C 1MI5B 4OCXH 4ZTPL 1IILE 1U0QA 3QUML 3EJJX 1LEIB 4LLQA 4PJ5A 1KJ3H 1ZGLA 3W5MA 2VAAA 4JZJC 4NC0B 1MH5A 4JFHE 3D85D 1RUQH 2V2WA 3B43A 2A6IA 4JEGB 4PBXA 3NPZB 2OL3B 1Z9SA 3IS1X 4F3FB 1IKFL 3C5SB 2ZJSL 3QQ9C 4K3GA 3FHQA 4JFZH 2DM2A 2YRPA 4XAWL 3NCEB 4N8CL 2QADD 3OHXB 4OFYA 1H15B 4AEIH 2R1YA 5IHLB 5E2TL 1T1YA 1OP3K 2OJZH 4FFVD 4OD1L 1UH2A 3G6DL 2FX7H 2MCPL 5CJQH 5KVEH 3EJYC 1MWAA 3HRZB 2B1HH 1C5BH 4KPHL 3TJHD 1JWMA 1RJLA 2C1PB 4QRRE 3KHQA 1KCKA 5KSUA 3NIFF 1JWUA 2VR9A 4GBXC 4RMVA 4JY4A 3AMLA 2PR4H 3UC0L 4G6JH 1MLBB 1BOGB 2FRGP 1OSPL 3KAAA 5E2VH 2Z4QB 2RAMA 1V05A 2DKUA 5DRZB 1XZ0B 4MZ2A 5AD0B 2FECI 4GXUM 1TVHB 3FO9A 4WW1B 4U2ZA 3VI3F 1D5XB 5F1NA 5DTFA 1AR1C 3LRSA 1P4IL 1BFOB 3U30B 1WTLA 3D69A 4Z7VF 1Q0XL 2DQJL 3SGDH 3QSKB 3SPVA 1FDLH 4JR9L 3RDTC 3UBXA 1T6WA 3FO1A 3E8UH 1PVHA 4RA0C 1A1OA 4YIQB 5E5UB 5DFVC 3QNYB 5HGHB 4PIRF 3MQIA 2EE3A 4XC1L 3KYOA 4PRAB 1JRHI 5F71A 2X9XA 1CT8B 2ADFH 2Y72A 3CLEL 3GI8H 4W4OA 3I6GA 4HJGA 3AY4A 4MAYA 5DJAB 1CXHA 5E2JA 2YZ1A 4WEUD 3GSOA 2G60H 4F80A 1LQSR 1WTGT 2X1XR 5B8CA 2J5LC 2R69H 1FG9C 2ZKHL 3CVIL 4PLKD 3M1BA 3IFLH 2BCKB 1DP0A 2W60B 2YN5A 4EN3C 3SDAB 4EOWH 3CK0L 1UM4H 4PPTA 4XAKE 3P0VH 2HLFC 2ADGA 2W91A 2BFVH 3JV6A 4LKCA 1YPZA 5HYJD 1NMCB 1MRFL 4HUWA 5A16A 4NKDB 4FFYH 5L2KA 4OCNC 3QUZA 1CD1A 2CK0L 3PHSA 4K9EH 2GEEA 3MV7A 3CXDH 5FUZL 5L9DL 4CVZA 4Z18A 1JGUH 4GMTL 2AJVH 5GGRB 1S9VA 4GMSL 4PJCA 1UACL 4OCLC 4XCEB 2NY4C 2JJTA 4R4ND 3VFNB 1A6ZB 4H25A 5DWUL 3JTTB 4RFOL 3ARBB 3IU4L 1A3LH 4ELMA 3HLAB 1QFUL 2AVGA 4HF5L 1YC7A 1Y6MR 4WHTA 3VFPB 5D7LA 2IG2H 4ZTOH 2BK8A 1JPST 2CK2A 4KV5F 1EFXD 4KZDL 5KW9L 5ESQA 1ZLUH 2XG4A 1P4BH 3BN3B 4P2RE 4YHOL 1E27A 3QDMD 3D85A 4HAGA 3PL6B 4HS8L 1U41A 4X4XA 2YUXA 32C2A 4YHZH 3EYVB 1I8KB 3WIFB 5CIPH 1ROWA 3HFML 3TO4C 5SX5K 3S9DB 4S1QH 1R0AH 1H3TA 3QI9A 1MI5D 4F7TB 2DTML 5FKPB 3GIZL 3BZ4A 3TFKD 4M7LL 4GG8A 5F7DA 3O81A 2JB5H 1S3KL 1U8JA 1JPSH 1WEJH 4M5YL 4NWTL 4PGCB 2A1WL 2AK1H 4HSQA 5C0RH 5KSBA 1OAZL 5LBSL 2XZCL 3GSXA 4TNVF 1Q9OB 4HJ0C 2CJUH 2VC2H 3HC4L 4X8XA 3TJHA 1FYHB 4Q9QH 5GGSB 3E6HA 2WQRA 2D9CA 5C6PB 1D9KB 4LASH 5IOPB 2XZZA 5FO8A 3EYSH 2BZDA 5GJTL 4XP5L 1G6RA 4P59L 4G6AC 3U4EA 4UTAH 4R6UA 5TGBB 1OW0C 2BVPB 2G9HB 2Q3AA 4QY8A 5IT2L 5ISZE 5FYKE 1C5CL 2Q6WA 3DGCR 1DQTA 3EUUA 2FEEI 3PWLB 2R1WA 3SDXB 3TIEA 3PABA 1HE7A 1TMCA 4LCWB 2VITA 2XWBA 4PP2A 4YNYB 3V0VA 5DHVB 4NDMA 4HKZB 3MLXH 4ZNEA 4JPVH 2CQVA 3UYOD 4JHBA 5AAMA 1FAIL 5F3HA 4MGXA 5I8OH 3L3KA 2CRMA 3K2MC 3IDNB 3FQXA 4LKXB 4JRXB 3P77B 5ACZA 3CDGB 1WFUA 1XGPB 2WIIB 3DBXB 4MDIA 4UIMA 1TIUA 1CK0L 4XPBH 4RFEB 2Y36H 5HPMA 4JKKA 1IC7H 3WXVH 2Q8AH 5E00A 4AEHL 2IAMB 3ZKXB 1GPOL 3DIFB 1EHAA 4TSAL 1IM3A 5EBMA 3RJDA 3WNKA 4LCUB 1UQSA 4M6OH 2K7QA 3MLSL 2COQA 4B41A 4GUPB 1B2WH 3O2DL 4HPYL 4ODVH 5HYJA 1C5DB 1WBZB 3QQ4B 5CEYA 5F3BB 4Z0XB 1M7IA 1BZ9A 2DLGA 3IU3A 5EG6C 3SDAD 3VGHA 4BQBA 3LN5B 5FB8B 5F9AC 1RAMA 1EH9A 4K8RH 4XHQA 2MHAB 3I6LE 4JHWL 4P46C 3HZYB 4IOFC 5KVDL 5I1GH 3CFCL 3R0MA 4IHOB 3MRJB 5BRZB 5I1AB 2VUYA 4OGXL 1G9ML 3NA9H 3BZEA 1IGML 2OS7A 4OGAD 5CMAB 4X0KA 2PXYC 4WGVB 4K7FA 1B4JL 5DJYB 1HCVA 5C0AE 2I60H 2JKXA 5ESVA 3QDMA 4ONFL 4HUXA 3ARBD 4OCRH 1L9NA 1OAQH 2DJ4A 3T77B 5A40E 5EO9B 4ODXB 1OARH 3T4YA 4H8WL 1X6NA 4RAUA 5HGDA 3OKMA 4FFWD 4PJXB 3V6ZB 3U0WL 4X6DB 5FGCB 2OCFD 5CZXC 3HNTL 1MI5A 3N85L 3CDYA 4I0CC 3OBAA 1DBJH 3TFKA 3SY0B 3WE6A 5D96B 1RIUL 3PL6D 3MGAA 5HHOE 4YDKH 4FQ2H 4JHZA 1YY8B 2CIIB 2OL3A 3BHBA 4L4VB 4MA3A 3PQYB 4H8WC 4F3FA 5DRNB 2XPGB 1DTUA 3C5SA 1CDGA 4N0CC 1HQ4B 1YECL 1N7ML 1I7RB 3OHXA 1H15A 3JUYA 5TF1H 1CLOH 1GGUA 3GM8A 4ZAKB 4KI5E 4CMMB 2YD9A 1B0WA 5D8JL 4RWHA 1L0XA 3IFPB 3SDDC 4LIQH 4AEEA 3WN5B 3N1FC 1WICA 2C1PA 3MJ6A 1NBQA 3ZT6A 3MJ9H 1D9KD 4TVPL 5CBAB 3BJ91 1CD8A 4YHKH 3WJJC 1MLBA 5JQ6H 2W0PA 1BOGA 5F44A 1S7WB 5E8PB 1UWGH 3D3VE 3T65A 1DFBL 1LEKB 1MVFA 4O9HL 5DRZA 1IGIH 1XZ0A 1FNSL 5J11B 5T3XD 1KCUL 1TVHA 3L3IB 4WW1A 1D5XA 4Q9RL 4YXLH 4MAUH 3PWVB 4ZXBA 4TSBH 1X4ZA 4JFOB 4LCWD 2VO5A 2DQIH 2OR7A 3D0LB 1F58H 3DHMA 1W72L 3TF7A 5CBEB 2YWYA 3QNYA 2WWMD 5HGHA 3SGKC 1YQVL 4PRAA 2CKNA 1QRNB 4OKVB 4XNXL 1FBIL 3ARDC 1JF5A 4JRXD 1SYVA 4Z7UF 5DJAA 2ZNWA 4HWEH 5T3ZD 5F7EH 1REIA 4LQFL 4QT5B 5C07E 1T1ZB 1VGEL 5GGVH 4S1RH 3BT2L 3DTXB 5SV3A 3WD5H 4ETYA 1HILA 2IAMD 4KJPC 4FQQB 3I3EA 1HSBA 5K9QI 5B4MD 1N3NB 4P57B 2PTTB 4DOHB 5GS0L 1ZVHA 2R56L 5ETUB 1OCWL 4OI9A 4TUKH 4FA8A 4P23B 1ZHLB 1X44A 4G7VH 1N5AB 2Y5EA 3QPXL 3BUYB 4A6YH 1IQDB 5CKAA 5LKNA 4Y4KB 3QFDB 3D5OF 5GGRA 3WXWH 3MGOB 4XCEA 1PW3A 4HUMB 1NEUA 4Y2DC 1A6ZA 4Y4HC 2LQRA 5DMYA 5GS0C 4F7PB 3ARBA 6FABH 5BRZD 3HLAA 3QCUH 4N8VB 1EBAA 4NQEB 5BVJA 1JYVA 1JYNA 3HG1E 1OVZA 3L3HB 5D6DA 1K3ZA 1BWMA 3TYFB 1MHEB 1R24B 3R1GL 2AJSL 5D7JA 1FAKT 2Y06H 2NZ9C 3BN9C 1DBKH 2AABL 2A73B 4QHLA 5JIKA 2B2XL 2J6EL 3N06B 3PL6A 1CFVL 3RGHA 4W6YB 4WFFD 3GBNH 5JNYB 4P3CL 1I8KA 3RNQA 3WIFA 4Y16C 5IKCB 1J05B 3QPQD 3N9GH 5IFAL 5IMKB 3MV9B 4F7TA 1XT5A 3GJFH 1ZV5A 5FKPA 5ILTL 3ZL4H 5DDHB 3V6BR 2OR8A 1HINH 