1T0MA

Conformational switch in polymorphic h-2k molecules containing an hsv peptide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
278
structure length
278
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title The structure of H-2K(b) and K(bm8) complexed to a herpes simplex virus determinant: evidence for a conformational switch that governs T cell repertoire selection and viral resistance
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t0mA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1t0mA01
5DC4B 4MMZC 2CDGA 1QRND 3MRBA 1FRGH 1QPPA 4XXCA 4ELKB 3QIUD 4WFGE 2NR6C 5SX5H 5IQ9A 5F72S 2NY2C 4C58B 3HNTL 4NZRL 2YD3A 4JFDA 1EMTL 1KIQB 2X1PA 3P0VH 4G42B 4XP1H 1VFMA 2I5YL 4XZUA 1A2YB 2CDFA 3LH2L 1YNTB 3OJ2C 1MRDL 4NPYB 2Q6WA 3QJFA 2H6PA 3CX2A 5F1IB 4RGNE 1T2QH 1S8DA 3N1MC 4AL8H 1JMXA 2YK1H 3CGTA 3GSOA 5ADPH 2Z8VC 5L8KB 3KJ4B 2HKHL 2MKLC 1T7ZA 5AZ2L 5J0BA 2EDRA 5FA3A 3GUTA 4Q0XH 1RU9H 4F37F 4LNRA 1TFHA 4RZCA 2DKUA 3T2NH 5HHXH 4XNUH 2MOVA 2GJ6D 2DQUH 4JHAH 1Z3GH 2NNAA 2IG2H 1LNUA 1F3JB 4DW2H 3I02B 4PRIB 3RGVD 4KZEH 4XP6L 3K8MA 2CRYA 3U46B 1AKJA 1V8HA 2E6QA 3JVGA 4PRBB 5CWSB 1FGNL 1XEDA 3NAAL 2AQ1A 1X5HA 3MRHA 5B39B 4GH7B 4TNWK 1QFWM 1YYMH 2Z91A 5KVMC 1NCTA 2ZZUT 4QHKI 4D0DA 1N8ZB 2YPKB 4OLWH 5BZWA 3GI8L 1JFQH 3IF1A 1MY5A 5D9SA 3DX7A 3SQBA 2XWTA 5CGYC 3UTSE 5ESQA 1DEEB 5F70A 3GBNL 4ZUVB 3O6LH 1T80A 3MV8E 4PJCF 5IBTL 3LDBB 4OGZA 4C83A 3IVKA 3HUJA 3KWWA 4NJAL 5T5NG 1DN2A 4MDIB 3QB7C 4R9HA 5CCKH 5AWNH 4JZOB 2GKIA 4M03A 1GGCL 2J5LB 2IANA 2ICWI 4DOHB 3HG1E 1EGJH 3L7FA 5DD6A 3O45B 3AS1A 4Q9QH 1P4BL 5GS0C 1MWAB 1WC7B 2Q8AL 3WIHA 5DUPH 1OVZA 3FFCE 5E24E 2B8OT 4CUCA 5HHQB 3WKNA 3ZZ1A 1C7TA 4WW2B 5DD1L 4M6OH 5DI8B 1KN4H 2DLEA 4POYA 5HVHC 4BH7B 5CSBA 3IFPA 4JKPH 4ETQA 3HHRB 5ALBH 5FYJU 4F7PA 5IMLA 2ZCKL 3GSWB 1LEGA 3NFSH 4E0RA 2ENSA 1YPZA 1CDGA 3KPRD 1K9TA 2R2BB 1H3WM 2HFTA 3QXWA 4DGYH 2VWEE 2X1QA 4GRLD 3GNMH 5GRJL 1BFVL 5HTSA 5J1AA 4JM2B 4EVNA 4QO1A 2DL2A 3CPLA 2YKLL 3QUZA 4YDVA 5E5MB 3G6DH 1IBGH 4XMPH 5GS1B 1NMBL 2R8SH 1BJMA 5ERWA 5TE4L 3GMPB 5KSAD 3KPOA 3VGGA 1WFTA 4XMKL 3FB7B 5FYLL 3N85L 2BSSB 2GTWB 4WRLA 1RUQH 1MFCH 4AEHL 2J4WL 2FX7L 1NANI 3A6CL 1WK0A 4UDUB 2R29H 1QQDA 3BP7A 1MJ8L 5EOTB 3MCLL 3UBXG 2Q86A 4JY6B 4QT5B 4LP5A 4YHOH 2A6JA 1U3JA 5FYKL 4Q7DA 3MYZA 5IFJA 3D6GA 3CSGA 3LKRA 1L9MA 1RULH 1G7IA 1MPAH 3K2UL 3UROR 4OLYL 4HX1A 3JSSA 5FOBB 1K2DB 3D2UA 3IDIB 2XY2A 4FS0A 3RIAK 4OLVH 1MHPH 1XFPA 5I8OL 1I1YA 4KY1L 5A16B 5EH1A 1JJUA 2NY1C 3QUXA 4G6MH 1BD2D 4FXGB 1RK0B 2P24B 5C0GB 