1T0MA

Conformational switch in polymorphic h-2k molecules containing an hsv peptide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
278
structure length
278
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of H-2K(b) and K(bm8) complexed to a herpes simplex virus determinant: evidence for a conformational switch that governs T cell repertoire selection and viral resistance
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
total genus 71
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t0mA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1t0mA01
4U7KA 1ONQB 3LKQA 4HWBL 3BO8A 3MUGA 5DS8B 3NFPB 3AU1A 5I74B 1WT5A 4Q6IC 5I1KH 5HD8D 1DANU 5CINL 3QAZC 1JFMA 2VXSL 1U8QB 4TRPL 2AXFB 3N1FC 4HIXH 3VU2A 4JFOB 4LEXH 3D39D 4XXDB 3VFTB 5ICXA 4X6BA 2X4TA 3WN5C 2Y6SC 2ATKA 2I07A 5CJBA 2ZUUA 1WC7A 1FV1B 1U8IA 4XCFL 2FDBP 2C3XA 3OR7A 5EU6D 4K94H 3LN4A 2Q8AL 3FTGA 3JWOL 4Z7WF 2VN4A 2ICES 4NQSA 1Q94B 5I8CA 1DEEA 2X4PA 3NCJH 3LS4L 4H88L 3UTTE 4DKEH 3SJVA 3BGFB 1IE5A 5J9PB 4XAWL 4MXVF 1CFQA 2Z93A 4GW5A 4MJ2A 1QKZH 1NC4D 1MJUH 4QHMB 5LGHL 1CDJA 5ACMA 2P42B 3KJ4C 2C26A 3JV0A 2XA8H 4PV8B 4MNQA 5DK2B 3VDCA 1B4RA 3O2VL 1AIFB 4L8BB 3X13B 1ACYL 2DQHH 3BE1L 4QHNB 4WHYH 3KPPA 3RZCC 1K85A 1N3NA 2AJZB 4U7SA 4NM8L 3F12A 3MNVA 4QXUH 4ACPA 3HE6D 4AEHH 4Z5RB 1I85A 1J8HA 3O3BB 2O5ZL 4PJHF 2BVOA 1CXIA 1Q9LA 4HGMA 4Q9RL 2ORBH 2APFA 1IGFH 5CD3A 4OZIB 5FKPA 3EJYD 1U93B 3LD8B 3ZL4H 4JM2F 1KYOK 1JNLH 4S1RL 1G7LA 3U30C 3C87A 3HE7B 2R1WB 5GZNC 1CGWA 3NGBB 5KSAC 1KPVB 5HJ3A 1TVDA 4ZOEA 1MCDA 3UZQA 4GQ9L 4U6HA 2D4DA 2CKBA 1EFXA 5D8JH 3SGDH 1A4JB 1DQQA 4XPTL 1NFDF 1ZA3A 3OX8A 3CC5A 1WSST 1H3VA 2VL5B 4U1JA 2D31A 5TGBB 43C9A 5IMLB 5D7IB 3MV9D 4P2RA 2HFGL 4PJ8A 3U0TA 5IJVA 4ODSH 4YFLI 3NH7L 2D7TH 5CIPA 4JPIB 4S0TD 1RJLA 3MYZA 3P3YA 4NN7B 3QG6B 2LAAA 3VJ6B 2AJXH 5GGTL 3BKYL 1F90H 2OYPA 1OPGL 3RAJL 4JG1L 4RMSA 1ZVSB 4YHYC 1CCZA 1TCMA 3NVQA 4Y4HA 5IJKA 3C5ZB 5DHYA 2AK4A 3PP4L 4Z7VA 4MAYA 1PLGL 3G5XB 4G9FE 4C55A 5BRZE 2VLME 4HUXA 1ZLWK 5I71C 3AM8A 1R3KB 4GT7A 5GSRB 4NUJA 2P4AB 2R0LH 3LRHA 1ZHKB 2FCBA 1HXMA 3TP4A 5CEZE 4CBPA 3WO4B 2J8UA 2ICEB 3OJMB 2Z92A 3GJFK 2E7HA 5KANG 4LCCC 1G7PA 3WFHA 4ZNEE 2J88H 2EZ0C 4PREA 2PR4L 3SHSA 5F7DB 5FA3B 4WHDA 3U7AA 4CUCA 2Z4QB 4PJGB 3TFKD 1NMAH 3LSOA 5EU5A 3JV4A 4Z7WB 5GS1B 4B0MM 5E95B 2IQ9H 5EULV 4YHNB 5GGRA 1LK3L 2NXZC 3V0WH 3BAEL 4Z0XA 5KVGL 3AAZA 1VGEH 4HV8A 2H41A 4M00A 1VDGA 2UUDK 5FYJE 3ZE2F 3U36A 3PHOB 5F7WC 1AGDB 3TNMB 5KSVB 4J23A 4QHKI 1DTUA 1KEML 4LCWA 2DL2A 4JM4L 5CS7A 5BCAA 15C8H 3V0AC 4JANA 2WY3A 1T1ZA 1SM3H 1X5IA 1SEQH 2V9QA 4HXAH 3MLZH 3DARA 3H7BA 2WIIA 1NCCL 1NEUA 3PUCA 3R8BB 4OLZL 1G6RB 3CZFA 4MNQB 3TJHD 3NBNA 3BXNA 4HMCA 4Y5VC 1V5JA 5IKCA 1URLA 4XMPL 2YWYA 3MA7B 2DQEL 2EDOA 1S7TA 3LIZH 4P2CG 3VWJD 5C70A 3BIAX 5H8DA 4ZOBA 2J8OA 3OR6B 3KPOA 3D3VA 5IFAH 2R0LL 3FAWA 5ISZE 2V7HB 4PRDB 2VXVH 3KPSA 4GW1A 1NUDA 2OBGA 3B6SA 1EVUA 4U1GC 4U3XA 2R0WL 2YUZA 4AT6A 1TJIL 2VERN 2VDML 3FL7A 1MLCB 4G8GD 3MCG1 5C08B 4P9HC 4HFWB 1S7WA 4NBYB 5ICZA 3S35L 1KJMB 5DMGD 2JIXB 1KLUA 1RUQL 5DJXA 5GRZA 4GG6F 2W0LA 3KYOA 4PGZA 2D7TL 3SE9H 4I9WD 1UXWA 2D0HA 3WJLC 4EUPH 1DBKH 2HN7B 1IFHL 4QXGL 3HG1E 1JPGB 5F1NB 3QQNA 4EOWL 3KPNB 3CXDH 3JVGC 2EDRA 2B39A 2JJTC 4ODVH 3MUGB 3ZDYE 3GMOA 3LKSA 1W72A 4ZUVA 3SDDB 3U6RB 4YH6A 3B8SA 4XCYA 1NMBL 1X5HA 4HGWB 3CLEH 1HHGA 4I0PA 1LQSR 3DV6A 2YC1A 1RJCA 5EFIB 1PX4A 1DQJA 3T0VA 4D9RE 5FUCE 3MLWL 3CVHB 3UYRL 5D7JA 1SY6A 4OD1H 4LCWB 1DUYB 5L2JB 3FT4A 1SBSL 3O9WD 2XWTA 4JAMB 3IVKA 25C8L 1BOYA 4P5MB 4ZUTB 1FLTX 1A2YA 4XTRC 3MRGA 3JV6B 5FYLE 4MD5B 4Q6IA 4H1LG 3T65A 4QOKD 2H26B 3BP6A 2CDEA 3SKJH 5L2JA 1FNEB 3QUXD 5GGRB 1AP2B 2UZXB 1J1XH 4OLVL 5E8OA 3HUJE 1JGEB 1OP3K 1PYWA 4FFWC 5MEND 4OUUA 5I73B 1KG0B 2ZJSL 1RUQH 1WUNT 4U0RC 3S96B 5IBTH 3QR2A 2F5BL 2A9NL 4L9LC 4R2GC 3BOVA 2AJ3B 3D9AL 1DBKL 4QXGH 2R1XB 1J11A 5HBBA 1MRFH 1CDIA 5BS0D 1GPOL 4WUKH 4Z95H 3T0ED 3CLFL 2XQBL 4HJJH 4QF1A 2WSKA 1B4JH 3G5XA 3GMRA 3O4OC 3TJEL 4OLUL 4Z7VB 5I18L 3G6JE 2DQDH 4HAGA 4IRJD 5D2LE 3RIFF 1GGIL 1IM3A 2DKUA 2FJFB 4P99A 5T5FL 4MXWL 1TENA 1FL3A 2H8PB 4D9LH 2AEWA 5DWUH 4P4RA 2E9IA 2VXSH 1ZLVH 4GRMB 4NFCA 5D2NE 2IPTL 2ZP0T 3RL1B 3MZGB 2PF6A 4R0LB 3FQWA 1G9MC 3NPSB 1F3JA 1YNKH 1NGYB 3GUTA 3UYOD 4RQQB 3MJGX 4PRNB 3QNYA 2OTUA 3RFZC 5DYOA 1CQKA 3R1GH 1YPZB 5J11C 4U1JB 4OKVA 5I8KH 1RZJH 4LMQE 5HPMB 1F4WH 5KOMC 2WP3T 2GUOB 3NTCL 1LO5A 5D7IE 3GSNB 4Z6AT 2UY6A 3ARFB 1U91A 5FECA 5D4QA 2V5MA 4R7DB 1MWAA 2X4UB 2HTLD 4MNHA 3EYOB 3D87B 5ID0B 2GIYA 2BC4B 3QUYD 2ADJA 4KJPC 3D85B 4OFKA 1S7VA 2DTML 3NPZB 3TBYB 5TH2B 3HAEH 3SCMC 2FJGA 3O2DA 1C5CH 2KQNA 4WUUD 1FL6B 2F53E 2G60H 3VXQB 1YJDC 4HKBA 1UCTA 3BEVB 4LSVH 4G9FB 1UM4H 2VXQH 1P4LB 3LPGA 3GHBH 1S9YA 1KELL 4YHLH 1CVRA 2VR5A 2Y07L 5CJOH 3ESUF 3QIWB 2FHFA 2BVEA 1YY9C 3T3ME 5ALBL 2BDNL 3OXRA 1EIBA 1RVFL 3SDAB 1CDYA 4K7FB 2E7MA 5EIVA 1U3YA 5FA3A 4CRPA 4HMEA 5FYJD 1TZGH 1UWGL 2KZ1B 1IC1A 2PN5A 3C60A 3E6HB 1BEYL 3BPLC 3PHSA 3QIUC 3VFOA 5JHDD 4CJ1A 2AGJL 3MV01 4W70A 1FGVH 1LO0L 2AJSH 2W65B 4RGOL 5ADOH 4GKZA 