4JM4H 2NY7H 5CP7A 2KL6A 5BJTB 2XT1B 4L4VD 3LD8B 3PQYD 1MFCL 4HFUH 1Q9OA 3V79C 3HPLA 3S4SB 3IKKA 4K7PL 3IJSB 3QQ3B 3O6FB 4F33A 4PLJC 2AJUH 3VFWA 5GGSA 1FZJB 4KMLB 4MQXD 5IOPA 2XY2A 4EDXB 12E8L 4FQIH 1IGJB 4ONGL 4PLNC 3MBXH 5C0BE 5EWIL 4OF0A 4Q7DA 3MLZH 5DR5H 3HC0B 2AK4E 3VGAC 5FYJL 4G8FB 2BVPA 4M5ZH 2G9HA 4P2OB 1KYOJ 1OAYH 2VLKE 1I1AB 3PWLA 3S36X 5J13B 3SDXA 3ILPB 1NEZG 1XIWC 1KEMH 2OR9L 1A1MB 4YNYA 2DMBA 4Z76A 5DHVA 4HKZA 1P53A 1Y18B 3VMOA 3WS6C 5I1EH 4JG1H 4WV1B 3ZE1E 3ZYOA 5C2BH 4BK4A 3HS0B 2FO1A 4YBLB 3IDNA 5D1QB 2DM4A 4LKXA 5IHUL 1FFPB 4JHAL 3P77A 3CDGA 4R26H 1XGPA 2WIIA 3DBXA 4TN9A 1U8QB 3HAEG 1KGCE 4RFEA 5FFLA 4HBCL 1DVFB 3QFJE 1MAJA 4LVOB 3T0EC 3S5LB 4CJ0A 2R2BA 1QRND 3H42H 5HHXL 4PG2A 5INDA 4LCUA 1BJ8A 2BSRA 5KBNC 1FORL 3Q1SL 4U3CA 1C5DA 1MJJB 1WBZA 3QQ4A 4NO5B 2B0SH 5F3BA 4Z0XA 4YE4L 1ED3B 1S7RA 4NNXB 4TRPH 5I8CB 1FZMB 1DN0B 2FNBA 3JWNC 3T0BA 5FB8A 3MJ7B 2AERT 1KT2B 3ZKMC 2MHAA 1T80A 4KJWC 3HZYA 3NCBB 4LPTA 1G7JB 4P23D 3MRJA 4GRLB 5BRZA 1A4JB 4YXHH 1A6TB 1PEWA 3RI5K 5L8LB 2P49B 4Y4KD 1ZT4B 4QF1B 1EX0A 3OB8A 5D4QA 5DJYA 3TYGL 5IMLB 3OKEB 3VXNB 7FABL 3VXQB 3NIDE 1T5WB 4YJZL 1YEEH 3O6LH 4I3RH 5EO9A 2XTLA 4ODXA 2PYEE 1LE9B 4NQED 3QEQE 5CJBA 3VRLE 2HJLB 4C55A 4K2UL 4PJXA 1JBJA 2ITCA 3SJVB 3R06B 2GY7B 1NMBH 1HHJB 2ARJB 3O4LB 3U7YL 1NFIB 3O3EB 2JJUA 1RIHL 4KTDL 4JN2B 1XF5B 4LVNC 1CICB 2FHBA 4JN1L 4RDQF 5J3HC 2LAGB 5D6CB 3ARGB 1AP2B 3V8OA 2CIIA 5FYLE 1FNHA 3PQYA 5CEZL 3IJYA 5DRNA 2XPGA 5F7FA 1IVLA 1NDMA 3S37X 3MV9D 4KUZL 5BCAA 1MY7A 1I7RA 5ABDE 4MXWL 3OTTA 3AM8A 3CDCA 1CI5A 3TJEH 1I3GH 1PGRB 3D0VB 4ZAKA 4DN4L 1M4KA 4CMMA 1UGNA 3EOBA 3U36B 2FX8H 5J8OA 3IFPA 3QUKB 4CL7A 3HPJB 1PX4A 4KAQH 3WN5A 4DUXA 3O6FD 5K9KB 1AIFA 2XICA 3NCJH 2NXYB 1QSEE 3TESA 4AL8H 2XZQH 3L3JB 2BNQB 2JCCA 5CBAA 4JREC 1KC5H 3QEGL 4FQJL 5DURB 5CWSA 1S7WA 5I0DA 4DFHA 2P1YA 1LEKA 3C6SA 5DD1H 4LRNH 2BHYA 3LEYH 4NHUB 1MIMH 3DPBA 3L3IA 4PJEF 5I18H 5BV7H 4UBDC 1I1AD 4KHXL 4XCNA 5DUPL 3VFUB 1IE5A 2EXYD 2R0LL 2CDGA 4TSCH 3HUJB 4AYFA 4JFOA 4YX2H 3U4BH 4WFHD 4HZLA 2VH5L 4UUJB 5CBEA 4D0CB 2DI9A 3TBTB 4PJIB 3QCTL 3PGFH 2GTZB 2VR5A 3HI5H 1M05B 4OAWA 5J9PB 2I26N 2GJJA 3VXOB 1QRNA 4OKVA 4AH2B 5D1QD 2XZAH 2OMNA 4R7DB 4HX1B 1JNLH 3AY4C 3LCYA 4QT5A 3CDFA 3S5LG 1T1ZA 5B8CC 5IHBA 2GK2A 1DVFD 1V7ML 3ABZA 3ZO0A 1BGXL 2L7JA 2E6QA 5C0EB 3ZE2E 1T2QH 3BRDA 4KDTA 1WZMA 1N3NA 3U0TA 4R90L 5SWZE 1RZFL 4PB0L 4UNVA 4H0GA 4P23A 4YPJA 3I9GH 1YEHL 1ZHLA 3BE1L 1RJCA 3IDGB 4ERSL 4WU7B 1TFHA 1HWGB 1N5AA 2Z91B 3BUYA 1N0XH 2XQBH 4Y4KA 3QFDA 2ICWJ 2APTA 4CW1B 3GBMH 4S10A 4L9LB 1UZ8B 4I3SL 5E0QA 4UT9H 3WO4B 4Z77B 4M6NL 2O5YL 2NLJB 3P4MB 1D5IL 2JJTC 1FZKB 3ALXA 3MYJA 2K7PA 1MFNA 4F7PA 4GRLD 4N8VA 1QEWB 4I2XE 4NQEA 1I8LA 1W8OA 5KANI 3ZT7A 4XCYA 1MHEA 5HPOA 2QTEA 4S2SB 5D7KD 4HCRA 2A73A 3F7VB 1QR1B 5FK9B 3ZSSA 4M7KH 4U0RC 1MRDH 4NRZB 4XXCC 5JNYA 2UYLB 4YDVB 1VFMA 1J05A 5A2JH 2UZXB 3UTSE 2AXGB 3SJVD 5C08D 3UTTE 5IMKA 3MV9A 3CXHJ 3O4LD 1HKLL 3MLYL 3UAJD 5DDHA 2OZ4H 3WJLA 3ET9F 2QADC 4HIEB 2NY5H 1Q0YH 4JPWH 1ZS8B 1AGCB 1CICD 1CXFA 1I75A 4HMEA 4DEPC 4NQSB 5FA4B 3ARGD 1A7PH 2JB6B 3NACL 5BJTA 4KUCF 4WUUE 4P2QE 3WIHL 4EI5B 4FFVC 5CUSL 3BKCH 4K3DL 3S4SA 4OCWH 3I6KB 1IM9B 3IJSA 3UPRB 3QQ3A 1GH7A 1KJVB 1NFDF 3K4DA 5EDXA 2ZUYA 3TJHC 4UB0H 4MS8D 2B1AH 4XBPB 4XP1L 1FZJA 1P4LB 3QWOB 4BH7B 3B9DA 5CCKL 4EDXA 1IGJA 2R0WL 1TNNA 4RGOH 2FEDD 4X7SH 1TPXB 5I30H 4MA1B 3BQUB 3HC0A 1CFQB 3RIFK 3T8XA 2HP4A 1KTDB 2NXYD 4G8FA 1K4DB 3LPGA 2BNQD 4P2OA 3VW3L 1FNGB 5C0CE 4GXVL 1KCSL 1N64L 3RUGE 1I1AA 5MI0C 1VEPA 5DURD 1JHLL 3ILPA 1F4YL 1JNNH 1A1MA 3QUXA 1JGLH 1AE6H 1U95B 3V6OE 3TT1L 1CDUA 1RMFH 1Y18A 2V2XA 3QZWG 1IEAB 3LKSA 1FL6B 4JGUA 4AM0A 2EYRB 4WV1A 1A2YB 3DGGB 5JHDE 2WP3T 5D1QA 5KOMC 1VACB 3PDDA 1FFPA 4LQ1A 1B6DA 4ZS6D 2OX5A 2MSPA 1U8QA 3EDKA 4H88H 4U1SB 1VFUA 3ARRA 5B38G 2CKBB 4PLKC 4YQXH 1BQLH 2J8UE 4Y5VC 3FN0L 4TTGA 2VDRH 2ZOKB 3B2UD 3OAUL 1H3UA 5CLTA 3IXAA 3KGRA 3BYTA 5FDYA 2A6DB 2RCSL 1BVLB 3VMNA 4HKJB 2X1WL 1MJJA 4NO5A 4WI7A 4PRIB 5CZKA 3GKWL 3MLRL 1ED3A 2CUHA 1ZLUK 3I02B 1HWHB 4NNXA 5K9OB 5I8CA 1FZMA 1DN0A 2DJUA 1UA6H 5MP6L 3MJ7A 3ZDYE 3SHSA 1J8HA 4C56E 1ZE3C 1QP1A 2O5ZH 4KTEL 1ETZA 4U7KA 4YFLF 1K8DB 3LKOB 4R4NC 3X11B 1G7JA 4GRLA 1DQDH 1YN6B 2X4QB 4LPXA 1X7QB 5HGGS 3B9KB 4RMWA 3NIGF 1ZT4A 3V5KB 1DJSA 4QF1A 4F58H 1NCWH 1ZA3B 1OLZA 4ODUA 3WMSA 2CH8A 1RI8A 4WCYH 5IMLA 3OKEA 3VXNA 1JPFB 3VXQA 1T5WA 2YK1L 5BO1H 4OZGE 4KVNL 4WEBH 2GKIA 5KS9E 3TPUE 1W0WB 4LPUA 4BSWB 1LE9A 1K5NB 4XPGL 4W6WB 1VDGA 3T1WA 2W38A 4EI6B 3ZTNH 3G5VB 4OD3H 3EOTL 2A0LD 2VDLL 2HLAB 3SJVA 3NAAH 3RBGA 2BVUA 3R06A 2C3XA 2KUTA 2ARJA 1HHJA 1HI6B 1IAII 3O4LA 4XVTL 1NFIA 3O3EA 2EH7H 4XMLL 3RRQA 3TFKC 4JFFB 4N0YL 3V7MA 1R3JB 1CICA 3OX8B 2NQCA 5D6CA 3ARGA 1AP2A 1UB5A 2QQNL 2FR4B 2UWEE 3ARTA 4OF5A 1PZ5B 3NZHL 1ZK9A 1NLDH 1H3PH 5FOBB 1RZIB 1R3KB 2IC2A 2ZWLT 1LO5B 4XVUD 2DWDB 1D6VH 3C08L 5A1AA 4I0PB 3W9DB 1YNKH 1PYWB 1YC8A 2NZIA 3CUPB 3U36A 1LD9A 4EI5D 5HVWA 