4L8DB 4TNVK 4XHJC 4X99B 4HWZA 3PV6A 3FOLB 5SWZE 1KPRA 3T1FB 4HCRL 3SJVB 4RCAA 5DD3H 4LARL 5E08L 2YRZA 2B2XL 4N90E 5TGBA 5ESVA 1A7NH 5IUSA 2YUVA 3LS5H 4HS8L 2Y7QA 4J3VA 1KJVA 2XTLA 4JG0H 5D6DA 2A6IB 5D7IA 5EO1A 4JFQB 5KTEL 2X7LB 2PXYD 4JY5H 3OV6A 4MXWH 2AABH 1A7PL 1IILE 3C5JA 3KGRA 4ERSL 2WK2A 2LFGA 4QRRB 4X6DE 1ZTXL 1K4CB 4P2RB 3DMMB 3GFUA 1KN2L 2YUXA 4YHKL 3OKMB 2Y5EA 3SPVA 3WUZA 1OGAD 2BDNL 4YZFF 2FATH 3VXME 3VRLE 2AEIT 4JAMB 4PGDB 5IG7B 1Q94A 3FOMB 5KG9B 3ZE2F 2IADB 2YA1A 3ARBD 3NCEB 4KRMB 5KAQF 3AMKA 3AFLA 3G9VA 4S11A 4L4VE 5IVNA 4YFLF 2XACC 1WWAX 5D1XA 1U95A 4C56A 4FZ8H 4RA3A 4ZFFA 1OY3B 1T2XA 4KK9C 4KROD 1H0DA 2C26A 3TBWA 1RZFL 1O0VA 1WAAA 2C1OB 2LU4A 1OAKH 1FNFA 3RL2B 2R4SH 2HVKA 4WUKL 1U92B 1A64A 1C7SA 2QKIB 1BVKB 5IGXH 1T03L 1GHFH 5HHME 5JLZB 1EJOL 1XIWA 4KJYA 2WM0A 5K9JH 1JP5A 2FJGB 2VITA 5KSVB 5T3ZE 2EYTB 1X5AA 2OI9B 1XR8B 3D9AH 1HXYA 5EZJB 4Z7WF 5IB2A 5I0DA 4QHUB 1DANU 2MTPA 4JJ5B 3VXRE 5KJRL 2P8LB 3MRFB 3ULVH 4R0LB 3QRFM 1OW0A 4A2MA 4JFFE 4WU5B 2R4RL 1NGPL 32C2B 3VA6A 5ICXA 4F57H 4NQDB 1QHOA 2VL5A 3HTLX 1I8LC 4I0PA 4ETYA 3HI5L 1C5DB 3GMMB 3ILPA 1D3CA 4WVRA 3S34H 4F8TA 1I85A 2ZJSH 4WCYL 4L8SB 1F00I 1S9YB 2YWYA 1QSED 2HTLD 3QJHA 3U48A 1CL7I 1HH6B 4N0RA 3W39A 3RI5K 5AG9A 4IRSA 4UI2A 1KXVC 3STBA 3EYOB 5D7JD 2R1WB 1UWGH 4R2GB 3SCMB 1RZ8A 4I0CC 2NPLX 2F19L 4DQOH 4M02A 3OSKA 5DJ8B 4NQED 1NC4D 3V4VH 3EYUL 4KJPC 3SDCC 2W0LA 4OGXH 4QWWC 1F4YL 4WJ5B 4O51B 5CEZE 5IB3B 1J12A 3BP5B 4MQTB 4O2CB 3X14B 2EYSA 1J8KA 1KG0B 2YEZA 5GGRA 4NRYB 4ACPA 4MSWA 1F2QA 3LD8C 4OZFG 4BSWA 5FYJD 1F3DH 1U8PB 1OLZA 3RUGB 2J6EA 5D6CA 3MV9E 5SX4H 3QO0A 4Y16A 2X4PA 3BO8B 1ADQH 1BIIA 3OXSA 3CVHL 2W92A 4TQEH 3W11C 2EH8H 4HUUA 2VTFA 5L2JB 1NAML 1OF2B 4LCWE 4HXAL 3MUHL 4G8GE 1SYVB 5EZLB 2BOBA 1DUYB 3MLWL 1KTRL 1RJCA 2QADB 1NLBH 3GBMH 3DBXA 3FMGH 2R1YA 4U6TA 4R4NC 1KB9J 5D93B 4LVOB 2A0LC 2Y36L 4PBXA 43CAB 3OJDB 2UWEF 1BEYH 4NFBA 5LCVL 4JKWA 4LLVB 4RAVB 4K3EH 4R4BB 5F3BB 4XCFL 2X9YA 5ADOL 1XGRA 3FCTA 1UJ3C 2CRIA 5L0QC 3EFFA 4X6FB 2D31A 3MLYH 4MA7H 4P59L 2ZUSA 1JYVA 2Z92A 4KKBD 4N1CA 2JJTC 4ZO9A 4FQJL 4XHQA 4YPJA 3LHPL 4GAGH 1HIML 2AI0H 3QNZB 5ID1B 2BNUB 1CICA 3OHXB 1G7MB 4PRID 2EE2A 3EYQC 2VKXA 4OTXH 1KNOA 1MJUH 3DARA 3RX8A 2F5AL 1QKZH 1J18A 1Z9SA 2AK4E 2HYMA 5MERB 2X1XR 2AEPH 1A6PA 3UC0H 1T5XA 1A7OL 4P9ML 3JTCA 3QULB 4GKOA 3VJ6B 4XT1C 2CIIA 5CSZB 3H9SB 2XICA 4DN3L 3MUZ1 1WT5C 3MJ8A 4M7JL 4LIQE 1F02I 5C0AB 2FL5A 1SJHB 4M7LL 4TTDC 4Y19A 1T21A 3UPRA 5F21B 4NQVB 5I16A 4U1NA 2X89D 3O11A 3VFVA 5GGRY 3GO1H 2IFFL 6FABH 