3KYMA 1J88A 4OLVH 2NCMA 5E2VH 3MO1B 4EI5D 1A1MA 1X5XA 5J56B 1YEJL 5GGQH 4MAYB 2EE3A 3SE9L 4RX4D 4UINL 5FDWB 4YXLL 3DVFA 4JFZH 3L6FA 7FABH 2Z9TA 2P5WA 4FXLA 1QFWM 1RQ5A 4QRSB 1KCSH 1HWGB 3D25B 4LRNL 2Q87A 3DX7A 4ELKA 4YDLC 3SDXB 1I7TB 3TBWA 2EDFA 1EJ6A 2Q86A 5ICYB 3LQZA 3Q3GA 3SKMA 4PJCA 1K8IB 4ZDHA 4MCZA 4EDWL 3RKDC 4S1RH 2EXYC 4LLMB 3F7VB 5TGBA 3SOBH 1OLZA 1NEZB 4OZHA 3ARBA 4U1MB 2C1PA 4BZ1L 3P77A 5FM8A 3GMQB 4DKFH 5BQ7B 4LLMA 1AE6H 4IIQB 1A4JA 1WWWX 4PJCB 3HZVA 5GRJL 1HI6B 1YNKL 4KAQL 1WCQA 1ZHLA 5DRZA 2C3HA 4W81A 1BLNA 1OGAB 1RIVH 3IXAB 5HYJA 2XZAL 2OR8A 1ZWIB 4M8QB 3SN6N 1CYGA 4D3CL 1EA9C 1EEZA 1S9YB 3RWHA 3QQ9C 4MXQC 3MRMA 4AEIH 1DLFH 5IWLC 1T22A 1NAKL 1SHMA 1X7QA 1FE8L 2DM7A 1JK8B 3GO1L 4MJIE 4RGMC 3ALWA 3RVWD 2VLRE 1WICA 4ZODA 1EAPA 3V0WL 4NQDB 1Z9SA 5DT1H 1UT9A 2VLJD 3GSRB 3KGRA 3UTZA 2D7OA 3D48R 3SDYH 5E7FA 3LMJH 5IBUG 4Z5RA 3GI9L 2IJ0C 5TH2A 3KLSA 2YSSB 2CPCA 2A9NH 1X5ZA 1P1ZA 4NQEE 3RIAK 4E41A 5BO1L 1H3WM 3QNXB 1U3HA 1BQLH 1F11A 3E6HA 4NZUL 1MWAH 3VXUB 2GUOA 4QHMA 1ORQB 3L95A 1W0WA 4QHLA 2JCCB 1P5UA 1F13A 5DC0A 1KN2H 4C4KT 1Y6KR 2VZ3A 4P9HH 4D9LL 2PO6C 3P4OB 1K8IA 4ZDHB 3DURB 3HG1B 2DTSA 5EBLB 5CUSL 5ICYA 3BZFB 3UP1A 1QBML 5K93A 1YEHL 3VXPB 3LV3B 4ELKB 1KBGL 3DYOA 1UXSB 3H9SD 5D1QB 4X6BB 2BCKB 3ESVF 3L5IA 4JO1H 3ES6A 4HUKB 5I19H 3CFDB 2GEEA 1NDGB 2AXFA 1QVOB 4XH2A 3KPRE 5F97E 1MAML 3CX2A 4PJIA 4RZCA 1K4CA 1HOCA 1E28B 3PDGA 3TIEA 2FX7H 1WCBA 3VFNB 1MCHA 2PTUA 4NQCD 4CAGA 3SPVB 3PWJA 4ODSL 1BIIB 3CFKA 1IBGL 3QCUL 4N5UA 1EJOH 3VW3L 3CFJA 4NM8H 5JPMA 3JTTB 3ULVF 2WUCH 3CFKB 1FORH 4I8DA 5MP6L 1JMZA 4DOHB 3OXRB 3TZVB 3RWIB 1QQDB 5DZNA 3KYNB 3S36L 4HF5H 4Y8DC 3EOAA 3DMMD 3VXOA 3R4DA 3VFNA 4JRXD 4F8QA 5CJOL 2HFEA 2R69H 1HOCB 3T08A 3QJHB 1EBAA 2EXWC 1J0ZA 5CILL 1KCGC 4Y16A 2HJKB 4QRQB 3P0VH 3CUPB 2FHBA 5CHNB 4L3ED 5KVFL 3UPRA 1NFIA 5FYKH 3RVVC 3KYKH 1KB5H 4F9LC 2BRRH 4YHIB 1FBIH 2Z31C 5HI4D 2Q6WB 4DKAA 4XRCB 3S3PA 5ANME 3MRLB 4JPWL 3RJDA 3GSNA 2B1HH 1F3DJ 3OAUL 5L8LB 1LO5B 4MA7H 3MRBB 3G5VB 4I48A 2RAMA 3EZJB 2BNRD 1RZGB 4RWHA 2QSCL 5B3JF 1NGQL 4MAUH 1XF5A 4OSUL 2NY6B 4NO3A 2IBZY 2I5YH 4WTXA 3QDMB 3C5ZC 4KKCC 1KB9K 4WEBL 1FFQA 5HVHB 3MRPA 3ZKND 3PV7A 1QSFE 4GFTB 3MFFB 4PLOB 4R4NC 4MD5A 3D3VE 2N56A 4XP4H 1P6FA 4HBQA 4N1CA 2KKQA 4IOFC 4EVNA 1G0YR 2YKLL 4KKNA 4G6FD 4NQXA 1C16B 3GGWB 4TSAL 1EUTA 5T5FH 1KJ2A 3GJFB 3LRGA 4QGYA 4B5EA 3QJFB 2YUWA 1KACB 1LEGB 1AXIB 2A6JA 4LSPH 1IEHA 1I7UB 2VLKA 3D1MC 5EZOL 4P48A 4K7PX 3KR3L 1P4BL 1EEZB 5EUOE 2R2HA 3O6KL 1AO7D 4IRSD 1W72B 3W9EA 2DLFH 3MLUL 3DX8A 1BLNB 1OGAA 4P2OC 2VNCA 2BMKB 4JFEB 2D0GA 3HCVB 4LHUG 3MLYL 4WFED 3AREA 1TVHA 2AEIT 4JN1H 4JY5H 2Q7YA 1T1WB 3I6KA 5LAXA 3VXNB 3EOBB 2F5BH 3U4BH 2YD4A 4PJHA 3CCHA 4WNQB 1U3HC 4X5LA 3B2VH 3CMOH 3MNWA 3MV7D 2ESVA 4G8EA 5A16A 4PJEA 2ITDB 3LQZB 3Q3GB 5BZWB 3ULVE 5JTWA 2FYYB 1KT2B 4ZTPL 3SDXE 4N0CD 4G8GE 4XNUH 1CZ8L 5I1IH 1XH3A 2XWTB 3ARDA 4HIEB 2FNBA 3PWNA 3D2UD 2HP4A 4S2SA 4JHWH 4Z0XB 1PW3A 3MZTA 3V5KB 2I27N 5EWIH 4CMMA 3DSFL 4M1GL 1A9BA 3OGCB 5DJ0B 3W81A 1R5IA 4XP4L 1U8JA 4O2CB 1NMBH 3E2HA 4UT6H 1RIHH 1Z6JT 2O5XL 4OT1L 4I0PB 3QEQA 2DI9A 3CD4A 5FDYA 3MGOB 3QIBC 3C2AH 5DJDA 3BP5A 4RFEB 2VQTA 2VXVL 3VWKD 2LTQC 2E7CA 4YHKL 5IW1B 4YDLB 4YEEA 1B6DA 4N0YL 1MLBA 1U8LA 2NTFA 1UWGH 4D2NA 5IV2A 3UZEA 3T1WA 1U2CA 4L8SA 5EZOH 1MCEA 3KR3H 2NX5B 1Z9OA 1LD9B 1JBJA 4NO2B 4G6KH 1M6OA 4K3HA 4L3CA 1AD9A 3S35H 3RBGA 3FOMB 3WN5B 4FABH 3UTSB 4TULH 4OZHE 5GPRA 2CKBH 4K3JL 3WKMH 2HVKA 2EKJA 4S1QH 4HFWA 5D1ZC 3RUGF 1NGQH 4MAUL 1XR9A 2YD3A 3INUL 3SE3A 1JHKL 3WV0A 3CH1A 4N0UE 1QQDA 5DJAB 1EVTC 4O58L 5A2KH 2VMFA 2N4IA 3VXSD 1DN2A 2IH3B 3K1DA 1MJ7L 3IDXH 3KJ6H 2YS4A 3HA0A 1MFNA 3S34L 2UVEA 5C09D 1ZS8A 1FJ1B 4NT6A 3SY0B 5HHPA 2C5DC 4HWEH 1EEUA 2N1KA 2Z92B 4OFDA 1JNNH 2JF1A 1N64H 2P47B 2YN3A 3WFDL 4HIXL 3OJDA 3NFSH 1D5IH 4LF3B 2R0KH 4EDXB 4QRPB 1WAAF 4IHOB 1JNLL 1R3KA 3ARWA 1KLGB 3NCCB 1DBMH 5F1KC 4AIZA 3OF6A 3ZYZA 4L4VD 3DECA 2FO4B 4JHZA 3BT2H 1Y18A 4XCEB 1PX3A 1XF2A 5GRXG 4TSCL 3TWCH 2A1WL 3DXAE 1IL1B 4RIRB 2PTTA 5BS0A 2ZOKA 2OK0H 1UVQB 3BRDA 4X7TB 5E8PA 4PJBB 2OI9C 1QR1A 5DC9B 5C0RL 4Y5XC 4R0LA 5BOPA 1Q9KA 2C3VB 2X4NA 4JN1L 3IDYC 1B0GA 4ENEC 2JJVA 5H37H 2X1OA 3E3QA 4ZOAA 3L3OA 4CU8A 3U0WH 3EYQC 2HKFL 3JTSB 5C9JA 4NO2A 2DM2A 2YPLD 4AG4L 1ETZA 4P2QB 1J5OH 5KTEL 2HJFB 3QUKA 3W5MA 4ZFZB 4GXVL 3STZB 4APQB 4O5LH 1MI5E 1LEKA 4N5EC 3FB6B 3MREB 2LFGA 1P84K 2Q1EA 1A6VH 1A3RH 1OSPH 3S96A 4YHZL 3UZVB 2O5XH 2OSLB 1T21B 3EUUA 4GRWB 4K94C 1CBVL 3OKKB 5KVMC 4NKDA 3MRCA 1AY1L 1ZVHA 4UB0L 1G0DA 4UV4L 3I84A 1IQWL 1NGPL 2P8MB 3H3PH 4NRXA 1IJ9A 5GIRA 3RWHB 1VERA 4KHXL 1NBQA 3S88H 1IEBB 3MV8E 2H26A 1R5WB 1KBGH 4ZO6A 3RVUC 3X13A 1AIFA 3N1GC 1BBDL 4UIMB 1A6AB 3GZKA 3WO3B 4ORGB 4LU5H 3P4NA 2XN9D 1JVKA 3QBTB 4ONGL 4N9GB 3FT4B 2AAVA 3FT3A 5DURB 4ZUWA 1AKJB 2F54E 5IEHB 4YEFA 4NP4L 3VXNA 2E27L 4CADA 3MLVL 4PRHA 1UJ3A 5FHAL 1D9KB 1K8DB 1DBBH 1IC4H 1I1YB 3O6FD 3WNNA 1RJYB 3DVNA 4U6HB 1T4KA 3O6FC 1R3LA 1KTLA 3A0OA 4ZSOA 1UM5H 5HJ3B 3MFGB 1KPVA 3MCLL 1BZQK 1F6LL 5B38A 3MLXL 5EBMA 4K3DL 4OCMC 5CD5C 2CUMA 