5DJXB 3QUKA 3BWUC 1BQHB 3HPJA 1IM9D 4R8WH 2NCMA 4PJ8B 5K9KA 3LOWA 3W0WB 5J6HB 3A6CH 3UROR 2P8MA 1JJUA 1UM5L 3L3JA 3RPKA 2BNQA 1YYML 4J3TA 5C3LD 1DBAH 2BJML 3KHOA 2X9WA 2E7MA 1JP5A 3EDDA 3RWGB 3VD5A 4BH8B 2EDQA 3BQUD 2FYYB 4V3EB 4HC1H 4NHUA 1FNFA 2IF7A 4YDJB 1BQUA 2WINB 3VXPB 1LP9F 3BD3A 3VFUA 1CGVA 4X7EC 2XTJE 3HUJA 4L5FL 3U30C 4KVCL 3IJHB 3BMVA 1UXWB 5J89A 2O5XH 3GI9L 4UUJA 2AXJA 5CINH 5TE6L 1XF2B 1S9WB 5LWYH 3TBTA 4RGNE 1M05A 5J9PA 3OG6B 1E4KC 4AH2A 1YMMD 1FO0B 3ARXA 5C92A 5CKGA 1DQQB 4R7DA 2MPAH 1P9MA 2F5BL 1RUPH 1IAOA 2BVEA 2V17H 4QO1A 4FRWA 1YEIL 5E4EB 1WAAA 5C0EA 2YC1B 1KIRA 3OSKA 4Z7OF 4LSDA 4CAGA 1BBJB 3SDAC 4OCYL 1GL4B 2VDNL 1XF1A 2L4OA 2DQCL 3MXVL 4R3SB 2BOBB 3DVGB 4X98A 3GK8H 3C6LB 3L5HA 4PRID 1NMCC 3IDGA 5SWSB 1XF3A 4WU7A 3RWHB 3T3PF 2Z91A 3ULVD 1IQWH 1JHKL 4DKFH 5JLZB 1IT9H 4CW1A 2YD6A 4OGAC 1GGIL 3H9SB 5F1OB 4Z77A 1BECA 1FVEB 1T66D 1ZT7A 2NLJA 3P4MA 4HIHB 1VSCA 4PBWD 5D5MB 3S3SA 5FECB 1FZKA 4XCCH 5DZLA 2VWEC 4DAGH 3DO3A 3NFNB 4YK4B 3ARBC 1EAPB 1LK3H 3KPMB 3B9KD 4K23H 1OAKL 5GRZA 4FFWC 4PJHE 5D6DC 2YOCA 3DURB 3I50H 4G6KL 1QACA 4S2SA 4XMKH 3CZFB 3OGOE 1SBSL 3F7VA 4Y7MA 1QR1A 5FK9A 4IDJL 5DJZB 4Y1AE 1DQLH 3DRQA 4RMSA 1VEOA 4NC2B 2AW2A 2UYLA 3PL6C 1ACZA 4YDVA 3FN3A 3O41B 4HUVB 3GNML 1BOYA 4ZOCA 3BRFA 2AXGA 3MRMB 4JGJA 3L5WB 5CJOH 2VABA 1J7VR 1YPZE 2HJKB 2I27N 1PLGH 4M02A 1CF8H 1XF4A 4HIEA 4JFFD 5L2KE 1ZS8A 1AGCA 2ZZUT 1RUMH 3MV7E 4NQSA 2ICCA 5FA4A 3EOAB 4KFZC 4EI5A 1KACB 1B3JA 1U8KB 3DVNB 2YA2A 1CU4H 1H3XA 2H26A 4XHJD 4PJCE 3I6KA 1IM9A 3UPRA 1KJVA 3AS1A 3FTGB 2DI8A 2NTSP 3RKDD 4AK1A 2O93L 1RPQA 4PJAE 4EUPH 4ELME 4I0PD 1I3RB 1NCTA 4QYOB 2PCPB 1D9KC 1J1XH 4BH7A 3U1SL 3TCXA 2DN7A 5D7LE 4PREB 4GQ9L 3QYCA 4N5UA 2FLRT 1YJDL 5EU6B 4PJ8D 1KTDA 3W0WD 1K4DA 3RWEB 4E5XB 1RZ7H 3B8YA 1ZEAH 1F13A 1EMTH 4C54A 3X12B 2HVJB 1YYLH 1EO8H 2B8OT 4HAFA 1OGAB 3QNZB 5D1ZB 1OT1A 4FTVA 2GT9B 4GS7B 1ZGLP 3DVIA 4ZTPH 1M7DB 3QUMH 1IEAA 4YUEH 1FL6A 2EYRA 1BX2B 2CO7B 3B2VH 3FB8B 1A2YA 2WWMC 3DGGA 4I9WD 2YBRA 4OZFG 1VACA 1KTKE 2WWKT 4LDOB 4NUGH 4OZHF 1IKFH 2ZJSH 2LVCA 1AC6A 1RURH 5EO1A 4N8CH 5EU7E 3O3DA 2XY1A 3EYUH 1VA9A 2CKBA 5FGBA 4OB5H 2R23B 3BP7B 4FNLL 1S7TB 4PJBE 1IL1A 5E2TH 4S1DD 2IAMC 4TUOA 4OD1H 2ZOKA 3ZKXC 2C3WA 3G6DH 1OP5K 1TQBB 5HDOA 2A6DA 4JFXB 1BVLA 1CDYA 2D4DA 4U6YA 5B4MC 1NGWB 5HVFB 4HKJA 4PRIA 1H5BB 3SEPA 5T1LB 3I02A 2FH6A 5IMMB 3OJDB 1KCVL 1JMXA 4QRUB 3UC0H 3BSZL 5IQ9B 5C71A 3RVWD 1K8DA 3LKOA 1HSAB 1QD0A 1NGZB 3C6LD 3X11A 4OF3A 5A2FA 2RHEA 4ZNEE 5C0GB 3GJFK 4HT1H 3RY6A 4M7JL 1YN6A 4MVBD 4WU5B 1SJXA 2WBJB 5SWSD 1TETL 1X7QA 4Z95H 5FHAH 4GG6A 3B9KA 2VOTA 3H9ZA 3V5KA 3WFCL 1P4IH 5IWLA 4M1GH 1LHZA 1ZA3A 3H9SD 1Q0XH 2DQJH 5B39G 3VG0L 1INDL 4JR9H 1JPFA 2XKSA 2EXWD 3TWCL 1U58B 5ADPL 3HZKB 5DJ8B 3GHBL 4BSWA 1K5NA 4JO1L 2DL2A 4U3HA 4HJJL 2FGZA 4EI6A 4MXVE 4BZYA 3G5VA 2HLAA 3D9AL 3J8F7 1YUHB 1T1XB 3QPQC 3GSNH 4RX4A 5F88B 4LSUL 1ZSDB 5D71L 5HYJE 2FBJH 4LOUD 4JFFA 4HWUA 2ZKHH 1R3JA 3P4NB 2AQ1A 4FQHB 5D96C 2UV3A 2FR4A 5I16B 4G9DA 5TE7L 3CVHH 1XCQA 2RJMA 4ALAL 1PZ5A 2BXZA 1K6QH 5FOBA 3X14B 3R8QA 5GGRY 2CLZA 2H3NA 2GJ6B 2DWDA 3S35X 4K94L 1MRFH 5CD3B 4I0PA 4JGMA 4JE4B 3W9DA 3AM8C 2CK0H 4QRRB 3CUPA 4MQXC 4PJFA 5L9DH 3QH3A 5DJXA 2VZOA 4XVSL 4GMTH 4Z7NE 4OGYH 1TQCB 1BQHA 4XP6L 4M61A 1A9EB 5C7XL 1MIEH 3A67H 4P5MB 3RU8L 4PJ8A 3W0WA 3WN5C 5IESL 5J6HA 5DWUH 1YNTB 5TF0A 3IU4H 5EOTB 3DYMA 2BSED 3T2NH 4M7LT 5FUCC 3O4OC 3PDGA 1FFRA 4M8QA 5AWNL 2ZNXA 4BH8A 2XN9A 4KZDH 5KW9H 3PWNA 2IFFL 4U49A 3MV01 2WINA 5J11C 5DK2B 1N8ZB 3OL2A 4ZUWB 1IJ9A 1OGAD 2DM3A 3MMEB 2FB4L 3QHTC 4MWFB 4N1EA 1CDJA 5D1ZD 2EYSB 3IJHA 1C7TA 1UXWA 3C2AL 5TJWK 5DC9B 4GW4B 1MCPL 1XF2A 1HHKA 4M7LH 5FGRA 1S9WA 3G04B 4NOBA 3BRGC 4YBHA 1S3KH 1IFHL 4M5YH 4NWTH 2NYYD 2D7QA 3MXWL 1HXMB 1FO0A 3GHEL 2ZUWA 1DQQA 5K9JH 5IEKB 2CXKA 3TZVB 1DLHB 2NX5E 4HKXB 2DDQL 3HI6L 4TPRL 4H1LB 1G0XA 1S7UB 1UEYA 4UQ2A 1AXSA 2YC1A 4OGZA 1BBJA 3RVXD 3SCMB 3Q6GH 3OPZH 4KDTC 2FJHB 5GJTH 1QKZH 3JV4B 3V7AG 4XP5H 4KQ3L 2GUOB 4P59H 4R3SA 5I8EB 3DVGA 4N5EA 5EU3B 1TJHH 1A3QA 5SWSA 2ICEA 4MVBA 4R4FL 4CVXB 5T1LD 1NBZB 4P23C 5D2LF 3RWHA 5IW6B 3EDFA 2CUIA 1C5CH 5AG9A 1NJ9A 2JK5B 1Q9KB 5EUKB 5B3JF 2W07A 4V3DB 3H9SA 1T7ZA 5JOPE 4ELKA 3WUWB 3SE3A 3TIDB 1FVEA 2H6PB 5D5MA 4U6HB 4HIHA 5FECA 4LLMB 5IJKA 2I9TA 4NT6B 3NFNA 4PGEB 2WBJD 1MOEA 3KPMA 4ZYKB 4WWID 5HGAB 2E6JA 5CHNB 3WHXB 2F54A 4MMXC 1I8LC 1ZLSH 4LCIH 3DURA 4HMCA 3CZFA 3O3UN 4OV5A 5C0FB 1CK0H 2BP3A 2DJSA 4JFZL 1BLNB 5DJZA 3VFRB 2LTQB 3LSOB 3EO1B 3O41A 1X5AA 4JFHD 1N59B 4HUVA 4WI3A 1SM3L 1JHTB 1XH3B 3C60B 4TSAH 2OJZL 2I07B 3MLSH 2ILLA 2ZG2A 5CJQL 5KVEL 3L5WA 5CAYB 5TPWH 1E4XI 3LQAC 4MXQD 1C5BL 4NUJB 4M8VA 3WNMA 3PJSB 1A6WH 3OJMB 4TNWF 3WJLC 3U79A 3LPFA 5DD6B 3QEUB 3DX8B 3QDHA 2XA8L 1SYSA 2ZPKL 3DVNA 3LD8C 3AFLA 2X6MA 1S7QB 5C9JB 3BPCA 1EV2E 4JHWH 2GJ6D 5E2VL 1A3RL 3O6FC 3BXNB 3BO8B 3CFCH 1AQKL 1I3RA 4OM1L 5F7NC 4QYOA 4R2GB 4QRRD 4OGXH 2G75A 5ISZB 2R0ZL 1R6VA 2DQEH 4GKSB 1MF2L 