1IGIH 2ICCA 5T1DH 3LB6D 4M1DL 5IR1B 3CFBB 4X9FA 3B9KA 5EOCJ 4FQ2H 3OKEB 3B5HA 2MNUA 1FSKB 5IW1B 2YXFA 5E2TH 1CDJA 4H1LH 1M7IA 2EE9A 1CIDA 1KIRA 4DN4H 3GIVA 1A7QH 4FQXC 1GGYA 2OL3L 2X2YA 4DKEH 2ZNWA 1CZ8H 4IOIB 3L3JB 3WXVH 5B4MC 3MA7A 3OQ3B 3ROLB 1JZ6A 4I3SH 5I1GH 4JB9L 4XPGH 4PJFA 3ULUF 2VDML 4PPTA 5DJXB 1AO7B 2YMXH 4PJHB 2GJZB 1TIUA 2KQNA 4QOKB 3OX8A 4XTRC 2NY4C 5DJYB 1UC6A 2Y23A 4U1LB 1TZGH 4ISVB 4MNGA 1F6AB 4ESKA 4XVSH 1BZ7A 3VG0L 5ALCL 4JM2D 2QQNL 1E4JA 3K8LA 5E6ZA 1NAMA 3KR3L 5LBSH 3T0VA 4GAYA 4QRQB 2WNGA 3P9MA 4OBRA 4PLJD 3CZFB 4OUUB 5KSUA 3BGAA 3O9WB 3DYMA 1DLHA 5C0ND 5L88H 4P2QA 2H8PB 2H3NA 4JN2A 4AEFA 3ARDB 4G9FA 5C07E 5DMYA 3FQWA 4L9DA 1AGBA 3IU3B 4EIZC 2HWZH 1B0RB 4M5ZL 2VXQL 1SY6A 5ACLA 4CJ0A 3FJTA 4AY0A 4HUWA 5C6TL 5T5FL 4LCUA 2QQKL 1G6RH 5AUMA 3FN0L 2A73B 1WCQA 3ARGB 4MAYB 3VXTA 3IDXL 3WSQH 4XI5C 3EJZD 5DSCB 1C5BL 2ZCLL 4WV1C 3FO2B 4NYLA 3WNOA 8FABA 4KUZL 1G0DA 5K9OB 4APQC 1LP9E 4HG4K 1QSFA 4ZXBB 2Z0BA 1MCDA 1EBAA 4D3CL 1PYWA 1ZHNA 2NY6C 1FZOB 5ICYA 2DTML 4RGNB 5BS0D 1SY6H 1TTGA 4KGJA 3SJVD 3R1GL 4ZUWA 4YBQC 2BXZA 2F58H 2WIMA 5HI5D 4N1HB 1I9RH 1JPFA 4TSCH 2IH1A 1GGIL 1Q9OB 4NM8L 4NJ9H 3L5WB 3QO1A 1F11B 1URLA 4K9EC 5HYSG 1ZEAH 3HE6B 4GKSB 5EBWA 3IFLH 3ABZA 4OLUH 1VACA 2X1WL 4RAUA 2ADJA 3CX5K 5EO9A 1A6ZA 4GMSH 3QWRA 2X4UA 4LLYB 4ODVH 3IETB 4PJEF 1CT8B 5T5NF 1HKFA 3LKPB 3DMMD 4K9EL 4P2RD 5DQJA 1W0YT 4GBXC 5B21A 3SE8L 1QNZL 1OSZA 3ZKXB 5C08A 4LVHC 5M7QA 3MUY1 4Z0XB 1WZLA 2CMRL 3HAEA 4JHWL 3MGAA 3MBEA 4TVPE 1PKOA 4KKAC 1W72B 4KI5C 1F6FB 4Q6IA 4JR9L 4MXQD 1CGTA 3D0VB 2MCG1 3UTSB 2F5BL 3QIBC 4EUPA 5T33H 3F6LA 1HHIB 4I3RL 3MV8B 3V5HB 3IFOB 4J7RA 4Y2OA 5JDJA 1HQ4B 2ITCA 4P5KB 4P46B 2DD8L 2OP4H 3DX6B 4WU7B 3HG1B 5I76B 4BK5A 2AGJH 3MMEB 2EDFA 3DUSA 3WIIH 4KQ4H 4U2ZA 1W0VB 3IAQA 1FC2D 2V7HB 1BOGB 2ICEB 4X80H 1MCCA 5L8LB 4YDKH 3FFCB 2VKWA 1HH9A 3QPQD 3ULSB 3JTSA 3T1WA 3Q0HA 4XVTL 4XC1L 2C3HA 4P3DB 5CBAB 4ELME 5E5UB 35C8L 5JO5A 2FEEL 4IJ3C 1AP2A 1A4KA 1FZMA 2I07A 5TH2B 1RUKL 3MRPA 1AY1H 3QXAB 5H2BB 4QTHA 4NQDD 4DTGH 3VCLB 4EDWH 3HZKA 3UX9B 4I18B 4KMTH 2OZ4H 3MRDB 4LEOA 4HGWB 2RQ8A 1OWWA 1R6VA 2GFBA 4MCYB 3LN5B 3SO3B 3PHQB 4I4WB 1F90L 5DK2A 4U1IB 4R2GD 1YQVH 4C57C 4RGMB 2O61B 1JTOA 1T1WA 4RRPA 5FO7A 3HRZA 5DA4A 3FQXA 2M1KA 1G7QB 5D1ZA 3WFBH 4Z7UE 1QBML 3SKMB 4HKXA 3RVWD 4HWUA 2JJWA 5DT1L 4HZLA 1CR9L 2RB8A 3O3EA 3S4SG 1KEGL 3JWDL 1CGUA 3O3AA 3QG6A 4PB9H 1CFQB 3C8DA 4LCYA 3TM6A 5E2VL 1KCVL 2A83A 4XWOD 1FO0B 1JMZA 4Y4KB 4PGEB 5A1AA 3STLA 1MCRA 2XZCH 4FQLL 3A6OA 1RZKC 4OF3A 1IAKA 3MLSH 