1JF5A 3LPFA 4R90L 1XIWD 5FCUL 1T66C 5DJ6A 3RZWA 1XMWA 3GK8H 2QADB 4I0KA 1FFNA 1C16A 3ZZ1A 4ETYA 4RWYL 4H20H 4UOW1 3I50H 5IF0A 1K2DA 1T5WA 4KTDH 3RWCA 4PTUA 1GC1H 4MA8H 3WIHL 4X4MA 3JUYA 1ZK9A 1A21A 2ARWA 2EYSB 2ZG1A 2A1WH 2ICWI 3HAEG 4XPBH 4ZO9A 5JPNB 1AI1H 1MI5D 4L8BA 4F58H 5CZVL 4PLNC 1LMKA 3ULVD 1C7SA 3MJ9H 3DUUA 3Q5YA 4ZG1A 4HWZB 1BMGA 4JFEE 4I0CC 1H15A 4PB9H 2IAMB 2DICA 3L3GA 1ZLUK 2XN9A 4PGBB 3JVGA 4K7FA 2A6DA 3OSKA 3MRJB 2OI9A 2I9LB 1JPFA 2B2XL 4UDTA 3TIDA 2IMNA 1RD6A 4I3GA 4MA7L 5MEQA 4YPGA 2OXGA 3GIVB 5I8CB 3QP3A 5HHME 1EJOL 3OTTA 3VW3H 1UYWL 1N4XL 4JKPL 4YXKH 1R5VB 1ES0B 1G7IB 3PGCA 4M3KB 4EI5C 1MF2H 3AXLA 5FEBA 5FHAH 3PHQB 1DBBL 1IC4L 5E24E 2NY4B 2VTFA 1A6VL 3L3IA 3OL2A 4N5ED 5JORA 3QDGD 3EYOA 3TA3D 2XTJB 4MX7B 1EXUB 2YA2A 5HYSB 5B8CB 2XWJA 3MODL 4JFFA 4HV8B 3AAZB 2XY2A 4R97B 5IVOA 3GK8L 3IXTB 4P46A 2OR9H 1U58A 1TQBB 5IOPA 3BPCB 5CUSH 2ZOLA 3VXMB 1U92A 2OTWB 2AJVL 4JRXA 4P59H 1R3HA 4M7ZB 4X8JB 3CK0L 3VE0B 4RGNC 3Q6GH 1MUJB 3OPZH 5HHQB 4G8IA 1S7XA 1JV5B 2MPAL 4HK0A 1MH5A 4NM4L 3EAKA 3RWJB 4PTTA 4TSBH 2W0PA 4NYLA 3TH2T 4PRHE 1T89C 4G9DB 1HYSD 3U4BL 3VWJB 4OZGF 3R0MA 1SY6L 4MJ4A 4FFYH 4G80A 3CFDA 1E6OH 1X5JA 3GSWB 4NNXB 5I76A 4OGYL 5E7BA 3MTRA 3E2HC 4P5TB 4NZUH 2RR3A 4R4BA 5IHBA 2NY5L 2P8LB 1B88A 5CJXC 1A02N 5DJCA 1B4JL 2BNRA 2BNQA 3TJEH 1QO3A 1X4ZA 1AD0B 1FQ9C 1KC5H 5JZ7C 3MRHB 2R29H 5J57B 4NRYA 5H35B 4HZAA 1RU9L 4LCYA 5D2LF 5EUKA 1QEWB 4G3YL 3CVHH 5CGTA 1CDCA 4B7IA 1YEHH 3JWDC 3CFBA 3O11A 1C8PA 5DQDL 5BV7B 4DEPC 3FO2B 1WIPA 4HS6A 5KSBF 1DR9A 4QRTB 4KDWA 3IU4L 1FG2B 2I60H 3LH2H 4GBXD 4MVBD 1CE6A 3SJVD 1KJ3H 5FA4B 4EN3A 2XWBB 3TN0D 4WDIA 3OV6A 4WI8A 4W6XB 2J8UE 3I6LD 2NR6C 1U2HA 4PJ7F 4DN4H 5EC2B 4Y4HC 1AO7A 1DN0A 1DQJB 5E9DA 2JKXA 1OTUC 2IAMC 1LO2H 1EO8H 1ODAA 4HS8H 4NM4H 1CGVA 3E1F1 3LS5H 4ISVA 3NABH 4QLRA 5GRUH 1T0NA 5KZCB 1X5FA 5D71L 4YFDB 1YEKH 5C0FB 1L4IA 1UM5L 5I17B 1YN7A 3LEXB 2O93L 1F4XH 3DTXB 4YGVA 1RZKH 1EAJA 3QEUB 4H0HB 1U8OA 2XQYG 4F3FA 4FTVE 4HJ0D 2Y7QA 2Y06H 2RBLA 5I17A 4HIIB 1QUNA 5CEZL 4NN5B 1TNMA 5SWZD 5C0DA 3GMQA 2C1PB 4GRWE 2WP3O 1J0JA 4S1SL 4MQ7B 2XG5A 3QO0B 4YFLF 4IOIA 4PJFA 4E42B 1XIWA 2OJZL 2YPVL 1MVFA 2BSSB 4BZ2L 2PCPB 4OCWH 4PRBB 1F58H 4HC1H 5D8JL 3EYSL 1YEGH 3HZMB 4TUOA 1MHCA 4QTHB 4XPFH 4JVWA 5JDSB 4M61B 3VXSB 4XNYL 3OR6A 3GSQB 3BGFC 5KVEH 3JWDH 5D6CA 2IEPA 2AXGB 2A0LD 4JG0L 5CJ5A 3OG6B 4OV5A 4OZGE 4HCRL 2P1YA 4N0RA 4PY7A 1LO4L 3DIFB 1F4AA 1I3VA 1VKXB 2NY0D 2AABL 2ZG2A 5E1HB 4XCFH 3OAYH 4NZTH 3F7PC 4PPTA 1CF8H 3W0WD 1F3RB 4U1NB 1UACH 4F2MA 5DA0B 2XT1B 1J05A 4IJ3B 5D9SB 4MCYA 1P7KB 3EO9H 1J0KA 4S11A 5ITFA 3TNMA 3BISA 1KTKE 3I6GA 3U36B 2MHAB 2HWZH 4LL9A 1LVEA 3GJEB 4YDIL 4JFQA 1MIEL 5CJQL 3GMNA 4LVOB 4M7ZC 4HIJB 3ET9F 3FONA 4KJYA 4XVSL 5DTFA 3PWLA 4L4VB 3E8UL 1IGYA 2VKWA 4WO4A 5CZKA 4BKLA 4DKDC 1NSNL 1A47A 2G2RA 3GRWA 5DQ9A 5DHXB 3VE0A 5T1LB 3A6OA 4Y2DC 4LGSB 3TM6A 2MCPH 3KPLA 1IMHC 1NCBL 3GSVB 4I13B 4JRXB 3V4VH 1F58L 1S7VB 2V2XA 4KWUA 1FH5L 1YQVL 5H35A 4XXCA 5L7XH 3GO1H 3M45A 2VZUA 5J3HD 3FFDB 1JGVH 2UYLA 4LDEB 1JZ3A 1IILE 3DI2B 4DW2H 4HQQL 4QT5B 4PJAF 1L6ZA 3IT8D 4E0RB 3BD3A 1F3DH 3AB0B 3DMMA 5FYKE 3QWRD 2GKIA 3L9RA 4R8WL 5I76B 3MRQB 4PG9B 2P48B 5L0QC 1RZKL 1OP3H 4Z0BH 3QZWB 2L7UA 3T4YB 1LP9F 5D7LD 4FFZH 5JQ6H 4FQLL 3ILQC 5D1XD 1I3UA 1FC1A 1ORSA 3IJYB 2OMNA 5CZXD 3I3DA 1WBYA 5FF6B 4NKOB 5I6XB 5CZXC 2ED8A 4AL8H 2HG5A 1JYWA 3MMEA 4WWKA 3QUYB 2PR4H 5DURD 2LAGB 1FYHB 1TXKA 4K94L 3RNQB 1NMAL 2EC9T 2I9LA 3QUXC 3BGAA 2BJML 4ZNCD 3RWGB 3UEZA 4NZRL 1QRNA 2GJZA 1U58B 4L5FL 1AQDA 1FNAA 3TFKC 3V7AE 4ODXB 3OKOA 1OW0C 3RWDB 1X3DA 1D6EA 4OIIH 3V5DA 3QXAB 4F33A 3S4SG 2VH5L 1G7JB 4NQED 4OCXH 4IS6A 1F02I 1RK1B 5KN5B 1QKZL 4GBXC 3QEQE 4DQOL 1IEAB 3KNBA 1N59B 2DQCL 2VSCA 3HLAB 2UWEA 3R06B 3RWCB 5FKPB 3DGGA 2OP4L 5EIQA 2IWGA 4LARL 1Q9LB 4PBWD 4LSQH 2VLRD 4EN3D 4F7MB 4Y16D 1TTFA 3O6FB 1F8TH 5IMMB 1S8DB 3HC0B 3O3AA 5DC4B 4M93B 1T2QL 2VLMD 4GRLC 4YLQT 4AG4H 1P6AB 1XEDA 1K5NB 3P73B 3T1FB 1FORL 3L7FB 3QDGB 3SDCC 4ZS7H 1N2RB 1CGSH 2YEZB 4DGYL 4PJXB 2E7LA 3UTTD 3FQUA 1NGWB 5C3LD 1MREH 3ECBB 4UDTB 1C12A 5F9AC 2XXMB 3STBA 3UJIL 2OI9B 3MRJA 4KRLB 3SJVB 1W8NA 3UJTL 3ZE1F 1H15B 4QY8A 1MHPH 1CU4H 4XNMA 3PL6A 1A7BA 1TMCA 3ECBA 2APTA 4LSRL 3VG9B 4MS8C 25C8H 1OAKL 1N2RA 4UQ3B 2QR0B 1YMHA 3G5YB 3MRIB 2H1PL 2EH7H 4CVWA 3TT3H 4G6MH 4YQXL 1M05A 2GJJA 5DXWA 1D5MA 3MXWL 1JP5A 2RB8A 2E5EA 2NMSA 1IEBA 4X4ZA 2X6MA 4WFGE 3VMNA 1JPGA 1BECA 1P2CB 4JRWA 1I1AB 1IGIL 2W9DL 3KYOB 3KHQA 3PL6C 2FBJL 5MI0B 1OTTC 1QFWH 4XHJD 4LVHB 2JIXA 3TA3B 2JB5H 2CD0A 1IZJA 1WEJL 4YNYA 3ARSA 4NKQB 1IEAA 4JQVA 4NC2B 5LGKA 1JJUA 1S7QA 3FOLA 2AS5M 1FGNL 1HH6A 1O7SA 4MNQD 1CLCA 2EXYD 2NYYC 4WI6A 3TVMB 1IM9A 2XQBH 4HJJL 1RZFL 2NZIA 1BFOA 4HUNB 3WL9B 2JK5A 3ZO0A 3HFML 2DYPD 1RMFL 4A2MA 1IM9D 2YPLE 4G8FA 1NCTA 3D18B 3QIUD 2X1QA 2W92A 1TITA 2YD2A 4K7PH 4KK8D 4NSKB 5F8RC 1L9NA 3SCMA 3U30B 5IW6B 4I5BA 4POZC 5C0CA 2Y6SD 1KXTB 5F3BA 4N5EA 5JHLL 1KB5L 2C1OA 3U0PB 1S8DA 4KTDL 4RMVA 5F9DC 5C2UB 2BVPB 3SDCB 3RTQA 2IQ9L 3SKOA 2EDQA 1HHKA 2C3WA 2NY6C 3DROB 1OW0A 2AKRA 1K6QL 