2FATH 5F96L 3HE6B 5EU6A 1ADQA 2OJEB 3RWEA 2R0KH 4E5XA 3ZE0F 4ONFH 1X5KA 4JO2L 2HVJA 3FB7A 5E70A 3VA6A 2E9BA 4H8WH 1I1AC 1OGAA 3MLPA 1SEQH 2EXYC 5T5NF 3Q5OA 4FABL 5DQ9B 3U0WH 1ZTXL 2X4TA 5D1ZA 3IFOB 2GT9A 3BWAB 4X6CA 2XA3A 3N85H 1M7DA 2VUOA 5DHYB 5M7QA 2FBOJ 2G60L 4NQUA 1BX2A 3FZUC 1OAXH 4XBGB 1QO3B 1KJ2B 3FB8A 4M00A 4EQ2A 3UZQA 4WV1C 1D3CA 4AY0A 1I7ZB 3KYMA 4G43B 4OZIE 2EYTA 3FO0H 2V9RA 4YBLC 5D1QC 3RHWK 1O5DT 2DQFB 4EOWL 2D7NA 4OLXH 1N5YL 2Q3ZA 3P0VL 3SKMB 1WSST 2XKUA 1NDGB 1N7MH 5L8KB 1DVFC 2WSKA 4LVOC 4FFYL 2R23A 3BP7A 4K9EL 3P73B 5DJ6A 5D8JH 1J0JA 3VI4E 5C3TA 4JFXA 3QIWB 2ZOLA 1JGUL 2ERJB 3SE8L 3NFPA 3TZVD 4J12A 4XB7A 1NGWA 4XAKD 4ZFFB 1CLYL 2EDNA 15C8L 1OL0A 3AMKA 1H5BA 1MFEL 3WFEL 5T3XE 5T1LA 1UJ3B 1A3LL 3OJDA 4QRUA 43C9B 1T7YA 3P11L 1C08B 3LHPH 3NCYS 5IQ9A 3SCMD 3HMXL 5C0DB 1RSFA 1K3IA 4HGMA 3O3BA 1ZVYA 2D0FA 2VLLB 1HSAA 1NGZA 4O9HH 5L6YH 1P4BL 2CDFB 4WU5A 1J0IA 1LMKA 2WBJA 4GRLC 3SKNB 5BOPA 4Q9RH 1BAFH 3VXRB 3RFZC 4YHZL 2Y25A 4IRSB 3FQRB 2E7CA 1JGDB 4GAGL 5FO9A 5T3ZE 2GJZB 4S1QL 1R0AL 3ZKSD 4QXTB 1A7RL 4UMGA 3CFEB 1U58A 3HZKA 5DJ8A 4P2RD 2H2PC 1YQVH 4PJGB 2JB5L 1JPSL 1WEJL 4C4KT 1FBIH 2AK1L 1GGCH 1KUMA 1T1XA 4XNMB 2V9QA 5F88A 5JXAL 1ZSDA 3TN0B 1PX3A 3RWDB 2VC2L 4MXQA 1IMHC 3UAJC 4UI2A 4PTTB 4RCAA 3CZJA 3P4NA 1VGEH 4FQHA 3BT2H 4Q9QL 4KRMB 1CICC 1DL7H 2W0FA 3ARGC 5I16A 3C60D 1DSFL 3X14A 1KXTB 3PG2A 5GS0H 2VL5A 4NRXB 2GJ6A 1GYAA 2R56H 4ZOBA 2E7LA 1OCWH 5CD3A 4UTAL 4MS8C 4LHQB 3QPXH 2DOCA 3SOBL 1A9EA 4YDLB 2FEDC 2BHZA 4P5MA 1UG9A 4RFNB 4I4WB 4RMTA 2QQKL 2JELH 5HY9B 5LGHH 2NXYC 5IIEB 3PWUB 2WUBH 4GO6B 5EOTA 1KPUB 4R2GD 3TEUA 2P5EE 5JUEH 3PP3K 5E08H 5ISZD 1EGJL 2HTKD 5B22A 4PJXE 4LLUB 4G7YH 1QSFB 3HE6D 2AJSH 2HKHH 3I2CH 1T1WA 5MERB 4JAMB 1PSKH 3ORJA 4XPBL 5DK2A 4E42B 1CFVH 1WZ1H 1IC7L 1L7IH 1RV6X 4ISVB 3FQWB 3WXVL 3LEXB 4X9IA 3CC5A 3V5HB 1B9ZA 1II4E 4XBEL 3VFOB 1H8SA 2AEIT 3MRPB 4M6OL 5IFAH 3VRJB 5FYKU 3UJJH 4ZS6C 1B2WL 4ODVL 1NC4B 4NGHH 1A14H 4JDVB 2B39A 5I8KL 2OI9A 4RZCB 4LGSB 1PQZA 1HXMA 5HI3D 5KVFH 3RQ3A 3ALWA 5IEKA 3B2UC 4PJ7F 4TOYL 5HHVH 2IEPA 3TZVA 1DLHA 3OB0H 4K8RL 1P9MC 4HKXA 4TULL 4U3XA 2D7MA 4P99A 3H3PL 2PO6C 3RAJH 5I1GL 4H1LA 1S7SB 4ZO6A 3VH8G 1S7UA 2JCCE 3GKZA 1JZ5A 12E8H 1QFWI 4JVUA 2JLLA 4J4PD 4ONGH 3SCMA 2FJHA 3QIWD 3HR5B 4JANA 3HZMB 4X4MA 5C86A 3OXRB 5I8EA 3G5YB 5EU3A 2YD2A 1KCGC 5FYJH 3I6LD 4IOIB 4FS0A 4M9OA 1G1YA 2I60L 4NQDB 4CVXA 5IW6A 5KSBF 3JZ7A 5GZOD 3BKMH 4OCRL 2W59A 2GSGB 1Q9KA 5EUKA 1OARL 4L3EE 3MLVH 3RX7A 2PN5A 4M6MH 1LO4H 5IBUB 3TIDA 4L9LC 4NPYB 4XCFL 2V9TA 5D72H 2H6PA 4OT1L 4LLMA 3WO4C 4KK6D 1DBJL 3H0TB 4NT6A 5D7IB 4NJ9H 5F93C 4ZYKA 4LU5H 4YDKL 4CJ1A 1QRNE 5CHNA 3VXRD 3WHXA 5L0QB 5JQHC 4FQ2L 5IHUH 3VE0B 3HAEA 4IRSD 2A0LC 4BM7A 5C0FA 3B3IB 1BLNA 1PJ9A 4HUUB 4K3JL 4PGBB 4U1LB 4JY6B 3VFRA 5HHNB 1QSVA 4MQ7A 1NCUA 4BQ6A 3LSOA 4R97B 1CLOL 3EO1A 1N59A 5JW4N 1QLRB 4QHKI 2LU4A 1JHTA 1XH3A 4K7PY 3C60A 5SX4I 5HHXH 3H3KA 2I07A 4EIZC 2X4UB 4LIQL 5I66B 1FORH 3TN0D 3WUZA 3Q1SH 4JFDA 4NUJA 1YY9D 4OQTL 3PJSA 2NNAB 4WI2A 4J3OC 4L9DA 2E7BA 4XVUC 4YE4H 5DD6A 3X13B 3WNPA 2APXA 1UJTA 4KY1L 2AJZB 4LCCC 3NN8B 4EI5C 4M93B 4YHKL 4NO3B 5JQ6L 4P3DB 5C9JA 1QPPA 3QXVA 4TVPE 4L3AA 3REWA 1WFOA 1KCLA 4QHUB 3BXNA 1T89A 2ARWA 1IGIL 3PGDB 4NQEE 5ISZA 1JRHH 4U1KB 3BPLB 5CGYD 5F1IA 4YXLL 2VLKB 2X44D 3DYPA 5I0ZA 1TPXC 1HH9B 2AGJH 4FP8H 1AQDB 4MA1C 1F58L 2A6KB 3BQUC 1UADC 7FABH 4DQOH 3BAEL 1CDCA 1P84J 2VDOH 2HG5B 3Q6FB 2M26A 4A2LA 1LK2B 4M7ZB 4RBPH 5MHSE 2QL1A 2Z35A 4K2UH 3ZDZE 5DQ9A 1JN6B 3CH1B 1QSFD 3BWAA 5DMKA 4Q2ZB 3MV9E 1CBVL 2FJGA 4WWKA 5DHYA 4QRTB 5DC4B 1Q9WB 3IDXH 4XBGA 1KJ2A 1V5JA 4U1MB 2LU3A 4LNVA 5GGVL 1PY4A 4LPCA 4S1RL 3QFJB 1I7ZA 1NAKH 4G43A 1RZGB 1JYXA 3LIZH 2IADB 4Z7VB 2DQFA 4NQVB 1JVKA 5F97E 3SKMA 2VQUA 3CX5K 3U9PH 1NDGA 1OP9A 2BVOB 4NNYB 1BREA 3ZYJA 5IROA 5FGBC 5EC1B 4DN4H 1JI2A 2NW3A 3EYFB 2P45B 3P73A 1UC6A 2WUCL 4I18B 2OSLB 4J4PA 4A6YL 1IARB 4YHLL 3G6JA 4EXKA 5KJRH 1GSMA 2MCG1 4PDCE 1U42A 2NY2B 4XX1E 3WXWL 2G5BB 3SKOB 1H3WM 1X6LA 5H37G 2ZG1A 4URTB 1UJ3A 3E3QE 5JOFB 1OP3H 3WFDL 4MB3A 43C9A 3WYRA 4HXBL 3ULVC 3QCUL 1C08A 1INEH 5DK3A 1HDMB 5C0DA 3QDGB 4WFHE 2VLLA 4PJDF 2Y06L 1T66C 4ZFOL 4CU7A 2WP3O 3BEVB 1I8IB 2CDFA 4NQDD 5BW7C 4RAVA 3L3DB 1KB5L 4UDUB 1KB9J 1AJ7H 5DJ0B 1EJ6A 3VXRA 2X4PB 4KHXH 3B9KC 1TTFA 3GBNL 5GRJH 2PYEB 2R0LH 3QEQB 3FQRA 1D5BB 4ZO9A 1JGDA 1RHHA 2GJZA 1A6PA 3MLTB 4PB9H 1CZ8L 2VH5H 4QXTA 4GLRI 3CFEA 3KLHD 1CFSB 3ZL4L 3ES6A 3TA3B 4Y5XB 3MRBB 4PJGA 3QCTH 4QLRA 2EEBA 2NY7L 3VXSB 4ZS7H 3RKPA 3LAFA 3C5JB 3BIAX 4KHTL 4DTGH 4EQ3A 5D7SH 1AHWB 4XNMA 5IP4A 3IKCB 4MCZB 2AS5M 4KGJA 4LMQE 3RWDA 3TN0A 3UTPD 5ADOH 4LRIC 1UWXK 2QV2A 4WI9A 1H0DB 4OM0L 4MJ5B 4KWUA 3MZGB 3PDOA 1MCOH 2VXQH 2BNRE 3W5NA 4UZGA 4YZFF 4FQIL 2M2DA 5ENWB 3MBXL 1J8HE 4R90H 4NRXA 2B7DT 3MLZL 3O6KH 1RZFH 2A9NL 1HHHB 3RKDC 3BE1H 4ERSH 4JM2F 1QSEB 4Q6IB 3TGXA 4I0PC 1F4WL 1OAYL 5IJVB 3IVKB 1AO7A 5CEXB 4YHNB 6CGTA 1KEML 5HHME 3VG9B 3BFOA 4I4WA 