3VFMA 4JRYE 1NFIA 2V7NB 3KJ6L 4LSDA 5BVJB 1SHMA 3R8QA 3VFNB 3JV6A 1FYHB 1RI8A 4L1DA 1T0MA 1EEZA 3MNVB 2VMFA 3V52L 2BXYA 1NGZA 3EHBC 4KHXH 1RZKL 4LLDB 4UT7L 1TITA 5J6HA 1JN6A 3VI3E 5C09E 4YHZL 4AZ8A 4OZIA 4JO3H 4FTVA 4GRWH 5MEOB 1T1ZB 4MB3A 3D18A 3T2PA 1JGEA 3BSZH 3LSOA 3OGCA 3QCVH 5IBLC 4OV5B 2PW2A 3VWKA 1IAII 2HVJB 2CUMA 3SY0A 2GSIA 1LMKA 1VADB 1UZ6F 1A6WL 3TPUA 4KTYA 3MLTB 1R0AH 1IAMA 5JA9A 4N1EA 3HZYA 2FB4H 2FIKA 2BP3A 2NTSP 1CF8H 4XBPA 4G3YH 5SV3A 4X6DB 2AJ3B 2EDNA 5BMFL 2DJUA 3PWUB 3QDME 3VFUB 1I7TA 5I30L 2BHZA 4R7NA 3QDJD 5CLTA 4CMHB 3VXMB 1FFPA 1HQRB 4TRPH 4WO4A 2I60H 4DGIH 4ZSOE 1ZSDA 2G2RB 3QQ9D 4U7KA 4OFKA 2HN7A 4X6EB 5CINH 3LKNA 5IMKB 1HILA 5I18L 4YHYC 2H26A 3BUYB 4L4VB 3WNLA 3FRPA 2IPTL 4QRTA 1VKXB 1ZA6B 1HHHA 2D7NA 4ZFOB 4PJXA 1IM9B 1QFUH 3H9HB 1DQDH 3UTPE 3QCTH 5DDHB 5C0AD 1JWUA 3TJEL 3PP4L 3C5ZB 1FCCA 3IJYA 2ADIB 1TNMA 4CU7A 3H7BB 3TBTB 3THML 3HPLB 3QIUA 5EU7C 4EN3D 2EZ0D 1R3IL 2IPUG 2UVFA 4NRXA 2VDQH 3BH8A 5HHMB 2GY5A 1GOHA 1MUJA 4L8BB 2EKSB 3RZCD 2GK0B 4WI7A 4YQXL 3MOQA 4F3FA 3VXOA 1TZHA 1INQA 4ZS7H 3VXRB 2EEDA 2EIZB 5EU3B 1TCRB 2DQEH 2DQJH 2BMKA 4JFFB 1UZ8A 1DQLL 5C6PB 2XQBH 3AB0C 4PJBA 4M8VA 2KZ1B 2Q76B 1JZ2A 5C0DB 4PRAB 1RK1A 4YAQA 2DIJA 3GSVA 2B1HH 1FVDA 3QQ3B 2GCYA 1U8OB 1OP3K 4O4YH 2GJ6A 4DGVL 1JTTA 4WFEE 1JNNH 1CWVA 3W82A 1SYSA 1AO7D 3P4NB 4QOKD 4XP1L 3RGVA 4BYHA 3SDAC 1WITA 2VO5A 5MENE 2XXCB 2VDLH 1N7MH 2PXYC 1ZHBA 2E7CA 3UZEA 5MHSD 3DUHA 4AL8L 4X8JB 5IHBA 1MEXH 2ZUVA 4IHOA 4UT6L 3E2HB 5ADPL 1KCUH 3M8OL 1E6OH 4QXUL 3VGAC 1NGQH 1HKLL 4S0SD 1JRHH 3EDDA 5HYQA 4J3WA 5FHAH 4Q0XL 1KB5A 3T2NL 2HKFH 2ED8A 5HHXL 3O9WD 3UYRH 3CMOH 4XNUL 4EEEA 3HI6H 2HJFA 4NQXA 3CCHB 1AH1A 4JHAL 5FKAA 4J12A 2BC4A 2IG2L 5DHVA 3ARBC 3PIQA 3MV9B 3BZFA 3DV6B 4XP4H 2QTEA 3V7AE 4NZTL 2A6DA 5BOZG 1IQWH 5KN5A 2ENYA 2AJSH 3KHOA 1BGXH 5DR5L 15C8L 3TVMC 4LP4A 4NO5B 5IT2H 2ZUYA 4LCWB 1HSBB 4IIQB 4LRNL 4UBDC 4HGMA 1I3UA 1YYML 4G8GB 1EXUA 2ZPKL 4LAQH 2PR4L 4JDVB 5LG1A 4KROC 3RDTA 4LHUD 4X9BA 4MLIA 1TJHH 5AYUH 1NPUA 1JFQL 4MAYD 4WFGD 1KLGB 3KYNA 1KTDB 5D1QC 5IV2B 4LPXA 2OMNA 2AJYH 2ZUWA 3B2UD 3MFGB 4X5XA 4YBHA 2RCSH 4FFVD 3DURA 4HUVA 5C0EB 3CK0H 3O6LL 4QRPE 4X98B 5L8JB 4ZXBD 1OGTB 2QJDA 2ZSWB 2NY3C 3FONB 4EQ3A 4YHML 4NZJA 3SGKC 4OM1H 4P2OC 1KTKE 4OJFH 4OT1L 5CCKL 1P4IL 4XH2A 5AWNL 4PJAE 4H88L 2PETA 1I7RA 4N8CH 3KPRA 4RGND 5I6XC 3D25A 3BH9A 1U9KA 3W81A 4Q9QL 4GRLA 5DTFB 4DKAA 1GH7A 1HHKB 1ETZB 4JDZB 4KUCD 5DQDH 2OLDA 3MRRA 1IM3B 3MJ6A 5E99H 5JZ7D 4CDHA 4M6OL 3HE6D 1IT9H 2DLFH 3OJVC 5DYOB 5KSAA 1KN4L 