5E5MA 5DRNA 2RFXB 4KJWD 4U1HA 2CXGA 2OMBA 4I2XB 1G9NC 1UJTA 1WV7T 5C0BB 3ILQD 3MR9A 2XKNB 4F9PC 5KS9F 1I1CA 4XB7A 1X5KA 2W60B 4HAFA 4MZ3A 5I1DA 4WWKD 2X70A 4U1LA 4H1LH 5CBAB 1UWEH 3TCLB 4I18B 4O4YL 4XB8A 3CDCA 15C8L 3K4ZA 1AXSB 3VA6A 5AZEH 4ZFZA 4RRPA 5D7KE 1A7NL 1FJ1A 2PYEB 2D7PA 4U0QB 3QQ3B 3WFHB 2RCSH 4ZAKB 4Y19A 4FOMA 3HMXL 5DI8A 3WLWD 1AXTL 2BHYA 5BZDA 3NFNA 1MIML 2HMID 4HJ0C 3WLBB 4JDZB 3X12A 1R6VA 2FGWL 1NLDL 1W0VA 3WS3B 3ULVL 1NC4A 2CO7B 1JI2A 3ARQA 1FVEA 1PZ5A 3PP3H 2FX8H 4JFYA 4NJAH 3R8QA 3P0YL 3RDTA 3BUYB 1FO0A 2UWEF 5E94A 2ZSVB 4GSDL 4L8SB 1D5BB 3TBVB 3OAZK 4Q58C 3G04B 4I3SL 4WO4C 3ULUH 3C60D 3RIFK 1IGJB 1CR9L 1MCWW 1WFOA 2DWEB 4G6FB 3NACL 3JWDL 2HTLC 2OZ4A 4YX2H 4PP8C 3BP5B 1N4XH 2VLJA 4LKXB 5TDOA 4QWWD 4LHUB 1T5XA 3KWWB 2VL5A 4DCQB 1WQVT 5GGTH 5FUCC 1F90L 2VRAA 5J0BA 1BQUA 4X9FA 1MF2L 5HHOE 1ZA3B 2Y36H 4UBDD 1IRAY 4Q6YA 4JDVA 4IOSD 5D7JC 1BQLL 5INCA 3RY6A 4KJYB 4PLJC 5DTFB 1MJ7H 3IDXL 4KGLA 1PZUB 3I75A 1FIGH 5SWQA 2ARJQ 3IRZA 3K2MC 2BSSA 3MXVL 1JNNL 4L4JA 1TZIA 4M7KL 1AHWA 4X4XA 3EHBC 1FNSH 1ITBB 1OGAD 2NXYC 3C09B 2CJUL 4D9RD 3VFWB 1T1WA 3I6KB 3DRQA 3RI5K 4ZFOB 1T80A 4NUGH 3QRGL 4UTBH 4XTRD 1TVHB 4JPKL 5AYQA 3BQUD 3TLRA 4G3YH 2BOBA 1ERNA 4Z7UA 2BMKA 3WJLA 1HSBA 2VDKL 3Q48A 1N6QH 1DFBH 4GXUM 4PGDB 5IB2B 1RZIA 2CLVA 4U1KA 1F45A 2VQ1B 4PYGA 3K7UA 4DUWA 3CU1A 3QSKB 4K8RC 1U8JB 2W9EL 5IB1A 1FRGL 1E27A 4KI1A 5T1MB 4H8WL 3BW9A 3V5KA 4KPHH 5GS0H 3D3VD 3AMKA 1NFDB 5SWZA 5A2LH 4FNLL 1J18A 1A7NH 1N8ZA 2YOCA 4UOW0 1O0VA 1P7QD 4JN2B 2X05A 4XP5L 1MFBH 4Y5VA 3BWAB 1D5ZA 5B38G 5JNYA 2ESVB 5IFJA 1IQDB 3ARGD 4HSQA 1UADC 5IR1B 1GSMA 4LEOA 1NMCB 3VWKA 5DF0A 4H26B 3FO9A 4X6CE 1UM4L 4TUJB 2VDLL 1IC7L 3ARXA 4ODWB 2YHGA 2DD8H 3NPSC 3QDJB 3B4NA 2H3NB 2HJLA 3EOYG 2WV3A 4LVOC 2F54A 5GS2D 5D7LE 3REWA 5D1QD 1IGMH 1MJ8H 3MRHA 5E5UB 4GKNA 3RQ3A 4F8TA 3EYVB 1QO3B 5B39A 4M6ML 1CVSC 2DMKA 5DJCB 3KG5A 4KKLC 5I1JL 1TQBC 4LLYA 3VFVB 5F6IC 1BEYH 1R24A 4OZIF 1W0YT 4YDJA 1ZLVK 3H2WA 3UXFA 2XY1A 5IB4A 5JW4R 5MERA 1MFDH 2P8PB 4PJXE 4XPFL 1U9KA 5F8QC 2HJKA 4OLYH 3LKRB 3SJVE 4NQUA 1LILA 1GGCL 4XNYH 4M6NL 4KMQA 2XWBA 4HWBA 2QSCH 4XWOD 3ZKNC 2NY4C 3CSGA 2V2WA 1CE6B 4ZPTB 4GXVH 5GJSH 2WLYA 5DUMH 4BH7A 4N90E 3DX9B 1JYXA 4QCIA 1Q0YL 2B4CH 5DHVA 3RWIA 3VGFA 1EO7A 2V2TA 4NZTL 1Z9LA 4I4WB 4Y16C 3B9KD 4ZO7A 3ZDZE 2ICCA 4LCYB 1NKOA 2ZOLB 1MFBL 2VITA 4PGEB 2A83A 3DETC 1U95B 4OZFA 5EZIL 3U9PL 2NXZD 5FYLD 4LRIA 5EU7C 1PEWA 2D9QB 2DYPA 1QPPA 3NCEB 4RMQA 5DD0L 3WLWC 4OZFG 2AEPH 2VE6A 5GHWL 3SOBL 4P2RD 4P57A 4LCWD 4WENB 2YWZA 4NQCE 1EZVX 4OCSL 1XR8A 2ENYA 2YPKB 1XGQB 2AV1A 1ZTXH 3DXAB 2HLAA 1I3RB 5EU6A 4OTXL 3U2SB 5KVFH 4DQOH 1Z3GH 5DJ8A 3DXAA 3LB6D 2X1PA 4M6OL 1NAML 3MC0A 2H32A 1DE4B 1N6VA 2WK2A 4XC3H 3VGEA 4NDMB 4OAWB 5EU7E 3RUGB 3BGMA 5KJRH 4Y4KD 3SKNB 1BQSA 3SQOH 1FRGH 3I02A 2EDLA 1PQZA 2EO1A 3CXHK 5D1XC 4UZGA 3TZVA 2EO9A 1GL4B 3K80A 5FUOL 3BKJH 3NN8A 1QFWI 4X6CA 1BGXH 4JE4B 2FIRT 2X4OA 4M6NH 3V79C 4Z77A 3HAEB 5LVEA 3IFOB 3IJHA 1MI5B 5B39G 4OI7A 4R90H 4P9ML 1DZBA 3CLFH 3QH3B 1QBLH 1BZ7B 1SVCP 4LGRB 1BVKB 4GG6E 5ILTL 1MREL 1J8HD 3UJIH 2VDQL 5DHVH 2HT2C 3I50L 1AGCA 5C07B 2V2WB 2DIAA 1DQDH 4KUZL 1S78C 3HFMH 5B8CA 4LCCB 5IK3A 4DEPB 3EYUH 5DEFA 4LPCA 4PJGE 2X1WL 1AR1C 1R0AL 3F5WA 2ZG3A 3OZ9L 4J2XA 4GQPH 3PGFH 4NBXB 5KAQG 3X3GH 1SJHA 1UXSA 3FCTB 4H1LB 3LN5A 2XTJC 2MSPA 3B8YA 1UWXH 4YDJB 4PJIF 5F7HA 4BFIA 5L2KB 3ULSB 2XACC 4WU5B 3T0AA 4FQQA 5F96H 1R5VA 3HRZB 5EBMB 4H5SB 3QA3B 4M1DH 3S5LA 4LOUD 4G6KL 1FNHA 4OF8A 1WF5A 5F7MC 3NIGE 3VXTA 5HDOA 3RVWC 4Z7QF 3NH7H 2EH8H 5I66A 3TESA 1J1PL 1PG7W 4OLYL 4AEFA 5JO5B 2L7JA 1JTOA 2G75B 4UT9L 5IBLD 1CIUA 2XKSA 4KXZH 3VWJC 5GS0L 2Y72A 2CIKB 4LEOB 1E4WH 1F4HA 4V2BA 3WYRA 4W4NA 2CH8A 4ZD3L 4RISH 3T2NH 1W72L 2NY2C 4WI2A 1KN4L 3KDMB 1T03H 4WU7B 8FABA 1EERB 4PY8I 3U7YL 4HFUL 1OTSC 4XBPA 1KN2L 2GT9B 3LEVH 4MAYD 1KUMA 1HINL 4PJ9D 3QIBD 3JBG7 2LV4A 5I1EL 3PQYB 5HYIA 5JW4N 1CFVL 2VLJE 5C7XL 5C08E 2BVTA 2UZYB 2PW1A 4Y89A 4KUZH 1BQHB 1AGEB 2XRAL 3W2DH 1C1EL 2AVGA 2JJWA 3VH8G 3IDJA 4AJ0A 4Z8FL 2A9MH 4WU7A 1I7ZA 3QWRA 4UTAL 3KHOA 1IAII 4HLZG 4NKIL 4AQOA 2NY7H 2R1YA 4X98A 3U4EB 4HKXB 3LKOA 1QLRB 4KTYA 4IDLA 5KSBE 5KVGH 3VFUA 5TQ0H 5DQJB 4ZXBC 5IMOB 3BSZH 3RZCB 1FVCB 3C60B 1HH9A 4ZAKD 4EI5B 2V6HA 3FT3B 3MSPA 4F7TB 3BH8A 2LU7A 1FNLA 1J7VR 4NGHL 4IJ3C 1Q0XH 1WBZA 3BKJL 3QUZD 2EDBA 4OGYH 5K59F 1BWMA 4M02A 4AIXA 3KLHD 4PR5A 2QKIA 5DUML 2XI9A 4GAGH 1JF6A 1EO5A 1RUMH 1A22B 4JM2A 4LSSL 3L6FB 1A6WL 5D1ZB 1TJGL 1ZT7B 2GSGA 6FABH 1V7NH 3QXVA 1UA6L 3VD4A 4MMXC 4CNIA 3QDJE 3BX7C 2AEPL 3MLWH 3UYRH 4MQSB 1RZ8A 1SYSA 3O6MH 2PO6D 4D8PA 3LCYA 2KL6A 4RBPH 1GXEA 3PNWA 1ZTXL 2VLRA 2H1PH 4PLKC 2MQ0A 5FGBA 3ZHDA 3RI5F 3VH8B 4Y88A 2E9JA 1A4KA 4E5XB 4EBQL 1NC2A 4KZEL 3GMLA 4BJLA 3BH9A 4PJGF 2PXYC 4PYHA 4YWGL 3BP7B 5HHMD 4V1DA 5A1AA 5M94B 3C5JB 4X6CB 1WBXB 1YDPA 4YX2L 3MV7E 1G6RH 3O9WB 3P4MA 3CX5J 3CH1B 4EXKA 1ZHNB 1ZT1B 2ZKHL 3F7YB 3KPRA 5JHDB 1KSRA 1U8NB 5EPMA 3TC9A 4Z7VE 1JRHL 3KJ6L 2AK4E 1OCWL 3GNML 3H9SB 4N8PA 3QPQD 1UWEL 2NY4D 1XCTB 5MP6H 1TCRA 3GMRB 1A6ZB 2VAAA 3ISWA 