4M6NH 2O5YH 2KDGA 4NZTH 4PJ8C 1MCFA 5HY9A 1D5IH 2HH0H 5IIEA 3PWUA 2K9UA 3O11A 3NPSB 2XG5A 3F7PC 5I1EL 1E4WH 4JG1L 3RZCB 1L6XA 3LMJH 3QHZH 3GRWA 4FN0A 2VLKD 5HYSB 2C4FU 3SJVE 1X5XA 1QSFA 5HI4D 4JZNB 4O02L 1X5YA 4R96A 4JFQB 1E4XL 4QRPB 1J0KA 5MERA 4JAMA 4XVJH 5E94A 5CIPA 1C12B 2E9IA 4MSWB 4ISVA 3FQWA 1CR9H 4I48B 3LEXA 3V5HA 1MFBL 2UY6A 3VFOA 4NKMB 3QJHB 3H42L 3MRPA 3RJQB 3VRJA 4LDEB 4WTZG 1NC4A 3MUZ1 4ZUTB 1KCRL 2B0SL 1KGCD 1LILA 1P5UA 3QFJD 4RZCA 5E56A 1YMHB 4P9HC 2IPUG 2Q7NA 3T3MF 3WIHH 4N0UB 4S1DC 1MAKA 5CUSH 1IKNC 5KN5A 4LFHD 5EUOE 5DJDB 1RK1B 4X9GA 3PP4L 4HXAH 5SWZB 2QR0B 2BNQE 1S7SA 5H2BB 4APQD 3H8NA 5E4EC 4YXHL 5CCKH 2CRZA 2R0WH 3NCMA 3QAZB 3HR5A 1ZVSB 5C0JB 5GHWL 2FZ3B 3C5ZA 3NMEA 3OXRA 2NY2D 3RVWC 4AEFA 4KK8D 1O0VA 1YDPB 2ADIB 4IOIA 5J7CC 4NHUE 3BDBA 3C6LC 4NQDA 3ZZ1A 1PKQA 3GZKA 4KRNA 4WI8A 4MVBC 3ISWA 1SBBA 3AAZB 1KCSH 2FSEB 1ZT1B 4B0MM 5HBBA 1J1OH 2AKRB 5IB5B 3Q0HA 1MEXL 2WBKA 1QVOA 4I2XB 3X17A 1JHLH 1S7VB 3HUJE 4LLWB 1CXKA 3QB7C 3QDGD 4G9FB 4KKCC 1DE4B 3SE3C 4AMKH 2RGSA 1NMBL 4F57H 2YA1A 1IRAY 1RIVL 2DQUL 2EXWC 4DKDC 3UX9B 5D7IA 4YK4C 4CMHB 1CLCA 4M43H 3V5DB 4PJ9A 5EOCH 1V3KA 2PYED 1U2CA 5BZWA 3QEQD 1N6QH 3MRCA 1BMGA 3UTSB 1CG9B 3B3IA 2CR6A 4HUUA 4PGBA 5CEZE 4LOUC 4JY6A 5HHNA 3LDBB 3AVEA 3SDXF 3TA3D 2P8LB 2ORBH 1WAAE 4Z7QE 5INCB 3TJEL 3VXSD 1QLRA 3EZ8A 3FN0H 3VFSB 3IDIA 4WUUB 5FYLD 1OTUD 2FX8L 2RCSH 1RK0A 2VDPH 2X4UA 1U8MB 4NZRH 1T5XB 5I66A 3DROB 3BDXA 2NNAA 5EORL 3QRFM 3KNBB 1EAJA 3X13A 2P43B 3LKNB 3WL9A 4E0RB 2AJZA 3QG7H 1ACYL 1MNUH 2F9BT 4P3DA 1XEDA 1B4RA 4KTEH 4P3WA 2X05A 4QHUA 1ZLVH 1FPTL 3O45B 3LEYL 3MOBL 1PY9A 2D31A 3W39B 1QSED 1XR8B 1MCRA 3HI1B 1CFNB 5JIHA 4U1KA 1CDIA 5BV7L 5C0CB 3B5TA 2VLKA 4PP8C 1A4KB 1AGDB 3O2WH 3DECA 2IPUK 1DANU 1HH9A 5MEOB 1AQDA 4YX2L 4OLEA 1S78D 2A6KA 3I75B 3RX5A 5KAQG 1WF5A 2AEQL 3Q6FA 1RZJC 5JW3H 4K3EL 1LK2A 4X7TB 3RZCD 5FAAA 4PRBB 4XPGH 2OL3H 3FRUB 3PGFL 5EIIA 1E28B 5F72S 3EOTH 1JN6A 3CU7A 4Q2ZA 1DR9A 5D1ZC 1KXQE 3U46B 4QRTA 3QR2A 4GS7C 4XMLH 1Q9WA 5KSVB 2FIKB 2VQTA 4N0YH 5GGQH 3RBSA 3QFJA 3E0GA 1CTOA 4XP4L 2NYYC 1RZGA 4N9GB 1UENA 4YHIB 4Z7VA 2IADA 2J8UB 2X7LB 4NQVA 1TTGA 4MNGA 1JFQH 5D70H 2BVOA 4MHHG 4MNHA 4NNYA 2YUWA 1JWSB 4ZUSB 5HDBF 5EC1A 4X6DF 3EYFA 3KPQB 4I18A 3ULUL 3RVXC 2XQBL 4Z7UB 3PGCA 1TQBC 1G9EA 4HIIB 3GBML 3LN4B 3MJ9A 2G5BA 1INQB 3SKOA 3RI5F 4PRHE 2E5EA 4HS3B 2HT3D 5SWZD 1H5BC 1EERB 1YYMH 4NCDA 3NCFB 3ECBA 1G7LA 3SDCB 1DBML 1HDMA 1EZVY 3QDGA 4FTVE 2X2YA 4RAHA 4LHUG 2A9ML 3FRPA 5DA0B 3BEVA 1I8IA 2WWKO 4KKNA 4UDUA 5JO5B 5DJ0A 1TVBB 2WBJC 4OZGB 4R7NB 3TPUB 5I19L 5HXMA 5KS9B 5JW5B 1R5VB 1F5WA 5LQBL 1ND0B 4L5FH 4KVCH 2R2EB 4X4YB 3MLTA 4ZOEA 1TZIB 1SHMA 7CGTA 5IF0A 1CFSA 3QWRA 3TA3A 4Y5XA 1L7TH 2IANE 3MRBA 1A6UH 2NY5L 1Q0YL 4MD0B 4JPWL 2X5PA 4O2FB 3VXSA 3KPOB 3C5JA 2ZCLL 3MNVB 1A7PL 1NC2B 1AHWA 2F15A 3S8WA 4MCZA 3BKCL 5GS1B 4L8SA 3UTSD 5JXEA 4PRIE 4MXQC 1U2HA 4MJ5A 4UB0L 1YEIH 5BOZG 2PW1B 5A2IH 5DEFB 2H45A 4OCYH 3P9MB 4WUUD 4GXUN 4P2QD 2YMXL 3VD9A 3EGSB 4RGOL 2FLBT 4MJIB 1G7IB 1WGOA 2PYFB 1HHHA 2E7LC 3TNNA 4Q6IA 4GG6E 4B7IA 1JHKH 5IJVA 2CPCA 3IVKA 1GOGA 1Q1JH 5HHQB 4QRQA 3RNKA 1TQCC 5HI5D 1OF2B 3QJFA 5AYUL 4OBRA 1AE6L 4C58B 3SGEI 1RMFL 3VD4A 3DV4B 3RZCA 4NFBA 2CLRB 4YAQA 5C0CD 1T2XA 1OAKH 5HYSA 1WBYB 1MQ8A 5IQ7L 4JZNA 3D6GA 4G6KH 2XTJB 3ZYZA 1NL0H 4JFQA 3WLBA 3CMOH 4QRPA 1AD9B 2Z31B 4XPAL 3BGFB 4ORZC 3WDJA 1C12A 4I48A 3L1OL 4KC3B 1KJMB 4RGNB 1BQLL 3RIAF 3BPOC 2R1YB 3FQNA 4FFZH 4NKMA 3QJHA 4M48H 4HHAB 2VDRL 3CMGA 2G5RA 3QHFH 4F7CB 3L3GA 5KSUB 1YMHA 4ZOAA 2MQCA 3X3FL 4PJFE 1F3DH 4Y4FA 4N0UA 1UA6L 2N1KA 5DJDA 3TZVC 5B21A 4PRPE 2GSIB 3MV8B 4Q6YA 4OI8A 1QFHA 5T3XH 5SWZA 2QR0A 4EEEA 4Y5YB 3ZDZF 5H2BA 4BFIA 1AI1H 5DMIH 1WISA 1DQDL 2R29L 4TYUA 3FO9B 1QHPA 5F1NB 3SCMC 4DCQA 1ZVSA 3OMZA 5C0JA 2YRLA 2XN9E 1NCWL 1YJDH 3OWEA 3SPVB 1YDPA 2ADIA 3UBXB 5HYIA 1A1OB 4IM8A 4OKDA 5E8EB 2FSEA 1ZT1A 4LCYA 3LEVL 5IB5A 5CSGA 2ZUXA 1S7VA 1NAMB 3ZTNL 2BDNL 5T3ZH 1K85A 2WY3A 1K9TA 4G9FA 4OD3L 4OZ4B 4PJHB 1DE4A 2JJVA 3I6GB 3KPPB 4MAYB 4MJ2A 1LGVA 1CXLA 1FG2B 2EH7L 3LRHA 4WFGE 3B5HA 4OF7A 4Y1AB 3LQZB 1CFBA 1G0YR 2AJ3B 3V5DA 4AIZB 1MUJB 1I8MA 5IB2B 5INDB 5EULV 1NBYB 4Q0XL 1H3GA 3UTSA 3JWOC 5IB3B 1NLDL 1CG9A 2ADGB 1H3PL 2ED7A 3OZ9L 1NPUA 1D6VL 4LAQH 1QOKA 3VRIA 4HUWB 2LTQC 1DQML 5INCA 5L2KB 3QUZB 1CD1B 1FGNL 3VFSA 1ZLWK 1NC2D 3C60C 2HN7A 4HULB 1U8MA 1T5XA 3DROA 3MR9B 2CDEB 5SWSE 4BSJA 3A6CL 3KNBA 3BEWB 3LKNA 4E0RA 4PJAB 5FYKL 5HYEA 3MO1B 3GSRB 5JDJA 5DVKA 3RIFF 1DBAL 1DDHB 4KTYA 5D7LB 1LO3H 4GKOA 5CFHA 3OGCB 5LAXA 5D5ME 4MJID 5F9OH 1Z9MA 4OLZH 2D0GA 3O45A 5EOCJ 5ESQB 4HC1L 4M7JH 3W39A 4G8EA 1XR8A 1TETH 5H94B 1CFNA 1EPFA 4R2GC 3S7GA 3BJLA 2F54E 5C0CA 3DX6B 32C2B 4M3JA 2HTKC 2V5MA 3STLA 3IB4A 1AGDA 1Z5LB 5MEOA 3HE6C 3D48R 3I75A 3MACL 5E8DH 3QI9B 1OTSC 2LVEA 1ZGLM 5CINL 4O00A 5LWYL 3GHBH 4X7TA 1XGRB 2ZSVB 4PRBA 4JO1H 1Y6KR 3FRUA 4HJJH 5EU5B 2CRIA 1E28A 2W92A 2XTJD 4LSUH 5HTSA 2MPAL 2ZCHL 3U46A 2I25N 