1NEZA 4D8PA 1T5WB 5JHLL 1FP5A 2HTLC 5DWUH 1FGVL 1X9QA 2YD4A 1JPSH 4JKPL 4ZUTA 4FQQB 1U2HA 5LQBH 2EYRA 3VFOA 1TPXB 2AK4B 3U0PB 3F8UB 5DJ6B 1RMFH 2VDRH 4PJ9B 3L3DB 4ZUSB 2EDXA 1A9BA 5GIRA 4DGYL 3WEXB 3DX9B 3HLAA 5IF0A 1X4ZA 1PEZA 3L3GA 1P6AB 4FFZH 2IQAB 1HSAB 3TO4C 5B38G 5IW6A 4V1DE 3MXVL 4POZD 1D6EB 1IBGL 4XMPL 1LE9B 2G75A 4HD9A 4JFHD 2OJZL 3MV8D 4CBPA 4U0QB 2B7DT 5DRZB 1L0XA 1BD2A 3S88H 3ES6A 4P46D 5EIIA 1RUQL 2LTQC 2X4RA 3PWNB 3HG1D 1MFAH 5ABDE 4HS6A 4PY7A 3MNWB 2R29L 4R8WL 3V5KB 3ZDXF 1I7ZA 2XFXB 3GSXA 3FFCD 1UB6B 4PJ8B 3VFTB 4XGZB 4P23B 4PRDA 4PREA 4XVJH 5CD5C 3FZUD 1RHFA 3ZL4H 4H20H 1RULL 3VFSB 1MPAL 4YDJB 2D0GA 1V05A 4M7KL 3C5SB 2G5BB 3H3KA 1AR2A 4OLVL 1MHPL 4RMSA 4G6ML 3OXRB 4Z7UF 1RSFA 4EOWL 5JW3H 3FO9A 5JHDA 4DUWA 4L3CA 3QUYB 3H0TB 3G6JF 5C70A 2ESVE 1DBJL 4ENEC 2XQYG 1OGAA 1HI6A 2FSEB 2BSRA 1UA6L 4XNMB 3RWJB 4Y8DC 3KPQB 4DJMA 1WGOA 1DQMH 5GGUA 2VLRD 4OF6A 2DKSA 3DO7A 1A7NL 2YPVH 1D5MA 2VXUL 4JG0L 3EDJA 1HCFX 3TNNA 1NUGA 3HCVA 7FABL 5HHOE 4ZO7A 1DVFB 1ONQA 3AY4C 5C07B 3W9DA 1WVZA 3WXWH 2JJSA 1GYAA 1U36A 3GHEH 3Q6FB 5D2NA 4WFFE 4J8RA 5HI3D 5E5RB 1WBXB 3VXNA 4LAJH 5DHXB 2WV3A 2H32A 2BRRH 1S7UA 1MCSA 2UUDK 5EPMB 2NTFB 3ZDYF 2FATL 1H5BB 5IVXE 4Y4KD 3IJSB 4O2FB 1AHWC 2GJJA 4MVBC 1FORL 2CKBA 1DP0A 4Z7OF 2OSLB 4X4ME 3LV3B 4F7EA 1N3NA 1OSPH 2XTJD 4HMEA 2FHBA 5GGTL 4TVSa 2CJUH 3U30C 4OD2B 3BWAB 3GSNB 1LP9B 1OP3H 2F8OA 3LKSA 4P4KB 3MSPA 1W0WA 3UBXI 1JNHB 1BVZA 5FUOH 5CEXB 1YMME 3LEXA 1OAKL 2UV3A 2H32H 1BQHB 1KLUB 2R4SL 3L5HA 4CVXB 3ARSA 4EXKA 4UNVA 5IGXL 1LK3H 1GHFL 1PKQA 5E00B 3KPNA 2W9DH 3ULVC 5C0JB 1TMCA 2PW1A 3JUYA 4N8VG 2JLLA 1MWAL 4MXVF 2J8UE 1QVOA 1QBLH 1U8HB 3E8UH 3CAFA 1R3HB 3QFJE 4Y0GA 1I1FB 3E0GA 1JYNA 2AXJA 4NQEA 1NC4A 3M1BA 5ISZE 1RJYA 4AK1A 4G8IA 5IJKA 2C5DC 4OLXH 1QA9A 1G7LB 5IQ7H 3ZE0F 3B3IA 4RIRB 3ESUF 4NKMB 1TVDA 1T7WA 2YPLE 3S34L 3PWJB 1ZGLA 3P77A 2B5IB 5GZND 4O58L 3T2QA 2CDEA 3QEQE 3WCYA 2VXVH 4JRWA 1JWMA 1U91B 4M8QB 1CXHA 4KVCH 3KLAA 1ED3B 4OZGE 3HB3D 1CTOA 2VYRE 4CKVX 3RY4A 1TVHB 1FV1A 1IM9D 2J8HA 1RQ5A 3DGGA 2M2DA 1NBVH 5E4EB 3MFFB 3C5ZD 3RVUD 1EDQA 1DFBH 3IFNL 2XZQH 3MLVH 4ELKA 3PGDB 1BJ1J 2CR6A 5F96L 3P4MB 4YX2H 1KCSL 3TNMB 1KIQA 5HHMD 5I75C 2QLVB 4G42A 1A2YA 1KPVB 5T3ZD 3C08H 1YNTA 2BHUA 3EJZC 4NPYA 5IFAH 1ADQL 2EDEA 1UKTA 5F1IA 4HDIB 3VXRD 2EH8L 5I66B 4ELMB 3U0WH 1OCWL 3QYCA 5MEQB 1KYOJ 4FXKB 4JFFD 5IHLB 2P5WE 4RDQF 4F37K 2DQDH 2ZCHH 4K94H 5FYKE 3FMGL 4ZAKB 1U8LB 3R8BB 4YHIB 2OTWB 1I8KB 2APFA 4G7VH 4EZMA 2EDQA 3I02A 4PRIA 5TJWK 2RHEA 4KDTA 3U46A 4Y89A 4K3EL 