2H6PB 1I1RA 3TZVD 3WFBH 5DD1H 1G9EA 1KF9B 5DD6A 1CIDA 4LBEB 3V6FA 4MNGB 4IHOA 4RDQG 3D39A 5D70L 4OF7A 2CLRA 1MFAL 2X70B 3F58H 3EYUL 3UPAA 1MRCH 4HZLB 1R3IH 4JHAL 1KCUH 5IVXF 1R0AH 1ZHBA 4JO4L 3MBEA 3T0EB 4LLDA 4PRNA 3MJ7A 5FO9B 1AR1D 2V5TA 1QSFA 2X4QA 3RL2B 3MRFB 2CDFA 1Q9WA 4JM2B 1K6QH 2A0LC 1I8LA 4WUUA 2CMRL 2MTPA 3FQWB 3U1SH 4NQVB 3TGXA 1PBYA 3ARDB 4P23A 1CGTA 4QCIB 3CSPA 2P5WD 4HX1A 5T33L 1J10A 3L5WA 3MUY1 1KPRB 3SCMB 4JAMA 2GJ6D 1XF3A 4KDVA 3IVKB 1ITCA 4YK4C 5ANMA 2XICA 2V17H 4LKCA 5IBTL 4HKZB 2DQIH 3GBNH 4YIQB 4HBCL 3ME0A 1LE9A 5CWSA 4NQCB 1MCNA 2F15A 5IEKB 1ZLWH 4NNYB 1BD2E 1I9EA 1OF2B 4P5TD 3RX7A 4HUUA 2D03L 3KLAA 5EO0A 1O7VA 5C3TA 2PYFB 4WFFE 1Z2KA 2BY2A 1LDPH 4KQ4L 3GJFH 5I0DA 4HW6A 1P7HL 4HPOH 1JGLL 2G60L 3DX8B 4LLYB 2VDLH 4R96B 4BQ9A 1S7SB 4MXWH 1NGXB 3EZ8A 4PRHD 3N1MC 4GKNB 3KXFB 5I15H 4XWGL 3B5GA 2J7LA 2PYFA 4X6FA 1TZHA 3CDGB 3T4AB 3BZ4B 2LTQB 1INQA 4OQ1A 4R0LC 4HJGA 3F6IA 3EFDH 4H20L 3VGGA 1RK0A 3MRRB 5IIEB 2VOTA 4G43B 4FQXB 2CRIA 4OUOA 5HDBE 3FO1A 3IDMA 4X4YA 1CXHA 2FL5A 1XGYH 3ETBF 1MCSA 4URTB 3ZHKA 2GYSA 1FLRH 2E9BA 5L2KE 1VCAA 4UTAH 5I8KL 5IVXA 4DOHE 2VZVA 2EEAA 1VPOL 1RI8A 2ITDA 5C2BL 4XX1G 4U6VH 1RFDH 4TULL 2AI0H 3U9UB 4AT6B 3GKZA 1NCAH 4BUHA 3BRGC 3K2UH 1JGVL 3V5HA 4P2OD 1OARH 1DLHB 5C07E 4WFEE 3RIAF 5AG9A 1YMME 4JFXB 5CINH 3V8CA 5DLMH 1WIOA 1OL0A 3T2OA 1PVHA 5ITBL 4YXLH 3MRBA 3S37L 2B4CL 2EDDA 3PWPD 2VN7A 2CLVB 3S34H 3H42L 1QLEH 3RAJH 5LJYH 3WDHA 35C8L 4PV9B 5LQBH 2ED7A 2VLKB 1RHHA 4JY6B 5C8JB 5IMMA 1AGFB 3KPNA 2R4SL 1F6AB 2J12B 3X14A 3SGKC 1A7PH 1YMMD 5EO0B 4OI9A 3C9NB 3PP4H 2D7NA 1X5AA 2FEEL 4YHPA 4N8VB 1DQML 4MZ2A 4NNYA 3PQYE 1MFAH 4JGJA 4NQCA 1WZ1H 4DVBB 1TIUA 1N0XH 2D4FA 3DGGB 5IEKA 1YNTA 4KTEH 2NXZB 4XGZB 1T0PB 4D0DB 5KSVA 3R06A 3BEWA 2MJWA 3HNVL 1PDKA 3GMPA 5EU3A 5F1SA 3PV6B 4MJIB 2WM0A 1WIUA 1PKOA 1RV6X 2DD8L 4LMQI 4LVNC 1H3UA 3I75B 3RVUD 2UY7A 4I3RH 2APVA 4EBQH 3KPSB 3NZHH 4GW1B 5KSBB 3L5XL 1MI5A 1SVZA 1I85C 5KJRL 1TZHB 4EUPG 4LHQB 1NC2B 3CFIC 5HVFB 2NY1D 5IVXE 2WINA 3MBEB 4WVRA 3CMGA 3T0EA 1BIIA 5J7CC 1T5XB 1B6UA 2HKFH 5L6YL 3B2VL 3CMOL 5I9QB 3G6JF 3UMTA 4JZNB 1S78D 5DD5L 1UH2A 4PD4J 4IRJC 3KLAB 2G5BB 1KIPB 5EUOB 4NUJB 5FB8B 3TH4T 3ORJA 3ARVA 5I30H 1B90A 5JW4M 3QXTA 4OCYL 2RJMA 1TPXB 1CFTB 3E6FB 1A3QA 1IGCL 4Y16B 1IAOB 5HHXH 4JR9H 4JKWA 1MWAL 5D2NA 4YHMH 2EKSA 3PWPE 3QG7L 4GW4B 3LV3A 3O2VH 1DBML 2HVJB 5DJYB 5AUMA 1GGYA 1BPVA 4NC0B 5DMJB 5E4EC 4MXVE 5D7IF 5KOVC 1WBZB 5DK0B 4Y4KC 1MFEH 4O2EB 2EICA 4G8GB 3LQAH 4FXGA 4GAYB 5JUEH 1DVFA 2M8XA 2D31B 2GSIA 4DK6A 4KZDL 1BOGA 3LZFL 1PGRB 3GMLB 4TPRH 5HHOD 5DQ9B 2X4SA 3ZT7A 1TJIH 4JEGB 1FCCA 5IROA 5IMKA 1P84J 3VH8A 3LS4H 4OF5A 1T7XA 1IGYB 1WCBB 3FONB 4I3RL 5E6IB 3BJLA 4AH2B 1QSFD 4WI4A 1EEYA 4U6XA 1EMTH 2K9UA 2JB5L 3IFPB 5DLML 4V3DB 5HHOA 5J6HA 5DO2D 1QACA 4BFEA 3CZJA 3UTQA 3QXDB 1YA5A 3ARTA 3VRIB 3EFFA 3S3JA 2AK4B 1FPTL 3H9SE 3OF6D 3ZKMC 4EZMA 3GKWL 2J88L 5CGYC 3HKFA 4J3OC 4F37K 4JO2H 2NX5E 4IRZL 4OD2B 5EIIB 3U46B 4P3CL 4D9QD 1BX2A 1HINH 1M7IA 3FRUB 1GYAA 2HT3C 4NOBA 3X3FL 1A7OH 2C1OB 4OCYH 2NTSP 1XGUB 3S36H 3MV7B 1T66D 3QQ9D 1QSEB 5HI3C 3STLB 1LK2B 1A1OB 3SGJC 3DO7B 1A4KB 5HVWA 3ILPA 3MCKA 1CQYA 2G75A 4EI5A 1KOAA 4U05A 1I9IL 4NZDA 1OT2A 1V3JA 3STLA 2BVUA 1IQDA 2Q8AH 3TWCL 5I66B 1U8MA 1K4DB 4OZ4A 5M7QA 1GJIA 5T1KD 4L8CB 3EYSH 5D93B 4C83B 3L5JA 1QLFA 1RFDL 2FJHB 1OAQL 5A2IH 1PSKL 3LEYH 4NN6C 2CQVA 1BBJA 1CI5A 4NKMB 4A6YB 2CIIB 4LLUB 3BW9B 1A64A 4G6JH 3RNKB 4HD9A 4WI3A 2DBJA 3W82A 4Y4FD 4LOUC 5D71H 1C5BH 4KK9C 1BZ9A 2IG2L 1K9TA 2VABB 3ARBC 5D6DC 3MROB 5FKAA 4G5ZL 3ZE1E 5J6HB 2CKNA 4R7NA 3NCBB 2Y06L 1ZV5A 4N1HB 1G7HB 4LDLB 3ULUE 1UCBH 2XNAB 5MENA 5CBEA 3SDCD 3GKWH 1QBBA 1YECH 2Z91B 1HDMB 5IHZA 5HD8C 1T7ZA 3EO1B 1NLBL 4WHTA 2IFFH 4HKXA 3C5SA 2W0FA 1MCPH 3OJVC 3HR6A 5C0CE 1S9VB 1A6TA 3H0TB 4CVXA 2XNAA 3QB7C 2I9TB 3G9AB 1TZIB 4UDUB 1YMMA 3GSNL 2OL3A 3ZE2E 4IM8A 3CXDL 5BRZB 5IESH 2FATH 3X3GL 3ZTJG 1A3LH 4OCLC 4EN3B 1Q1JL 3QDGA 3E8UH 4L8DA 2EKSB 1K5NA 3SGDI 4X5XB 1FV1A 5AEAA 1CLYL 1MNUH 2NW3B 5INCB 4QOKA 3IKCA 4WUUE 4G7YH 2W1NA 3FFCE 1MJJA 3MYJA 4XXDA 3U1SL 1KIRB 2G9HA 2PO6A 5C0BE 3FCTA 4JJ5B 1HEZA 3KXFE 2RGSA 2VXUH 4R26L 1I9JL 4J8RB 2IALB 3X11B 4CMHC 3F5WB 3MO1A 2VIRB 3HI5H 1H3TA 2G5BA 1K4DA 4OZ4B 3DNKA 4NRYB 1ZEAL 4JFFE 1T1XB 2JELL 4JZNA 1ZGLB 4Y19D 1JZ7A 2ID5A 2PW2B 1IGFL 3N9GL 4JZJC 2VITB 5HPMA 3HZYA 2ZSVA 1FO0B 4G5ZH 1MQ8A 5CP3H 4LLQB 4EJ1C 4H88H 5E08H 4MJ5B 3U4AA 4JRYA 3GUTB 4Z7NF 1S7RB 2MKLC 5J8OA 5GGVL 4XCCL 4WWKB 2GTZB 4X6CF 4OD2A 1V7NL 4TUKL 4UT7L 5EU3B 2A38A 4G9FA 3G08B 4HWNA 2CLZB 1JN6B 1C1EH 5EB9A 1EV2E 3BEWB 1KNOA 1VACB 5C0EB 1OWWA 3LPWA 4DN3H 5E2JA 5CEXA 2H32B 4JRYE 2ITCA 1BJ1J 5KW9H 3FT2B 5MERB 2WBWB 5T33H 2VLKE 2QL1A 3U2SA 2ADJB 1F6AA 3QPQC 5ID0A 4U6XB 4GAFB 4XZUA 1MWAB 4JDTH 4PV9A 1GGIH 3FQTA 4BELD 5GZND 1KJVA 4OF0A 1QFWL 1NBVH 2OQJB 5JIHA 4JQVC 2HTKC 3QDJA 4F80A 4JHBA 4PJIE 4JZJA 1Q38A 4PJEF 5JXED 3C6LC 1JYVA 3EGSB 4BQ8A 1FYTE 1JGDA 1T0MB 2ITCB 3PIQB 4JLRB 4ERSL 5J11B 1KELH 4EI6B 3GRWL 3MBEC 5I75B 1A7OL 4OB5H 2YA1A 2X42A 1PY4A 4UT6L 2BDNH 