3WEXB 1JF1B 5D71H 1MCNA 2Z31D 1RUPL 1S7XB 1CXIA 5KSVA 4Z6AT 2FIKA 4S11A 2V17L 1LE5B 2IBGA 3MJ8B 3X3GH 2N7BA 4RGND 4N9GA 4ZUUB 4YHIA 1X3DA 5HI3C 4PJBB 4L8DB 2X7LA 4ALAH 1B0RA 3JUZA 1HXYA 1IC4L 1GAFH 2WANA 4JPIB 4ZUSA 1IZJA 3OXSB 5DRWB 4NM8H 5IROC 3KPQA 2AQ2A 1PBYA 2Q6WB 1KLFA 2P8PB 4PV8B 3VD7A 4Z7UA 4J4PC 1U6AH 1IT9L 4HIIA 2R1WB 2CGRH 5C7XH 3QIWC 3LN4A 5EU6E 2ERJC 5GISH 2DMKA 1INQA 5C09A 4PP2B 4CKVX 3MV8D 4HS3A 4KKBD 3VWKB 4TVSa 2X89A 2VKXA 4MZ3A 2X1OA 4GRMB 5M95B 5EC2B 1UJ3C 5GZOC 4PRNB 3ETBF 4W81A 3SDCA 1AC0A 1NCBH 3I50L 1F3JB 1FYTA 4HV8B 4X6CE 4XMKL 5ACZB 1EEZB 2J2ZA 1BFSA 4KK6C 1OHQA 2GITB 4W6XB 1TVBA 1DQLL 1QZ1A 1EVTC 2AI0H 5JW5A 1R5VA 5E00B 2FO4A 1ND0A 4OCSL 2QQQA 2R2EA 1T7VA 4LLVA 4IRSC 1IM3B 4X4YA 2DICA 3VGFA 4HPOH 3C2AH 4MAYD 1TZIA 3A6BH 5CJOL 1P69B 4YHMH 1PLGL 1CF8L 5DQDL 4Y88A 5FA3B 4Y1AD 1BEYH 4O2FA 5KVMC 2JJWA 3MXWH 1BZ9B 1CFTB 5H8DA 1NC2A 1UCBL 2YS4A 3VDCA 2CSPA 5GS1A 1CU4L 3THML 4WRLA 3TN0C 4DK6A 2DDQH 2YSSB 1HH6B 3HI6H 1YY9C 1JMZA 4ODWB 4XGZB 3SO3B 5L2KD 3QUZD 5DEFA 3UDWA 2J7LA 2C9AA 4AZ8A 4CU6A 3P9MA 2ZUTA 3KPRE 4HK3N 2Q86A 4ESKA 4X0KB 4PJIF 4WUKH 1VGKB 4MJIA 5AZEH 1G7IA 2PYFA 5DUML 4L4TB 1RZ7L 2J1KA 2VMFA 4HUXB 1MHPH 1ZEAL 1EMTL 2VZ3A 1YYLL 5CGYC 1EO8L 2P44B 5D7LD 2EZ0D 4YDLC 4L1HA 1NFDB 1CCZA 1OF2A 5CP3H 3T2OA 1Z9LA 5CSBA 4C4KO 1SMAA 4BA8A 3EFFB 2MMXA 3DV4A 4YUEL 2HFFB 3WE6B 1TNMA 3B2VL 2CLRA 2VLJB 1E6OH 4BKLB 1WBYA 5FGSA 3BHBB 4MA3B 4NUGL 4NIKB 4WIQA 1AD9A 2Z31A 3QI9D 3INUH 1RURL 4NN7B 3EYUL 2DD8L 2X09A 1KJMA 1TLKA 4OB5L 1SM3H 2EKJA 4HHAA 2OZ4A 3KG5A 2GJ6E 2Y4SA 2RFXB 4F7CA 2NX5B 1UEMA 2E7LE 5I74B 2VISB 2F74A 2Y5TA 3VFGH 4O5LH 4PY8I 4RNRA 3DSFH 1URLA 2HFGL 4P2CG 2XA8H 2ZPKH 4Y89A 4J3VA 4ZPTA 2GSIA 3T65B 3MV8A 1A3RH 5FO7B 4R0LB 1LO0H 4MA7L 2NXZB 1AQKH 4CGTA 4Y5YA 4HBQA 4OM1H 3E2HC 1ZANH 4HT1L 4XNZB 5HVHB 3LH2L 1IGFH 3MBEB 5I6XB 4Z95L 5FHAL 2R0ZH 4OUUB 5J56B 4QNPF 4U1GB 1FHGA 3KDMB 1MF2H 2W0LA 3TH2T 3CX2A 4M1GL 2B20A 5F96H 4ZXBB 1IAIH 3OR7B 2A38A 2BY0A 4IRJB 1AGEB 3VWKD 1JZ6A 2X70B 1ZHKB 3S98A 4JO2H 2YD8A 1C7SA 5BVPH 5E8EA 4NZUH 4UILL 3TBWA 1T22B 3UYRH 1NAMA 3QUMB 4FABH 1ZTXH 4HIXH 4OZ4A 4PJHA 4AQ1B 3GSNL 1SYVB 2DBLH 3KPPA 4AIXA 4ZSOB 1F3DJ 1CGTA 1FG2A 2GYSA 1FNEB 2ICES 4KKLD 2FBJL 1Z0MA 1PKOA 4PYGA 1G9NC 3KLHC 2VDQL 1IC5L 4Y1AA 3LQZA 2AJ3A 4AIZA 5L0QC 3LPWA 1MUJA 1HILB 5IB2A 4IS6B 1BBDL 2JF1A 3PUCA 1HSBB 1N5YH 1NBYA 3CVHL 4ZFZB 2XACC 3G6AB 1QUNA 1NANI 1T7XA 3TC9A 5IB3A 1A02N 1K6QL 1WZLA 4UOW1 1WBXA 5JW4Q 5DGQA 1X4XA 2PKDA 2YD5A 4R97C 1RULH 5J0BA 2YXFA 3L5XL 2EC9U 4X4ME 4GRWE 3DSNA 4OGYL 3SE8H 1CLYH 1MIEL 1A0QL 1UZ6F 3A67L 3MR9A 2N4IA 2CDEA 2LV4A 15C8H 1LQVA 1V3LA 1MFEH 3TBSB 3WFEH 3ARZA 2VXUH 3BEWA 5GSVB 5T33L 4PJAA 2IPKB 3MO1A 3GSRA 1QNZH 1DDHA 3P11H 1ZA6B 5IVXF 3T2NL 1JL8A 5BVJB 3G9VA 3HMXH 4HH9A 1MFAL 4M93C 3MCLH 3OGCA 3MCKA 3WFBH 4YFEA 3U9UB 4IEFB 5D7JB 5KSAA 2W9LA 4U05A 5GRWA 4QHLB 4L4TD 3QULB 5H94A 4PBVC 1EEYB 3DX6A 2VKWA 4HWBL 3BPLC 1QG3A 3F7RA 3RNQB 3S3PA 4FQXA 4L8CB 1Z5LA 4GAGH 1O7SA 5HI4C 2DQDH 3K8LA 2EKSA 1A7RH 1FIGL 3UBXI 3ULVF 4U1JB 5DRXB 1XGRA 2ZSVA 4NWUL 4M7ZC 5EU5A 5K9QG 4W70A 5CP7B 2VLJD 1FFNB 4IOSD 1NGQH 2P24B 4OZIB 3WV0A 5K9JL 5JXAH 4NM4L 4EDWL 3HPLB 1JF1A 4HWNA 3WEXA 3T2PA 4JFDE 1S7XA 1A6VH 3IYLW 4F33B 2CMRL 4HQQL 4PJEA 5FV2A 5C9KA 3DX7B 3N1GC 3VFWB 1LE5A 5E2WL 3MJ8A 4ZUUA 3QA3B 4PJBA 4L8DA 3Q6GL 4LVEA 5TE4L 1FRGH 3OPZL 1DSFH 1Z6JT 1QKZL 1UWEH 4WNQA 4YPGB 1DQJA 2NX5D 3Q2CA 1A47A 4PS4L 1TJHL 3NGBB 5AUMB 4JPIA 3GMOB 2IGFL 3OXSA 5DRWA 4APQC 3CD4A 3SBWC 5BS0A 2Z92B 1AFVL 2P8PA 4PV8A 4J7RA 3SOBH 4GFTB 2EE9A 1BIIB 2NY2C 4Z76B 2QQKH 4KK8C 3VWKA 2NXZD 4GRMA 5EC2A 1MSPA 2ADJB 4PRNA 2OK0L 3MBED 4X5XB 5CLWA 4ODHH 4ORGB 1EGJH 4HC1A 1AKJA 1ZLSL 3NH7H 4N68A 4F15B 4LCIL 4ZXBD 1B0GB 1F3JA 4HV8A 1EEZA 5JOPD 4IRJD 5FUOH 2GITA 3GDBA 3V95A 1KLUA 1DEDA 4XBEH 2R2BB 3PWPA 1VB9A 2ZCKH 4JY5L 1D5MB 2EDWA 2BSRB 4OLUH 5TPWL 1EHLH 1KV3A 4HS6A 1A6WL 5FA3A 3TA3C 2IMMA 5I8KH 4Y5XC 1ZLVK 3V4UH 3JXAA 1S7RB 1CFTA 4DK3A 4TOYH 3G6JE 5C6TH 2EH8H 1AHWC 5E24E 1OTUC 2GFBB 5E9DB 5SWQB 4TULH 3S36H 2QSCH 2YSSA 1HH6A 5CJXC 3H3PH 35C8H 4ODWA 4UQ3B 4L8BA 4XGZA 4WO4A 1VERA 1EJOH 1WQVT 4LVHB 4LSRH 3E6FA 2DQEL 2C3GA 3M8OH 3MFFB 4P9ML 2FATL 5A3ID 1VGKA 1JE6A 5CJ5A 4B53A 1XAUA 2R0KL 4L4TA 4PLOB 4Q6IC 1I9IH 5E1AB 3FT3A 3VXRE 2VRAA 1G6VK 2KQMA 2P5EB 5E2UL 5IUSA 1IC1A 3RVUD 3L5JA 4M1CD 1SEQL 4BELD 4XCFH 1NFDA 1WK0A 2ITCB 1JPGB 4OT1H 1HN1A 3UJTL 3VG9C 5K59F 5D7JD 1S78C 2W9EH 3EFFA 2HFFA 3NPSC 3TVMA 4PJGE 1OAXL 3RWFB 3RX8A 3RZCC 1KULA 2ARJQ 2VLJA 4BKLA 4HLJA 3FO0L 1GC1C 3R8BB 4DW2H 3IJYB 4YFDB 3V9FA 3CPLB 1GZQB 4OLXL 1NDMB 4K3JH 1EDQA 4JPKH 4JVWA 5F7LB 3EOBB 4LLAA 3EYOB 1I1CA 3C8KA 2KBGA 5E03A 4LSQL 4L1DA 1Z9OA 2RFXA 4NNPH 4F8QA 2NX5A 1DBBL 2UY7A 4OQTH 2VISA 1AIFB 2MKWA 4U33A 2LE9A 1FZOB 2Z0BA 1Z3GH 4IRZH 4KY1H 2BRQA 1EFQA 5ECJE 2JCCB 1AO7E 3VXME 3QXUA 3LHPL 5K93A 4EUPA 4K7PX 5CWSB 1C1EL 3LB6D 1JGEB 3C6SB 5FO7A 4R0LA 1BM3L 3OAYK 3TBYA 2IWGA 