4PRBA 4LF3B 5FKPB 2EDYA 3AREB 5CWSA 5DFTA 2ED7A 5ELIA 4P49A 4MA7L 4U6VH 5GGTA 1N8ZA 2YPKA 1OM3H 3OMZA 3WL9B 4MYWB 3M07A 4Z7UB 4FNLL 5CEZD 3UJTH 4GAGL 1CLZH 3U0TB 4NN5C 4U1KB 2MPAH 4JE4B 1K85A 5IB1B 3CH8A 2AI0L 2GQHA 1DEEA 4YNYB 4ZUVA 1U8IB 2X89A 4NCC2 5B3JE 3BDYH 1P53A 2FCBA 4OCRH 4U6XB 2BVEA 1PVHA 2KH2B 4OTXL 4Y4FB 1MJUL 2E5EA 4JZOA 5GS3A 1QKZL 5TF0A 3UO1H 4Y1AE 2ZOLB 2AEPL 3T3PE 1P4LB 3O45A 3UC0L 4LCWD 5J7CC 1MWAA 4ZPTB 4G8GD 1WC7A 1NMCB 5GRUL 3OAUH 1JYWA 1C8PA 3ARYA 5HHQA 2A9NH 5GGVH 3GMRA 4WW2A 5C09B 5DI8A 1W8NA 3INUL 3PL6B 4LSQL 5C2UB 5FECB 3TA3C 2EH7H 4BH7A 3D48R 1QLEH 4K2UL 4J2XA 3BEVB 1TQCC 2XA3A 1J1OH 4FZEL 1N5AB 4RMRA 6FABL 1HYRC 5T1DL 3GSWA 3W0WD 1ROWA 4HJJH 2R2BA 3T65B 1PBYA 3BW9B 3HUJF 4X7FC 1CL7H 3O8XD 4JM2A 5E2TL 3QZWB 1FHGA 2X41A 3LKQB 3ZKMD 1CD8A 1A6AB 4ZTPH 3QDMB 4MNQE 5GS1A 3EZ8A 3OL2A 2HT3D 4ODSH 3GMPA 3HAEG 1CZ8L 3BKMH 3WXVL 1T83A 3QEHB 4G6FB 5JR1H 3FB7A 4I3SL 2BSSA 4ZSOB 3ARFC 5F1NB 5I1HH 2GTWA 4XPGL 5ITBL 1QTYT 3WUWA 2YMXL 1BQLH 1A6UL 3P0GB 3NFPB 1A6TB 4PJ9D 1J0HA 3U6RB 1TZGL 3K1KC 4UDUA 4AIXA 2DS4A 1S7WB 4XVSL 5EOTA 5ACZB 4XBEL 4JY6A 4QT5A 2XKNB 2DQFB 4F58L 4PP1D 1YPZF 3RVWC 3QCUH 5LBSL 3TF7A 3PGFH 2WUBL 4UINH 4JHBA 1I1AB 4JFYB 5FOBA 3CXDH 1K2DA 1ZHKA 3IDIA 3IJHB 5L88L 4RX4D 4M7ZC 3BDXA 2YUWA 1JZ5A 5A16A 1A8JH 1E4XH 1HINL 5GSRA 4FXGA 5C0GA 1WFNA 4L8DA 2HWZL 4HH8A 3TP4A 4MCZB 4X99A 3FOLA 3X3FH 2XZAL 3T1FA 5CD3B 4LMQE 1KIUA 2QR0B 3J7HA 4PJ8D 4J4PA 4WI4A 3MYJB 4P23D 4HC1L 3NGBC 4DUXA 2A6IA 5HHVH 4JFQA 2X7LA 2D0HA 2PCPB 3UDWA 1ULVA 1Q9KA 1HHGB 4C54A 5TQ0L 4QRRA 5MENB 1U3ZA 1K4CA 4P2RA 3DMMA 4NQCE 3ZYJA 4IDLA 3QUYD 3BIKB 3OKMA 1CDIA 3ILQC 4U7MA 2DQHL 5AD0B 4JAMA 3K3QA 4PGDA 3O2VL 5IG7A 3C6SB 4U0RB 3FOMA 5KG9A 1F6LL 1I9RL 2IADA 4TSCL 3VRJB 5DEZA 5L6YH 1FH5H 1YEIL 5MI0B 4MXQA 1MCOH 1VFOA 3GMLB 4YR6B 4FABL 3WDIA 3TJHD 3IFLL 1DVFD 1BVLB 4RWHA 5C07D 3QQ9C 5AZEL 3WS3B 2WUCH 1XF2B 4GMSL 4OCWH 4HWEH 5IJVB 1MELA 2Q87A 1QD0A 5GGSB 4WHDA 3RL2A 3RVTC 1JGLL 1U92A 4JQIL 5DD0H 5JORB 1J7VR 2QKIA 1BVKA 4PRHD 5JLZA 3LIZH 4X4XB 2NW2B 4WHYH 4LVNB 5KSVA 4OFPA 4YDIL 1WWBX 3QIWC 2EYTA 4AEIL 2OI9A 1XR8A 3LKOB 3QNYB 4EN3C 4RBPK 5EZJA 4CADB 1VEPA 4QHUA 4JJ5A 2P8LA 1UM4H 3MRFA 5CHNA 3LS4H 5T33L 4R0LA 1OAYH 4QRPB 3EOYG 1GOFA 5DD5L 2ZUQB 3EOBB 1XT5A 32C2A 4WU5A 3RZCC 1X4XA 4P4KD 4AH2B 1MCWW 3A6BL 4MA8L 5DLMH 4OLZL 4PJAB 1UGNA 2OP4L 1C5DA 3GMMA 4HIJA 4LNVA 3BGMB 4FP8H 3D69A 1HXMB 1SBSL 3BQUD 2HLFD 1CTNA 2FYYB 4L8SA 1S9YA 3LRHA 1HH6A 2OX5A 4YDKL 3O2DA 3EYOA 3BYYA 5C0BA 2HJLB 1ORQB 3SCMA 4OCSH 