4GUPB 2OLDA 3VFGL 3P9LA 4OD1L 2XTJD 3I9GL 3THMH 1MAJA 2FZ3A 4F7CA 5T3XE 4JFQB 1OD9A 5F71A 3IAGC 2Z31B 2BNQD 4RNRA 3TO4C 4NHUE 3BKYH 2FEDC 5DVLA 4WGWB 1OD7A 1NANH 3B9VA 2X89D 4X80H 2KQMA 1DL7H 2E7LE 4B50A 1XR8B 3FQRA 2JJSA 2XV6B 4LCWE 4U4BA 4U1KB 4MMZC 1MCWM 6CGTA 4XP6L 3ULUD 5MENE 5KVEL 3FQXB 1MCCA 3KLHC 5HY9A 5JW5A 2ESVD 1LO2L 4P3DA 4QYOB 1CE1L 3M1BB 1TVBA 3GBLA 3LOWA 4ODWA 4O4YH 5I73C 5JW3L 2W59A 5TPWH 4X7SL 5E9DD 32C2B 3VFMB 1KGCD 4TNVF 1E4XI 3S7GA 1EHAA 1KPRA 2HFTA 4XI5D 2NYYD 3GBML 1J1OH 3QPXH 1L8JA 3QIBA 1FGNH 4PRPB 1MHCB 4FQHB 4P5MA 4DGYH 1M71B 2D03H 5EUOF 3O8XD 1WGOA 3ZKQD 3MV9A 5I18H 3V6OE 2APWA 2WUBL 5C0IB 1HSAA 3PJSB 2JJTA 2I9TA 5IB4B 3GRWH 4AM0A 2IADB 4LSRH 1RU9H 2W0FB 5CAYB 4X9BA 3GB7A 1A9EB 4X6DB 2GITB 4RGNB 4OGXL 3VGAB 2BFVL 3FQUB 1J0IA 1L7TL 3IDUA 5EZJB 4K7PL 1G7MB 2X89A 2XFXB 4NO5A 5D7JD 3D5OF 5DQDH 3WUWB 2FX8L 3K74B 3NIDE 4ZUVB 3BQUA 3B5HA 4MGXA 4WTWA 2P24B 1DP0A 3KVQA 3IDGB 2F58H 3FB8A 3HC4L 4JY4B 1MNUL 4KH2A 4Q9CA 3SDXF 5FOBB 5DMGC 4OGAC 3DXAD 1SJVA 3QEGH 3QUZA 1DQLH 2WAHA 1GAFH 1PZ5B 3Q1SL 5DJXB 3BN3B 2LE9A 3H9SA 3PABB 4K9EL 1QFPA 5CP3A 4A6YA 5F44A 1OTSD 4RAVB 5EC2A 1HN1A 4ZXBA 1FGVL 1LO0H 1SMOA 4PP2A 1RUPL 2FL5B 2BSED 3IAPA 1JTTA 4U1SA 4UNVA 4KUCF 5ADOL 2J3SA 4JPVH 2MQCA 1RZJC 4Z95L 3Q0HA 4TNWF 3RWDA 5T1MA 4GG6A 1IC5H 3IGAB 3DSNA 3JV4B 5CSZB 5IB1B 3MXWH 5SWSE 1QNZL 4WIQA 4JDVB 5EZLB 3NA4A 4P23D 5BJTA 5GRVL 2HMIC 1IAKB 2DLEA 2DQFB 4N0UA 4Z7VF 3VDBA 2HFFA 4Y2DA 2HT4C 1MIMH 3PNWB 4LKXA 4XAKE 5JOFB 2YRPA 4MLSA 4PJFE 3MLTB 3K8MA 1FDLH 4WW2F 5EOTA 2YPVH 5E1AB 2VZSA 4GS7C 3PWPA 2VZOA 1BHGA 4HUXB 4JANB 1FNGB 3U46A 4QXTB 4KY1L 1ZT4B 3WUWG 1EGJA 1AQKH 4Y4KA 5FAAA 1V8HA 5IVZA 5BXFB 4TVPH 3GHEL 5DRNB 3C8DA 4UU9A 1SMAA 1AE6L 2EE9A 3DGCR 1ZA6A 3IETB 3VRIA 1VEMA 2GJ6E 1P53A 1JWSA 1U6AH 4KHTH 1Z5LB 2DS4A 4OZGA 5JLZA 4JPIA 4EDXA 4WUKL 3V6ZA 5SWSD 2BSRB 4OLWL 1ACYH 2DQHL 3BE1H 4PTTB 5EU5B 3V4PH 4F7TA 2WLZA 1VA9A 5C0GB 4PGJA 5K9KB 2VDOH 35C8H 3PF2A 5FYJU 3TN0B 2EDHA 4IDJL 1BOGB 4M43H 2DQTL 2PYEA 4K55A 1NEZG 5IJKC 5BMFH 3LKOB 5T3XH 1UB6A 3IKKA 3FFCB 4OCNC 1FYTD 3OKDB 1MY7A 3V2AR 4IRSC 3B5TA 1HXMB 2GQHA 5FYJL 3W9DA 3BI9X 4PP2B 4U1GB 3P2TA 1CD1B 1VEPA 2QHRH 3HHRB 2R1WA 1MIEH 3HMWH 2DAVA 3QG7H 2IQAB 4JB9H 2EE6A 2CJUH 4PJ8D 1PG7H 3REVA 5DUPL 5CZVH 3I6GB 1IAOA 3O4LB 1KIQB 3R0NA 2QQLH 1CD1A 1HQ4A 4ZYKB 5HPOA 1MFCH 5IUSA 4TQEH 3QI9D 4XP6H 1U8LB 2NTFB 2WIMA 1I8MA 1MLBB 4KZDH 3QHFL 1MSPA 5DT1L 1G7QA 4QRUB 2BXYA 3ZDYF 4RFOH 5HDBF 4Z7OF 5IG7B 7FABL 4FQCH 3RKPA 2UZIL 4PRIB 5D7KD 1NL0H 1TLKA 2XZQH 2VLRB 2O5YL 4EXPX 1FZMA 5IGXH 1HSAB 2B1AH 4Q9BA 4LSDA 4LLVA 2AEQL 1SY6H 1YEFH 2IAMA 5JR1L 2X4PB 3MLSH 5C0NC 1BJ8A 1KIUA 4TTDD 3T8XB 4XNZB 2Y23A 4PJXF 3SBWC 2F5AL 2FX9L 5KS9A 5A3ID 1NFKA 4M62H 2OTPA 1OAZL 2V9RA 3M8OL 4U3CA 3WIHA 4CDHA 4L1DA 5HGAA 4Y7MA 4PG2A 1U8KA 5GHWH 2OR9L 1E6JH 3DBXB 5B22A 1E4KC 1JFQH 4JFDA 1GGBL 5EOTB 2ICWJ 5INDB 1N5YH 1XGRA 1OAKH 1S9KC 3S4SA 4EN3C 3G9VA 1OP9A 2L4OA 1N7ML 4KROB 1S9WA 3HUJF 2HFFB 3IDGA 3QFDB 1BFVL 3AS1A 4XPGL 3GHEH 3W9EB 1D6EB 4NWTL 1WWBX 2ZCLH 4QO1A 2Q3AA 5GGUB 1YMHB 1R3LB 1T2XA 3G5YA 4GS7B 2JK5B 1FSKC 4LQFH 3RWGA 2XYCA 1LP9A 1BREA 1OAXL 1PSKH 3RNQA 3WS6C 3O4OB 1UWXK 1GGCH 1M7DA 5CMAA 1OM3H 1NCNA 5DSCB 2FB4L 3F62A 2F9BT 3C08L 2E6QA 3D0VA 1OQOA 2DWDA 1IVLA 5CFHA 1C5BL 3B9KB 5E8DL 4X7DC 3RUGA 4PRPA 1YYML 4Q0XH 1YEKL 4S0SD 1QBLL 3EYQD 1JHTA 2YK1H 5IB5A 4HPOL 3LKPA 5C08D 5IFHH 4UQ2B 4TN9A 4GRWH 4XVTL 3MRDA 4Y8AA 2AV1B 1T89A 2QHRL 4XVJH 3DMMB 1EGJH 3BZ4A 4QYOA 4P23C 3AU1B 3P0GB 3NFPA 5GRVK 3UAJC 3P0VL 2P5ED 3ZKXC 2XFXA 4NO5B 3VXSE 5BVJA 2JB6A 4BSWA 5LKNA 5TE6H 1IGTB 1B0WA 5GSVA 2BRRL 4HPYH 3FFCA 5KSAA 4FP8H 2XKUA 2XTLA 3UBXI 1G84A 4P46C 5T1LA 2FD6H 3O2WH 5C6TL 3PWUA 1BF8A 1LE9B 5C0RH 4C56D 4XPAH 5ALCL 4MB5A 3GBNL 1JHKH 3TYGL 3CU7A 3LS5L 5DRWB 2BSRA 2VXUL 3TN0C 5JLZB 1WEJH 3SCMD 3AFLA 5E4IA 1LP9E 1OAXH 3NCFB 1XCQB 5LXGL 4JFDB 5INDA 1XGPA 3ARGB 4PBXA 3HRPA 4FFEX 4ETQB 2X4QB 3RL2A 4Z7QE 5L8KB 4X5WA 4NHCH 1LWRA 5FO9A 3MUZ1 3DJ9A 4YJZL 1Y18B 4XCEA 5FO7B 4Z18A 3SPVA 1HXYA 1BAFH 4EIGB 1MCPL 1SEBB 5J1AA 4KRNA 3RP1A 2P5EE 4GOSA 2HWZL 3EO0B 3V95A 2R2EA 3MLTA 3KXFD 2XWJB 2J5LB 4RZCB 1QRNB 4TRPH 2P5EA 3T77A 4NNPL 3CGTA 3QEQD 5GXBB 5EORL 3DSFH 1IQWH 1NGPH 2ATPB 3LKPB 4C54A 4BFBD 1INEH 1NUGA 2P7TA 3CDYA 2M2DA 4MA3B 1PQZB 3KPMB 3O2DH 5DJ2B 1JWUA 5ERWA 5LGJB 5IFJB 1AJ7L 3S6CA 3I2CH 3AS0A 4Y5YC 1EHLH 2C4XA 4OAWA 1INDL 4NDMA 3G08A 1TDQA 1JWUB 5DJAA 4KVCH 1V7MH 1WT5C 1NBZA 3B9EA 1CG9A 1OB1B 2AABH 1HHJA 4NP4H 3H0TA 3GJEA 4CVXB 3HR5B 1FC2D 5EOCJ 4PJFB 4DGIL 5KBNC 4MQ7A 4OF6A 4V1DB 3TIDB 2MKWA 2J4WH 2H2PC 5AG8A 2F19L 5T1DL 4D9QE 1JNJA 2NLJB 4P9MH 4G7VL 3QULA 3JUZA 3HE6A 5CSGA 3RY4A 1JTPA 2EZ0D 1T7VA 3SO3B 4RMUA 4HUVB 4OFVA 2ADFL 1J05B 3G5ZB 3KPSD 4O51B 3W9DB 4ZUUB 1DDHA 5DMYA 3MUHL 1MAMH 2IH1B 4M62L 3ARGC 3O4LD 1QNZH 1ZGLA 3QFJD 4PJ5E 1UA6H 3QHZL 4Z7UB 4NFDA 1UJ3C 3K81A 4CVZA 2GJ6B 2YZ1A 1L7TH 2WW8A 2CDGB 1KENL 4ETQA 2PETA 1VHPA 2VIRA 4YR6A 3T04D 3KJ4B 1CDHA 5HGAB 5BVPH 4PY8J 4B7LA 5C09E 3HC4H 1AHWB 4X4XB 3B9DA 1A9BB 5ESAA 3OB0K 