2WV3A 4JKLA 2HT3C 5L6YL 1BPVA 2ZUQB 3MBEA 3KJ4B 3ZMRA 4X8JB 4OUUA 4FQ1H 4POZD 1BAFL 3KDMA 4NO2A 4JZJA 4XCNB 1A6AB 3M07A 1QSFE 1A7OH 3QAZC 1K4CB 3OR7A 4L3EB 2CDGB 3ALPA 4HZLB 4IRJA 4MJ6B 1AGEA 3BAEH 2X70A 1MCWW 1ZHKA 4FQLH 1WIUA 1F11B 3LS5H 3S37H 1MCEA 1T22A 4LGRB 5C0ND 4OAWB 3FKUS 3QUMA 2QLVB 1T0NB 2FL5B 1CBVH 3RWCA 1LVEA 1NLBL 1GGCL 2E27L 4S1SH 4ZODA 4JKPL 4ZSOA 4EBQL 1FNEA 5DXWA 2G2RA 4O51A 1DL7L 4IS6A 4M6AA 4JDZB 5L8JB 4GBXA 3BMWA 4ZFZA 3G6AA 3HNVL 4O4YH 2HTLD 4BZ2H 4HDIB 3U0TB 1SVCP 1BD2B 4X5LA 1L9MA 3WS3B 3ULVH 4KJYA 2R4RH 3RTQB 2IQAB 2WUCH 3VJ6A 3MRLA 4YHLH 3K74B 4ZUVA 1EO5A 1MJ7H 5E9DD 4Z7WF 3HHRB 4C59B 4NQDE 2XI9A 3TBSA 2JELL 1KXVC 5LGHL 1PKQE 3MYJB 3CLFL 5GSVA 2WUBL 3RDTA 2IPKA 3WFDH 2AJYH 4OIBA 3BZFB 1OP5H 3QP3A 4HXBH 1ZA6A 5JUEL 5E08L 4ACPA 3QNXB 2Y23A 4G7YL 1HYSD 3H7LA 3U9UA 5GGTL 2ID5A 2D3VA 4XCYB 5HI5C 2VDMH 4Q97A 2HKHL 4I5BB 5ADPH 3I2CL 2DLFH 4UV4L 2HRLA 1PSKL 5D7IE 1KB5H 3QULA 4YC2B 2EDYA 1EEYA 2EDFA 4Z9KB 1WZ1L 1L7IL 3BZDA 2P5ED 1VEMA 4FQPA 4ZFGH 4L8CA 1W72B 4UTBL 2PTUA 1F8TH 5FM5M 1S5IH 4J3UA 4N1CA 3S34H 3UTPE 1CZ8H 3ZDXF 5GGVY 1OQOA 3UJJL 5DO2D 1X5LA 4U1JA 5DRXA 3ULUF 3MRHB 4NGHL 3RHWF 3V6OC 2H1PH 1A14L 3GSNA 3O8XB 4PFEA 2KPNA 1K2DB 2UZIH 1FFNA 4KHTH 3VGBA 2P24A 5KVFL 4OZIA 3V2AR 1BWWA 4YFLI 4LP4A 5HHVL 3VDAA 2CR3A 4JRWA 3REVB 4P5KA 1LP9A 4OM0H 4ODBD 4F7MA 3DX7A 2F53E 3RAJL 4NFDA 5E8OB 5F7WC 2VXVH 3QA3A 1PG7X 4ZAKD 2ESVB 2MKLC 1MJ8L 4ODTH 2EIZB 4YPGA 1WWAX 3P0GB 1OQXA 2A9NH 3T8XB 5AUMA 3GMOA 1RUAL 4HUKB 1VCAA 1F4WH 1TITA 2Z92A 4YR6A 3BKML 5JPMB 5KANG 4X80L 3C9NA 3KYKH 3MLVL 1MREL 1BIIA 4HWZA 4AIOA 4M6ML 1LO4L 4NN5B 5D72L 3MA9L 2E3VA 3QUXB 1RZKC 4O2CA 3TO4A 1JTPA 3NIFE 1FVDB 2VZTA 2V2XB 1FL3B 2ADJA 3OF6D 3LKSB 3ROOB 4AM0B 4X5XA 4NJ9L 4ORGA 3H9HB 4LU5L 3AXLB 4OZFH 3T04D 1B0GA 4L3ED 4O02H 1E4XH 3T0VA 5DD0H 4RGMB 2VERN 5F8QC 4G80B 3UPCA 1MHCB 3CH8A 3VI3E 4X9HA 1A7NH 3C2SA 3K1DA 4YEFA 1L6ZA 3UP1A 4OUOA 1WIPA 4Z7VE 1MFBH 4HG4J 4WTZA 4FQCH 2X9YA 4MNGE 1F6LL 3EW3B 3IXAB 1D5MA 2NTFA 5FCUL 5FXCH 4PGJA 2A83B 3K80A 5JPNA 2XNAB 1KCRH 1T83C 5DJ2A 4M1DL 3LV3B 2FECL 1XGUB 4LIQE 4WHYH 1MLCA 1YEFH 4DUWA 3CGTA 2BNRB 3V4PL 2YRZA 3PXJA 2GFBA 5E9DA 5GS1C 5SWQA 1J8HB 1ETZB 8CGTA 3PP4H 4UQ3A 5HGBB 1P7HL 3ZKQD 4DN3H 3RTQD 2DLIA 4XPHH 3UDWC 1DEEA 1JRHL 3DRTB 4TTDD 3AS2A 3QDGE 3QDJB 3GUTA 3MFFA 5GHWH 4ODUB 3F7YB 4JKWA 3MNZB 2AGJL 4FP8L 4TVPD 4DGVL 2CLVB 5HHMB 1UKTA 2YXMA 4DQOL 5I1HL 1F97A 4N8VG 2R4SH 2VDOL 5E1AA 2M1KA 2P5EA 1JCKA 1MEXH 2WAHA 2A77H 3I3BA 3IDJB 4PV9A 2YPVH 1JPGA 2H9GB 2R9HD 4JFYB 4GKNB 1RIVH 3U4AA 2DQUH 2BHUA 3IDXL 4MNQB 3RWFA 5IB1B 1J86A 1SJEB 5GPRA 3VXSE 3NA4A 1NAKL 1UB5B 5MHSD 4KV5E 1X5GA 2QHRH 3LIZL 1MWAL 2XTJC 3CPLA 1GZQA 4RMRA 3U9PL 1SVZA 2VDKH 2Z31C 1MAMH 5TDNA 1KIPB 3BGFC 4S0UC 3UMTA 1GOHA 3PHQB 3O8XD 5A2LH 3O2DA 4RGNC 3S4SG 1LD9B 3EYOA 4HGWB 5KJRL 3TBVB 5E99H 4KKAD 5EUOB 4H26B 1JZ3A 2FCBA 1EBPA 2PXYA 5EORH 3V0WH 4JVPA 1FZOA 3GMPA 2P8MB 4M03A 1ITCA 5JTWA 3UJIH 2ESVD 3D2UA 5GS0D 2GQHA 1A8JH 4OZHA 5MENB 1INEL 1ACYH 4XX1G 4RSVA 1ADQH 1JGEA 2C5DC 1M1SA 1FPTH 4JG0H 4KKBC 5DD3L 5IBLD 3MOBH 1KSRA 3OF6A 1I9JL 4Y5YC 1G7MB 2BMKA 1BFTA 4P2OD 1AJ7L 4X8JA 5EO0A 1A6AA 5GRJL 2Y07H 1GHFH 1K4CA 4L3EA 2WNGA 2Q1EA 1IAIM 4QRPE 3UO1L 3QUXD 4PB9L 4MJ6A 2BRRH 3SN6N 5IW3A 1I9EA 1MVUB 1CL7I 2AEQH 4N0CA 3JWDC 1F11A 1FL5A 4K3EH 5I71B 4ZS7L 4NFCA 1T0NA 2FL5A 1GZPA 1H9VA 2CXGA 2XWTA 3F8UB 5D7SL 5IW1B 4DTGL 5IG7A 2YD1A 4W4OC 2WLYA 4MAYC 2BX5A 3RIAK 5ADOL 3U7WH 1IAOB 4JJHA 1A1NA 5I1LA 2K1MA 5JHLH 1MCOL 3MRNB 2VXQL 4N0UE 4XP4H 3B9EA 2FEEL 4JLRA 1I9RH 2FWOA 1KIRB 4JDZA 5F6IC 4RRPA 2X41A 4JFPB 4HDIA 3SE9H 3WJJA 3BISA 3O6KL 3KR3H 5DI8A 1BD2A 4X98B 3WS3A 2BSTA 1A21A 1ZXQA 1A9BB 1SMOA 1XF3B 3RTQA 3DHJA 2IQAA 3QUZC 3ULUH 3ERYA 2BNRD 4TUJB 2B4CC 3DNKA 3ZHLA 5CS7A 4ZMAT 1J8HD 2ED8A 1ZT7B 4NZTL 4GJTB 2HH0L 2EDTA 1MCKA 3U48A 4UT6H 2ATPB 4G8IB 3BZFA 1E4WL 2R2HB 3VXTA 5CD5D 3U6RB 3LMJL 1DBMH 1E4JA 3EZJB 3QHZL 3QNXA 5FYJD 3H6JA 3SGKA 1JNHB 3QDJD 4G9FE 5DEGB 1I1RA 3UTQB 3I3DA 1LEGB 2EZ0C 1JF6A 4I5BA 2A9MH 1NCDH 5EBLA 5HHMD 4NOFA 1SY6H 1X4YA 4XVJL 1BFVH 3DRQB 5I19H 1CR9L 4PUBH 5BXFA 1W72A 5LQBH 3MYZA 3WNNA 1EZVX 2BC4B 3QI9C 2VABB 4C83B 3MRHA 5DUBA 1S9XB 1XF4B 4MNQD 1HOCB 3O8XA 3QO0B 3GBLA 1WWCA 1QFWH 1FLTX 1K2DA 4Z5RB 2ZCLH 5IFHH 1EIBA 2V5SA 3VXUB 2KQNA 3NFSL 5FM5O 3FFCB 5I17B 2H26B 4LNRB 1N4XH 1G6RL 2W1NA 1FIEA 4F2MB 2J12B 3REVA 1ZHNA 2AQ3A 4D8PB 5IBTL 1U3HB 4HXAL 1Q94B 5E6YA 5EU7C 2MWCA 2OTWB 4YH6A 5E8OA 5I1IH 2ESVA 25C8L 3QXTA 4U7MA 2HWZH 2Z9TA 2YMXH 1GOFA 4UT7L 4NP4L 2EIZA 1I3UA 2VLME 5EFIB 3C87A 3GSQB 2ZUSA 4POUB 3P9LB 4X7DC 4PRHB 5J4MA 4JO4L 3E3QA 4MJ4A 5JPMA 4PJ7B 2W65B 1J1OL 4DKEL 2YUZA 4HIJA 5CSZB 2YN3A 3ARPA 4NQXB 4FTVB 1SQ2N 1NQBA 5AYUH 4AMKL 1E6JL 2PW2B 4LP5A 1FVDA 4F57L 5EA0L 4KI5F 1FL3A 3ROOA 3H2WA 4LSPH 3BW9B 5SX4H 4D0DA 4BFGA 4M43L 3H9HA 2YBRB 3AXLA 5EOCL 1P6FA 2IJ0C 1JTTA 4ZQKA 2J6EA 5IQ7H 1PDKA 1N6QL 2E7HA 3BD4A 2HT2D 4G80A 4BZ1L 