2VRAA 3G6AB 4KRNA 4OB5L 1J10A 2R0KH 4DAGH 4G9DB 5DJ8A 4KK8C 2HMIC 1TQBC 4GXUM 2Z31C 3QUKB 4WJ5A 2XOTA 4O51A 5GRXG 5IB3A 1N0XH 3FRPG 4DTGL 4YEFA 3LMJH 4EDWL 4O2CA 3X14A 4KMTL 4XAWL 2C3XA 4OGYH 1KG0A 3GJFK 1Z0NA 2CSPA 4NRYA 4G43B 3R0MA 4P5TC 4Y4HC 4ZTOH 4TVPD 1U8PA 3WLWD 4OF0A 4JFOB 4JM4H 4V1DB 1LO0L 4HLZH 3BO8A 1MNUH 2CUHA 5HI4C 3VG9C 4LPYA 3EAKA 5F1SA 3N9GL 5L2JA 1OF2A 5TPWH 4W4NA 1SM3H 1SYVA 5EZLA 1DUYA 1FYTE 5FM5M 2I24N 1ZV5A 3EO1B 4TPRH 3WFBL 1ZA3B 3PNWB 2PN5A 1MFDH 3BFOA 2VZOA 5E8DL 4XMLH 43CAA 3OJDA 3X11B 4PB9L 1B9ZA 4LLVA 4RAVA 3K4AA 4R4BA 5F3BA 3C6LC 1IKNA 1WCBB 5FXCH 3B2UC 5D1ZC 4LCCB 3MLSL 1DQQB 1IARB 4X6FA 4PYGA 4UQ3B 3VFWB 5LKNA 4O9HH 4I8DA 4GO6B 2R0LL 4KRLB 2CK0H 1BPVA 2F54E 4ZAKD 1P7QB 3QNZA 5ID1A 4ZUUB 1INDH 4YDLB 2ESVB 4X9GA 5LGJB 3TYGH 1FNAA 4IRZH 3OHXA 3LEVH 1G7MA 3BSZL 3QCVL 4KH2A 5F6IB 1QR1B 2M26A 3KLSA 3QHFH 5MERA 3ARED 5CIPA 3UJIH 1HWHB 3I2CH 2QQQA 1YEFL 5HHOB 2NY2B 3VJ6A 1C1EH 5CSZA 4X6CE 3H9SA 3MA9H 2EC8A 2B1AH 3HMXA 1S7QB 5C0AA 1CF8L 4G3YL 1SJHA 1I4FB 1L7TH 1SBBA 4MB5A 3DSFH 3HE7A 1YEKL 4MA1C 3NFNB 4NQVA 5D8JL 5IVXB 4TRPL 4PY8I 1OTSD 1RFDH 2I60L 4DGIL 2F15A 3PHOB 2O5XH 5IR1A 3CFBA 4Y4FD 1X7QB 4HQQH 5CINL 1EVUA 43C9B 4HK0B 2X05A 5CZXC 3HRPA 1MHEB 3OKEA 4ZODA 2RGSA 3E3QA 3LN4B 4WW1B 2D7PA 3DVNB 5IW1A 1TETL 3TBYB 3VFRB 1W72L 5DHYB 1CLYH 4HMCA 1DQDL 3U1SH 3UMTA 1H8NA 4NNPL 1OQXA 1S7XB 1YMMB 1C12B 5C09D 2C4FU 3VD3A 3PL6D 4MD4B 1F4HA 4IOIA 3L3JA 4X4ZA 1KFAH 5DC9B 2XWBB 5IK3B 1I1RA 2G5RA 1FLRH 1DQJB 5DJXA 1AO7A 4PJHA 4QOKA 2GJZA 2DDQH 4RQQB 3MGTB 2J8UB 4KI5E 5DJYA 5JW4N 4U1LA 3QSKB 3OR6B 4ISVA 1ZT7B 4ZS7L 5FGSA 4U1MB 2HTKC 3QFJB 1EEYB 4OZHE 2DQEL 3FB6B 7CGTA 1CVSC 5ISZB 2YD9A 2XQBL 5M94B 3I84A 3QDMD 4QRQA 3PE9A 4S1SH 3CZFA 2R15A 4OUUA 4LEXH 3O9WA 4ONOA 1B3JA 2H8PA 4G6FD 2YPLB 3FO1B 4O4YL 1VERA 2R2HB 3ARDA 3DLQR 1OAXL 1JNNL 1EFXB 1KEML 2B4CH 1QRNE 4H0IA 2KL6A 4MDJB 1B6UA 3IU3A 3MNZB 5B38B 3QEQB 2X4TB 3NCYS 1B0RA 5A43C 1LQVA 4OZGB 3FRUB 5HVHB 4RBPH 4PJFF 2APWA 3VFPB 5HI3C 1JNJA 5DFVD 1KJ2H 3UTPD 3FFDB 4H26B 4IEFB 1DQTA 1KCUL 1E6OL 2VLLB 4D9LL 2A73A 2H41A 3ARGA 4MAYA 4Y5VC 5FHAL 1I1AD 5B8CC 5DSCA 2HKFL 3UYRL 1BZ9B 3CMOL 4FN0A 3FO2A 5K9OA 1B0GB 5I1CL 1EERB 4X5LA 4ZXBA 3WHXB 5TDNA 2Q3ZA 4MJ6B 2QQLL 5TDPB 4OCLC 2YD5A 2XTJC 1H15B 2AJXL 2AJSL 2DIBA 1BGXL 1FO0L 5E6IC 2R0ZH 1RD6A 2OR9L 3UCRA 4LOUC 4LAQL 4ZMAT 1LILA 3IRPX 2P5WB 4U1GC 2YN5A 1OQOA 1Q9OA 1IQDB 3L5WA 4GMTH 1F11A 1TJHL 1T89A 5AYUL 1H3PH 2PTVA 3HE6A 4GKSA 1MVFA 4KV5E 2C3WA 2GHWB 5BW7A 1SQ2N 5F8RC 2ZKHH 2AJYL 3C8KA 