3V6ZB 1P9MA 1QLFB 1AI1L 1Z5LA 4GRLB 4C83A 4HIEA 4KZEH 1F4WL 4N90D 3MQIA 1U8MB 3PWUB 1KT2A 1AGBA 1CDUA 5ALCH 1LHZA 1YMMB 1P7KA 2APBA 32C2A 5ESAB 5D9SA 3MNZA 4PJ7B 4PRAA 4Z7WE 5EO1A 4PRIE 3IDIA 4QHUA 4YR6B 1H3PL 2A74A 1G7QB 3ZTNH 4K8RL 4AEEA 5HGBB 4MCZB 1NKRA 1ADQH 4GAGL 5JOFA 2Y1VA 1MCJA 2NY2D 3G04A 1NJ9B 1G7HA 4TSAH 3MLRH 1YN7B 3B9KC 2ZUTA 2IF7A 4UQ2A 3WEXA 3C8KA 1OWRM 3JWNC 5D96B 4X5XA 4YBLC 4UUJB 4TUOB 3VFRA 1VADB 3P9MB 4L8DB 1YN6B 4JHAH 4KKAC 2W9LA 1HHHB 1REIA 3EJZC 4MD0B 4WEBH 1W0VB 4OFPA 1OB1A 2DIJA 5HSFA 5L2KD 4OZFH 1FFOA 3DV4B 3EJZD 4NKIH 3IF1A 4GUPA 5D93C 4EUPB 1Q8MA 4OCRH 1W72H 3MREA 5KS9E 5L0QB 2X5PA 1BJMA 5EOQL 1N6UA 3M17A 4FQ2L 1UEMA 3V9FA 1V7ML 4UINH 3U7WL 1LK3H 1WK0A 2P24A 2DN7A 2WQRA 1ZVYA 1HSBB 3ULUC 4XCNB 1E4JA 5FM5O 5JQHC 3HE6B 2F74A 1Q9KB 4ISVB 3SDAD 1WZLA 5FO7A 3QEHA 1EXUA 4PB0L 4X99B 5FO8A 5D1XA 3MA9L 3MUJA 1DN0B 4XNZC 1FO0L 1KULA 1VEOA 1KXVC 1H3GA 4FG6D 2BC4A 2VUOA 4QRQA 4HG4K 5EN2B 1BAFL 4L8SC 2O61A 3NA9L 4FQHA 4JB9L 4MNHB 2VISB 3UTTA 3L1OL 3P11L 2UWEE 2EIZB 2BFVH 4LDOB 3KPMA 3BYYA 1EEYB 2FR4A 1ACZA 4QXUL 4XP1L 3SE8L 2XZAH 5JIIA 1MH5B 1MRDL 1UENA 4LNVA 2NXYD 1RUAH 5GGVY 5I1JH 1CGYA 1UB5B 1QA9A 4PGBA 4YXHH 4MSWB 3HAEA 3AMLA 3LY6A 3BMWA 4U2YA 5DD3H 2PW2A 4ZAKC 3PWJB 3PV6A 3DYMA 1D5BA 1CT8B 3LMJL 4XPBL 5F3HB 1YNLH 2JTDA 5GRYA 5ENWB 4CJ0A 1X6LA 3IDNA 4JM4H 1HZHH 1BGXL 3K4AA 5BRZD 3O45A 1T83C 1X9QA 3CFCH 1CLZH 4WTZG 4UIKH 4KRPC 5DRXB 3N9GH 1PJ9A 3RPIA 1JGUL 4FTVD 4OLZH 3VG0H 3IFLH 4HWUA 4JDZA 3GMMB 1CTOA 3O41B 4X7FC 4XAKD 5BZDB 5EUOA 5IMKB 4MAYC 3U9PH 4NC1E 4RWYH 5BW7A 1TJGH 3DVNB 3QI9A 1CGUA 1G7MA 4PG2C 3BPNB 3HG1A 3W2DL 1K8DA 3GB7B 4NHUA 2YZ8A 1YUHA 1MAKA 1QG3A 3EYFB 4OKDA 1DANT 4I4WA 4CMMB 1IZKA 4CW1B 5DJYA 5AUMB 4XT1C 5JXEA 4XP1H 2J8UF 5SX4I 1WLHA 3HI1A 2O26U 3G6AA 5EOQH 2BY0A 5FM5M 3HPLB 1I9JH 4PJ8C 5CBEB 4KKLD 3DMMC 3MRGB 1CFSB 1FYTA 2DQIL 5E8EA 2L0DA 3QIWC 5FOJA 4RFNB 3OKLB 4RAHA 1HWHB 3FKUS 2Z8SA 3KLDA 5J4MA 4OJFH 4Y4KB 4JGUA 4XHQA 3N50A 1ZT4A 2YXMA 4PJ5D 2Z35A 4K71C 2QJDA 4WW2A 3KYAA 4ODVL 1KCUL 3QUMB 1J9CT 3DBXA 4DUXA 4KQ4H 3OKKA 5C0EA 2GCYA 2EDYA 1JN6A 1HIMH 4I5BB 5IW6A 2P45B 1R24B 3JV5A 1RK1A 4NQTA 2Y36L 5EU4B 3F7RA 5GRWA 4M8QA 1NBYA 1LEKB 1M1SA 3VGDA 5B3NA 4Z7UE 2Z8WC 3HI6H 3L3GB 3QJFA 3N0PB 2ZUWA 3QUKB 4KHXH 3QHTC 2CUIA 1QSZA 1NBYB 5F7UA 5C9JB 1OAZH 3RTQD 1N0LA 3QFDA 1NAMB 4U1IB 4KROC 2XTJE 1QPXA 4ZUWB 2FZ3B 1DBJH 2EIBA 1AC6A 1DLHA 5HHVH 1WBYB 4ONFH 3T3PE 3MV7A 5MHSE 5C08A 1ORSB 5IHLB 1OARL 4N68A 1MLCA 4X9HA 3SKMB 3MJ9L 4NQVA 4YWGH 1CD8A 3TBWB 1U8KB 3VXUD 1Q9WB 3ARYA 2IBZX 4Y4FC 4FQ2H 1AHWC 4FQXC 4RIRA 3UDWA 4EEEA 5I2IA 5GIRB 2ZKHH 1XF5B 4RFOL 5L7XL 1S5IH 5ADPH 4LIQE 3REVB 5B38B 4OSUH 5JIKA 4GLRH 3HI1B 1A14L 3N85H 3CDFA 4LP4A 2GK0A 4NO0B 4R96A 3ZLQC 2XOTA 1FLRL 1OAYH 5CMAB 4JO2L 5E6IA 3H7BB 2BXZA 3B83A 4PRHB 1S9VA 3ZL4L 3OKDA 2IADA 4IEFB 4CKVX 1A6WH 3FHQA 5EG6C 4AY0A 2PNDA 3IS1X 4J1UB 5TE7H 3STZA 4APQA 2ADFH 3DI3B 1CXFA 1XIWC 4Z0BL 3P30H 4QRUA 1ETZB 1H8NA 3MV9B 4P2QA 2WUBH 1LNUA 1M71A 1MY5A 1AGDA 5I1EH 4QRRB 4QNPE 4XC1H 3BDYH 3CX5K 4OM0L 4PJ7E 3F7YA 5JXAH 3HC0A 3O3AB 1BWWA 3QIWA 4R7NB 2A6IB 4P2QD 2FIKB 3SE8H 2DQUL 4J4PA 5DMKB 2CSPA 1CF8L 2COQA 3BP7A 3JSSA 3LH2L 4P4KD 4KMTH 1A7RL 4NKDB 4UU9B 1GPOH 1M6OB 5IHUL 4YXHL 4PJCE 5ENWA 5BXFA 5JPMB 3KXFA 2NY1C 1UYWH 4PP1C 1HKFA 3QDJD 4JCMA 4BSVA 3UC0H 4OV6F 3BZDA 1KIPA 5IVNA 4HS8L 2BSTB 4Z7NE 2FD6L 5C6TH 1YEJH 5CJQH 1PG7X 4FQIH 4V2CB 3O8XC 3N06B 4R8WH 2VLKD 4BSVB 5K9KA 3O81A 1IAKA 1AFVL 5EH1A 3IFNL 4FMKA 3MYJB 5DJ0A 2UUDH 5DVKA 3U48A 3QHZH 4JFYB 5CCKH 4AK1A 2BHUA 1XGUA 3IJYA 1AKJD 3QYCA 2R4SH 1YQVH 1FL5A 2EC8A 5H2BA 1KTDA 1JGDB 3P30L 4GRMA 3HPJB 4WV1B 1FFPB 4P4RB 5IVZB 3ULUF 3O9WA 3P4MB 4KJQD 1H5BB 4P59L 5HYJD 4S1DD 2B8OT 5F93C 3RTQC 2AGJH 2F54D 4XP9H 1QZ1A 3QQ3A 5GGRY 2IQAA 5IWLA 1ORQA 4LAJH 3PDDA 4Y5YB 2F53D 1LD9A 2M1KA 1HDMA 2LVCA 1WAAA 1ZLUH 5CSBA 2UYLB 1FG9C 4HLJA 3QEUA 2IBGA 4LSVL 5DFVD 1U8HA 1OAUL 1TJHH 2F53A 4K9EH 1L7IH 1ADQA 4DN4L 1D9KC 3FO0H 1GC1C 3NZ8B 3L3DA 3WNOA 3D85D 4FQ1L 4LSQL 4M5ZH 1IFHH 4CVUA 5DFWH 1RSFA 4OUUB 1I8LC 2GITA 4ONOA 4GG6B 1SM3L 3BMVA 1GHFL 1S9XA 1XZ0B 1H5BA 1KJ2B 5F72S 1JK8A 5SX5K 2X2YA 4RBPK 4ZOCA 3F65A 3DV4A 2CGRH 4YE4L 3NTCH 2VDOL 3WSQL 4D0BB 5J13B 1XF4A 3BD5A 4W4OA 1D5IL 3T0BA 1RULL 4PV8A 4LLQA 3FO2A 4IOFD 2Y4SA 3QUZB 4L4TD 4EQ3A 3EFDL 2DQCH 1MHEA 3D69A 5GRJH 3MCKB 4JY4A 1FNGA 1YY8B 3C60C 4DAGL 1FVCA 2WANA 1KJ3L 2R4RH 3BWUC 4G9FD 1RUKH 4H25B 1GRWA 2DI7A 2PXYB 3MV8D 3C5ZD 1AD0A 1MRDH 4KKCD 4HGWA 4QWWC 3TO4B 3S5LB 2A74B 3QXWA 1NAMH 4KKBD 3ULSA 1VB9A 4K3EL 3DYPA 1NFIB 2W9DH 1KCRL 4YC2B 5BJTB 4Z78A 3FMGL 4Y2OA 4XMPH 2HKHL 5HYQA 3QCTH 2WBJD 2P5WB 2E7LC 2QSQA 4DZ8A 4JQXC 2Z35B 4HGKC 4KUCD 4QXWA 4GRLA 2R2BA 4WJ5B 1A14H 3N85L 4Q2ZB 4G7VH 2DDQL 5HXMA 4XBPB 4FFVD 3BAEH 1P5VA 5T3ZE 5F7YC 4YHYB 1AC0A 5T3ZL 1IGCH 1RZFH 1VGEL 4UIKL 4K23H 4G6ML 2XXCB 5F7EL 5ESQB 4DVBA 2X4SB 4QRRD 4XPHL 2VDNL 3EO1A 4WHTB 1LE5B 1TQCC 1DLFL 2KBGA 4MWFB 4G8GA 4X6DF 3U7YH 2Z91A 5K9JH 1A1NA 1WFUA 3I9GH 1QHOA 5TDPB 2DOCA 5ETUB 2AW2A 4JM2C 3DTXA 3QDHA 1YEEH 