4XPAH 5JORB 5D2LA 4OJFL 2ZUVA 5EO1B 1MHCA 2AV7B 4KKLC 3PP3H 3O3DB 2WQ8A 5LG1A 3L1OH 2ORBL 4HW6A 2IANB 4JQXA 5T1DH 3U2SB 1IL1B 2R1XB 4TUOB 1NSNL 5D1XB 3CFDB 2VDPL 4U6YB 4NZRL 2A83A 2XNAA 3EBAA 3P0YH 4H1LH 3LV3A 5CEZD 1XGUA 1U9KA 1BZQK 3X3FH 1J5OL 4CBPA 3OG4B 1VADB 2BNRA 4Z7UE 5DLMH 4BFEA 3QG7L 4XC3H 1MNUL 2GHWB 5C09E 1FN4A 3ARSA 4R9HA 3O9WB 4RIRB 5HGBA 4V2CB 4N1HB 4BSVB 2QHLA 2R29H 3SO3C 3QCVH 2C3VB 5JDSB 3DRTA 4GG6B 1MCHA 1GGYA 4UOW0 1HIMH 3QDJA 4CADB 1JNJA 1J10A 1FYTE 2HA1A 3O2WL 1YNLH 3F7YA 3L7FA 3MNZA 2CLVA 3WNLA 5HHMA 5ITFA 2DQHH 4JQIH 2FD6L 5DQJA 1T0MB 3L95B 2C7UB 2BSSA 3CIQA 5JW3L 3LEVH 2NY3B 2OL3L 3T0EA 2BDNH 3JWOH 3IDJA 3DVFA 4NN6B 4O2EB 2H9GA 4Y5VB 4CU8A 3OV6A 4HKBB 4P48A 4JFYA 4GKNA 4FFEX 3BH9B 4MNQA 2BY1A 2IPTL 5GZND 5IB1A 4HG4K 1SJEA 5GGQL 1ZWIB 3AREB 4LF3B 1HQRB 4U7SA 3E1F1 4P5TB 2KH2B 2VSCA 1U93B 4G9DB 1XCQB 4Q0XH 1JFQL 5D70L 1CGYA 4Y19E 3OZ9H 4M62L 2CLZB 2H3NB 3BH8A 1KIPA 1UM6H 4NN7C 3PHQA 1DQMH 3V7AE 1YEGL 1FGNH 2AEWA 1YEJH 4PJFB 5DVNA 3VXUD 3QH3B 4HGWA 2R8SH 5EU4A 2DTSA 3TBVA 4AG4H 4M61B 5EUOA 4MJIE 4H26A 3G5ZB 4LMQI 4PRPB 1OM3L 5I74C 1U3HD 1X5FA 5FYKH 3CFBB 5MENA 1CQYA 4QGYA 4FMKA 3DXAB 1TDQA 4M8QB 3MFGB 4GLRH 2XN9B 2VQ1B 2QJDA 3PWNB 3EO9H 5TQ0L 4R0LC 2NXZC 4PRHD 5TQ2H 1U8LB 3A6OA 1G7MA 5HVHC 4XNZC 5I6XC 3MBEC 3PIQA 4DUVA 3G9AB 4ETQB 4U1GC 3QISA 2ITDA 4ZXBC 1JPTL 2WMPA 5I1JL 1IEHA 1PD6A 3MACH 4FTVD 3GO1L 5ID1B 2IBZY 1BF2A 4IRJC 1MVUA 1KJ2H 1HHKB 3TF7C 3KPNA 5IR1B 1MCBA 3BPNB 43CAB 1NCCH 1L7TL 2GW5A 1A6UL 4N0FB 3S35H 2XIDA 5IW1A 3KLAB 4PJDB 1ULVA 1K8IB 2ZCHH 1MCLA 4KRLB 4XTRD 3F6LA 2VZVA 5FV1L 3MUGB 3MRNA 2IAND 4KROB 2AJXH 5MEPA 4UQ2B 1AXSB 3D39B 2Z8WC 3TO2A 2QBWA 5D1XD 4JFPA 3DI2B 3MV8E 4JDTH 1IC4H 4DFIA 3ZE1F 3H3BC 4YDIL 5DHXB 2HFEA 1A9BA 1ZOXA 2ICEB 5E6IB 4KMTL 1N0LA 1CIUA 1P1ZB 4J3WA 1NJ9B 1I7TA 4KXZI 1MCDA 4TUJA 2WZPD 1Q1JL 4RISH 5A3IC 4ELKB 3AUVA 4O58H 3O9WD 3MRIB 3KJ6H 5EZIH 2I9TB 1OPGL 2ATPA 4G8IA 4Q9BA 3QUYB 2R2HA 1R3IH 3U6RA 4QRSB 5IK3B 3RVUC 2F54B 4M1CC 1JNHA 3UTQA 5DEGA 1LEGA 2JIXB 1NL0L 1DN2A 2A74B 3CMOL 4MQSB 4OV5B 1VPOL 3BKJH 2P7TB 5D7JC 4JM2B 3HMWH 1U8PB 1YN7B 3TNMB 1QLEH 5DGRA 3OR6B 2NY3D 3HCVB 4G5ZH 4FFZL 4OCSH 4M48L 4D3CH 3KPSE 2BC4A 5FM8A 4RX4D 3QHFL 3FMGH 4C83A 1S9XA 3QG6A 3JSSA 1HOCA 3L6FB 5DQDH 3B83A 3GMRB 2BERA 3EFDL 3QO0A 4HK3J 5J57B 3Q3GA 2YKLH 4NKIH 4Z5RA 3ARED 1UCBH 1CGWA 3VXUA 4P5TD 3QDAA 5DVOA 3FFCA 5I17A 5DSCB 1SYSB 3VD3A 3NIDF 4LNRA 4RQQB 3THMH 4F2MA 3DO7B 5ACMA 4P2YA 3BPCB 4D8PA 3SDYH 1U3HA 4LSTH 4XMPL 5T3XL 4L3CB 3BKYH 1Q94A 2DRUA 1F6AB 3VRLF 2OTWA 4B50A 3GSVA 4DZ8B 1AI1L 5DMIL 4F37K 1BQHG 2G75B 3TPKA 2HFTA 4IDLA 5EFIA 3GSQA 1UWXH 3LB6C 3FB5B 4PRPD 1CVSC 5DUMH 2RR3A 3P9LA 3NGBC 4PRHA 3VCLB 3K2UH 1IBGL 3BYYA 3BDYH 3GRWH 1DLFH 4PJ7A 3FB7B 2W65A 4POZC 5CGTA 4PR5B 4XXCA 3DXAD 5CILL 1ORSA 4IMKA 4U6VL 5CSZA 1GGBH 3O6ML 5E95B 5FDWB 2XOTA 5T3ZL 2X4TB 5JR1L 4NQXA 4J2XA 2XN9D 4X6CB 2PW2A 2JTDA 2OP4L 1XR9B 4ONHB 3PHOB 2HJFB 3BW9A 4P4KB 5DT1H 2FIRT 4PYHA 5HHPB 3KYMB 5C0NC 4D9LH 2EYTB 4FXGB 2EIEA 1F42A 5I76B 4F15C 5JORA 4PJEE 2MJWA 2AV7A 1N26A 1XGYH 2DD8H 4WFGD 1X5HA 4LAQL 3ILQD 1KN4H 2IANA 4K55A 3U2SA 1RJZB 2R1XA 5DJ6B 4U6XB 4PG2C 5D1XA 3EHBD 3CFDA 2BNUB 2ZOLB 5KAQF 3NFPB 4YGVB 3OKDB 2HTLC 2CD0A 3WIHA 1J18A 5H37H 3F12B 1SEBB 4WHYG 5BS0E 1WZKA 4KROD 2HFGH 1VADA 3MA7A 1KLGB 3D39D 4GSDL 4D2NA 3KPRB 3WCYA 1LO3L 3O3BB 4QHKJ 4N5ED 1CL7L 1JIBA 3O9WA 4MA7H 4RIRA 5F9OL 5FCSH 1DCLA 4OLZL 4BSVA 4OSUL 3LH2H 4LLDB 4XWGH 3B9VA 5E6ID 4GH7B 2C3VA 1T20B 5JDSA 4LGPB 4LVHC 4X6EB 4CADA 2OXGA 1HYSC 2BVQA 3LN9A 5FO9B 1FE8L 1G9NH 5E8DL 4LARL 5I1KL 2J8OA 3GSWB 2D7OA 3ZE2F 1T0MA 2AEPH 2C7UA 3L95A 4UILH 3GGWA 3QUYD 2IQ9L 5DFTA 2C4FT 2EEDA 5T1MA 3PWPE 2F54D 4O2EA 2JIXD 1KFAH 4DGYH 4Y5VA 1J0YA 4HKBA 4LEOB 4CVUA 3FAXA 3BH9A 3MLUL 4JM2D 5DO2C 4MD5B 4H0HB 2VDQH 1IC5H 2XRAH 1ZWIA 3AREA 4LF3A 1HQRA 2H32B 3EDJA 3X3GL 4CN1A 4P5TA 2W0FB 1MJUH 1BBDH 1U93A 2I5YH 3M17B 2EO1A 3K46A 4HK0B 4G3YL 3TP4A 2VL5B 1CS6A 3W2DL 4G8GB 3PXHA 5F9DC 5IVZA 1GAFL 3WSQL 3HR6A 3SQBA 4NM8L 5ICZB 3LRGA 3L5XH 3JBG7 4ZAKC 3UZEA 5JMRA 3TH4T 2X1PA 1U6AL 4JO3H 2DYPB 2CGRL 4X6BB 1A0QH 5GISL 3G5ZA 4V1DE 4PRPA 1ES0A 2V7HA 4UV7L 5HDQL 1NCAL 4L4TE 3DLQR 1JZ4A 1EFXA 1T2JA 5T33H 3CFBA 3DXAA 1XGQB 1MFAH 2F5AL 1OY3B 3NABH 1NFDE 1NCBL 2VQ1A 5EU6D 1Y6NR 2J4WH 1G9MC 1NMAL 1T1WB 4WDIB 5T5FL 1AR2A 1U8LA 2PUQT 4AENB 2OTPA 2ZUQC 3OKNB 4ETQA 2VLJE 3KJ4C 4R4BB 1LEIA 2AI0L 5DC0A 4HWBH 3CC5B 2ATKB 4J8RB 4NC1E 3MODH 4HPOL 1QBMH 5ID1A 1FIGH 3A6BL 2V7NB 5GS3A 4YHML 4LHJB 5IR1A 2OBGA 43CAA 4P4KD 5F89B 4NWUH 1BEYL 2NMSA 4N0FA 1R3LB 2OI9B 4OQ1A 1GJIA 1PQZB 4MA8H 3KLAA 4PJDA 4TQEL 5CGMA 1K8IA 1RJYB 4NM4H 4EDWH 3WKML 3NVQA 2EDOA 4I8DA 4FMFA 3B8SA 2CMRH 4HQQH 3IRPX 3RUGF 5DMJB 4UINL 3HRZA 4KK9D 5E2WH 4D94A 3MUGA 4N90E 5GS2H 8FABB 3D39A 1QRKA 3ZSTA 5TE4H 5F9WB 4JANB 1V7NH 4GRWB 3O4OB 2MQ3A 4WUKL 5F6HI 1IGCL 4PS4H 3SGEH 5AZEL 1PFCA 5J1TC 2IGFH 1CN4A 5E6IA 2Z4QA 1T03L 1P1ZA