1Q72H 1I8KB 5BVPL 1IAIH 3G6JA 1I7UA 5HGDA 4D94A 5I1CL 1DUZA 4C56A 5I19L 4LBEA 3RGVD 1SYVA 1CFTA 3E6FA 3O6FA 2BZDA 4WWKC 4OCXL 4ODTH 5C86A 5L8JB 5LBSL 1BP3B 2SEBA 2KH2B 4ZFOL 1NBZB 5SX4H 1CN4A 3VD5A 2A2QT 2FJHA 3CUPA 4K3GA 2UZIH 3PGCB 1EBPA 4OIAA 4HLZH 5DO2C 5DEFB 3WIIH 4LPTA 5C6WH 5IK3B 3MOQA 5JHDA 5ITBH 4QRTA 2B5IB 5JR1H 5JOPD 5JHLH 4UV7H 3HNSH 1HK6A 1PY9A 2RCSL 3VGAC 5MEOA 3SKJL 3FB5B 3L95B 3Q5OA 3G5VA 4I48B 3WD5H 3PG2A 3TO2B 3FN0L 3TPKA 3LDBB 1JZ8A 4LPYA 5D5MA 4BH7B 4KK6C 5KVDH 1I4FB 1DQMH 1GGBH 1N5YL 1CD0A 4U6TA 2P8LA 4AL8L 3HB3C 2BVQA 1SYSB 5ISZA 4P5TA 2WQ8A 2X41A 1QTYT 5EN2A 3DOSA 3QUMA 3GDBA 3BN9C 4N8VA 5E6IC 4R97C 2Q7NA 2HLFC 1C08B 3C9NA 4M1CD 3VWJA 5ISZB 3ES6B 3OKLA 1X7QB 1XF3B 2HT3D 3EDEA 1I3RA 4NYLB 3RBSA 2P49B 1DFBL 4NCC1 5B39B 5HGDB 4LVEA 1L9MA 3MV9E 1B9ZA 4NJ9L 3FO0L 4KV5F 4QRRE 5HHNA 3E3QC 3BDXA 2R69L 1T0MA 2DQGL 3JTTA 4PS4L 4UDUA 5TDPA 3HZYB 4QRPD 1A6TB 3CFJB 5I1HL 3QWOB 4JZJB 4GRLD 2JELH 4J12A 1GOGA 1NCBH 3M17B 3P0YH 5IM7A 4N9GA 4F57H 1OGTB 2DIBA 4X98B 3U4EA 3WSQH 2CLRB 1NCWH 1KB5A 4ORGA 4XNXH 2PYED 3D39B 2BP3A 4FQJH 3HNTH 4CN6A 5CD5D 2IALA 3X11A 3IDJB 4ZPTA 5A2FA 3AY4A 1KCKA 4JKLA 1FNSL 4HDIB 4JJ5A 1CL7H 3HE7A 4LIQL 4XBGB 5GQBA 3VFRB 3VXRE 4AZ8A 3GSRA 2MHAA 3O45B 4LFHD 1MOEA 2AJSL 3RNKA 5C0JB 2CIIA 4LLUA 2YC1B 2E3VA 1RUKL 4Z78B 2CLZA 2AJVH 2DWDB 2BVQB 2D3VA 4K9EC 2BVOB 2YPLB 5KG9B 5DVNA 2QTEA 3WIFB 1B0RB 4F7PB 1I4FA 4HS3A 5DDHA 5F21B 1YZZA 5CIPH 4PGEA 4APQD 4P2QE 1N3NB 4JFZL 2JJUA 5GGSB 3DIFA 5IP4A 4G6JL 4LAQL 5DEGB 1KCSL 3GFUA 3IDIB 3SDDD 2IGFL 4IIQA 1VGKA 5BQ7A 3RPKA 1TZGL 2BJMH 1NMCC 3I6LE 4D8PB 2D9CA 5D96C 3LVEA 5I8EB 2R2BB 1PFCA 4JHWL 4Y5VB 1BQHG 5SWQB 2B20A 4D0BA 4XBEH 4Y19E 1G0XA 3HMXH 3FTGB 4WFHE 1NCDL 1O5DT 3PGDA 1T7WA 2CUHA 5HGHA 1EAPB 3SDXA 3KS0J 3C6SB 5E2VL 2DI8A 3IYLW 1HEZB 3VXQA 3B6SB 4BA8A 3MV8B 4WEMB 5BW7C 4Q7DA 4IOIB 4E41E 1EDQA 2ZUSA 3KPOB 3PGDB 4AYFA 5HGHB 3TF7A 4NNPH 2I5YL 1VENA 5TF1H 4HZLA 4H8WH 3G6JB 2CDGA 1Q72L 2EDNA 5D2LB 4OQTH 4PR5B 4CVZB 4FZ8L 8CGTA 3ZMRA 1F8TL 4LCCA 5DUPH 2F54B 1RZIB 3MOAH 1I1YA 4PGDA 5IB2A 4OCSH 3GI8L 5JMOC 3ELAT 2EDXA 1YY8A 2BNQE 3V6FB 5K59E 1DDHB 3BH8B 1BVKA 3F7QA 4JFXA 4P4KB 2H6PA 3L3HB 4OZHF 5IBLC 3K8LA 1OAQH 1CGSL 4CMHB 1TCRB 4Q9QL 2OK0L 1XCTA 3EOTH 3QNYB 2GSIB 3WKML 1E4KA 1A6PA 4XMKH 3IS0X 4I18C 4O9HL 2DQGH 4HC1A 1AO7B 3EW3B 4HS3B 5DDHB 1IKFL 5DK0A 1B0RA 3RDTD 5F7NC 3WMSA 3ARED 2YPLA 5C0ND 4PJDA 4U7MA 4WJ5A 1HQ4B 1LO3L 3ARBD 5E56A 4ZYKA 1RIVL 2NW2A 2EDWA 4J3WA 1FL3B 1LDPL 3OXSA 4YQXH 1BZ9B 2JLLA 2VABA 3SQBA 1S5HA 4UUJA 5D2NB 3LSOB 2IBBA 1RPQA 4HWEL 4MA3A 4HKBB 1A6UH 1MPAH 3I3EA 5EZIH 2OJEB 2VDRH 5DZLA 3AUVA 4FQJL 2X09A 3MXVH 3Q5TA 3RX5A 1JPTH 2F53B 4GBXB 5ILTH 4LCIL 1NJ9A 1NUNB 4U2ZA 4C57C 4W68A 3RGVB 3O6LL 2P5EB 1I7RB 1DEDA 2VYRE 2BSTA 1QRNE 2I25N 1IGJA 4UAOC 4CNIB 3UO1H 3HMWL 4TSCH 2IFGA 4ONFL 1FN4A 3QUXB 3S35X 4GMSH 3MNZB 1BFTA 4HKZA 4OBSA 1CDGA 3SDAA 3WE6A 3UPCA 3BRFA 3ARZA 5KZCD 3UTSD 1LK2A 3DROA 1L7IL 5E5MB 1FNEA 1FBIL 3GI8H 4KHTL 1WZMA 1XF4B 4FQ1H 1XH3B 4M5ZL 5CKAA 1NC4B 3QA3A 3UTPD 1CR9H 5I1LA 3RU8L 4MLIA 4Q9QH 1LGVA 3LHPH 1QBMH 5A16B 4HK3N 3VGHA 3MJ7B 1I1AC 3MNWB 3HE7C 3ZYIA 1NAKH 2ZNXA 4MDIB 3Q6FB 5J12C 3WCYA 3CVHA 1FAKT 3AY4C 5E8DH 2OL3H 1AQKL 4PB0H 4JFEA 3BPNC 4QRPA 5C0AE 1AGFA 1NH6A 5IOPB 1NFDE 1AGCB 1X4YA 2R8SH 3IFNH 3OJDB 4PJ5B 3WNKA 5EC1A 4M5YH 1YPZA 2MOVA 3RHWF 5F7KC 4ZMAT 3PGFL 4JFFB 4UV4H 3TA3A 5SV4A 1Q0YH 5T1KA 3WHE1 2X7LB 1DVFB 3ZDXF 2DLGA 4FXGB 4GAYA 3F6LA 2GHWB 2FH6A 4ODBD 3OXSB 4DN3L 4O2EA 1U3HD 4PJDB 4H26A 5C0AD 3HPJA 4WV1A 4EIZC 1N7MH 3ARUA 5HYSG 1FL5B 3FMGH 4QOKE 2BVPA 2HKHH 4XP9L 1EPFA 4LFHG 4TYUA 4QRRA 3SKNA 3NCJL 3U0PA 3BGMB 1YNTB 4XGZA 1KTRL 1KCVL 2H45A 3Q1SH 5F3BB 2BRQA 4ZSOE 5A43C 3FOMA 3WN5A 5DJ8B 3MRPB 2GI7A 4PGCB 2ATPA 1NBVL 4TNWK 3TPUA 4GW5B 3WJJA 1JPFB 3VRLF 5EDXA 1YPZF 3MBXL 2YPKA 1NGWA 3RDTC 2F5AH 2GK0B 2E9WA 3CDGA 3KAAA 3T4AA 4JKPH 3PE9A 4X6FB 3QPXL 4JVUA 3W11C 5I1DB 2VQ1A 3P73A 3T1FA 5FV2A 3W11D 5E4EB 1YYMH 2ZNWA 4Q0XL 3MR9B 4FFZL 2Q6WA 2MWCA 2ZCHL 4M7LL 1T3FA 3VG0L 1JE6A 3MV8A 1T1ZB 1QBAA 4X5WB 1JL8A 1WVZA 1F4YH 2X4TB 5JMRA 5E0QA 3TH3T 3V5HB 1XGPB 3ARGA 5HDQH 4KRMB 2JCCE 2ZUQC 3QJHA 4NN6B 2HFEB 3ZE0E 1D5MB 3HE6C 4QTIL 4RX4A 2FBOJ 2ZCLL 4U1IA 1J8HE 1G7JA 1KEGL 2QADD 3TT1L 3QXAA 4PB9L 5I9QC 2W9EH 3QH3A 4HPYL 2ZZUT 1QSED 1KN4H 2DQDL 4RA3A 2R0ZH 4YHPB 4F9PA 3DPBA 4CW1A 2C7UB 4UAOB 4MA1B 2APXA 3VFUB 2MNUA 1F42A 3QHFH 4CADB 4RGND 2EIEA 5HY9B 5JW5B 4OLWH 1CE1H 3V4PL 2GW5A 2HG5B 5E6YA 5C9KA 5JW3H 4FZEL 4JPKH 5F89B 1HHIA 2DWEA 3HB3D 2KUTA 5C0JA 5I1HH 2CRMA 5ESVA 4JPVL 4MXQA 2ZPKH 1OF2A 4EQ2A 3FN0H 2R23B 2YN5A 2H3NA 3P4LA 2HJLB 4D0CB 3IU3A 4LSUH 4FS0A 3TVMC 5CWSB 4BH8A 5FFLA 3TPUB 2NY5C 3DWTA 1CICC 3SO5A 1CK0H 2YD9A 2VO5A 4PGCA 4YK4B 4Y4HB 5A40E 3OWEA 2A73A 3BPOC 4ZS6D 5BS0E 3NIFE 5LCVL 1ZVSA 4KI5D 4M5YL 3MRCB 5AYUL 3BWAA 1A0QH 3RRQA 5D70H 3HLAA 4BQCA 4JN2A 2DTMH 4WHYG 4DAGH 3OKEA 1IAMA 4RISL 3T2NL 5C92A 4O2FA 4N8CL 1T1YA 1RIUH 4CN1A 1JFQL 4OGZA 4G43A 4MVBA 1DBJL 4KY1H 2EC9U 3A6CH 1WBXA 1YDPB 1JHLL 1ZHBB 3VMPA 5I1GH 1DSF