2UWEA 4WFED 3GJFH 2RCSL 3V0AC 3S9DB 3RHWF 1P9MC 3P0YH 4LLYA 1KACB 2MMXA 3IETA 1U8KB 1CT8A 1L7IL 1NL0H 1U93B 3LKPA 4HUMB 4JKMA 4JCMA 4OM1L 3VW3L 4UIKL 4OJFL 5B22A 5ETUB 4N8CL 5D2LE 4Y2DC 1AXSB 3BIAX 4JZJC 3B9AA 4Z0XA 1EIBA 5AAWA 4OI7A 1T6WA 4G8FB 1WFUA 1NCBL 2NY1B 5FUCC 4QRUA 1UB5B 5J13C 5DQDL 1W72A 2A77H 3D0VA 3UTSA 1RUMH 4A6YH 1IT9L 1T7VA 5EWIH 4KWUA 2NXYC 1HHIA 3ETBF 3ERYA 1FC1A 3MV8A 3V5HA 2VZSA 3IFOA 4Z76B 1HQ4A 4CW1B 1A4JB 3NCBB 5DVNA 2W9LA 4JPKH 4P46A 4P5KA 3MOBH 4E42B 3DX6A 3GGWB 4WU7A 4Y1AB 5I76A 3SGDH 3QG7L 9CGTA 2VDRL 1CGSH 3MMEA 1CU4H 2GSGB 1XGQB 1FN4B 4L9LC 5LWYL 4JREC 1BM3H 1BOGA 2ICEA 2FEDD 3FFCA 3GRWL 4FFZL 4G6AC 4OD3H 4L5FH 1TJGH 3ULSA 1FNGB 4ZFOL 5K33A 4P3DA 5C92A 5CBAA 2MSPA 5EC2B 5DRWB 4W6YB 4GSDL 4PB0H 4QRPD 5ENWB 3H3BC 5TH2A 3KAAA 3QXAA 5H2BA 2E7LC 4KAQH 3S88L 1D5IL 2DKMA 2MQ3A 2XNAB 3VCLA 4C59B 4I18A 4N8VB 4PBVC 2AXGB 5I0ZA 1MFAL 3MRDA 1FIEA 4HGWA 5T3ZL 3ISWA 4MCYA 4MX7B 2D7QA 1ORSB 3LN5A 4KK5D 3PHQA 4I4WA 4J3TA 5IBUG 1PLGL 4MNQB 4UV7H 1E0OB 4LGRB 3I3DA 4NM4H 4ZOEA 2DWDB 4H20L 3ZL4L 2KPNA 2O61A 4WGWB 5DMJB 2W59A 5EU7E 3AAZB 3BPNC 1PDKA 1DUZB 3B2VH 2CLRB 2GI7A 3IXAB 2ZG1A 3B9DA 3OGOE 3L3OB 4LDOB 4LFHG 1X5IA 1G7QA 5GZOC 1J11A 5CEYB 3SKMA 5JW3L 5C3LD 4AM0A 5L2KE 4ONHB 4LASH 1ZAGA 1YDPB 2IBZY 3G5XB 3RKDC 4N0FB 1FO0A 4Y4KA 2AKRA 4PGEA 5JW5B 3GSQB 2YHGA 3N50A 4JDTL 4V1DD 4NRZB 3MRLB 2JK5B 1DQML 4QCIB 5DGQA 4F33B 5FYKU 1D5ZB 2V7NA 1UKSA 5E8NB 3DNKA 4P57B 4X7TB 5BVJA 1IGJB 3VFNA 1IFHL 5CEZL 4XBGB 2NY0C 4EDXB 3MNVA 3WXWL 1NGYB 1LO2L 3ZHLA 3ULUH 2A74B 4LLDA 1MIEH 2AQ2A 4JZNB 5ID0B 3V4UL 1K4DB 5SWZA 1YQ2A 3LPGA 5MEOA 3TGXA 1T1ZA 2V17L 4LGPB 5F7WC 3F7VB 4XAKE 5F9DC 4JPVL 3SDCB 4OV5A 1JBJA 3MUGB 5EULV 2QV2A 2HVJA 5J4MA 1XF4A 3B4NA 5FCUH 3NH7L 2P47B 2Y07L 3CVHB 3MLTA 2MFNA 2I9TB 3LD8B 5I19H 1GZPA 2HFGL 4Z7QE 4JEGB 1JHLH 4IMLB 4X6DA 2AJ3A 3NPSC 5HY9B 4XPBH 2IAMC 4NQCB 3PWUA 5B39G 4UNUA 1J0KA 4OGAD 3OPZH 4CAGA 3O8XC 3VXMA 3Q6GH 5TE7L 3VWJC 1CXLA 2V2WB 1WLHA 1RUAH 5KVFL 1LK3L 1WTGT 1A1MB 1DE4B 1AR1C 3RWEB 2G2RA 4X6EA 2EXYC 4OZIF 5IMKA 2OJEB 2E9WA 5F3HB 1EO8H 3IB4A 3GRWA 3BUYA 1QBLL 4L4VA 1I75A 2EDKA 4CDGC 1HDMB 5HHOD 2NY2D 1VKXA 3GIZH 1NBZB 2R23B 1TXKA 1ZA6A 4ZFOA 5B3NA 5F1OB 1LO3H 3H9HA 4WFFD 1DCLA 5DDHA 2FLRT 3FQRB 2WINB 4OQTL 3C5ZA 2ADIA 3H7BA 1FVCB 1UJ3B 5BO1L 4OLXL 3TBTA 3MV7E 3HPLA 5IQ7L 4Y5YC 1S5IH 4U3XA 5E1HB 2DM3A 4HUXB 3EGSB 1T0NB 3RWCB 4N9GB 2WBWB 5HHMA 4L8BA 4HXBL 2EKSA 4Z6AT 2CD0A 2GK0A 5T3XH 1MF2H 4QNPF 2AW2A 2VXVL 3VXRA 4LIQL 4KVCL 3SDDC 2EIZA 2BOCB 4PLOB 5EU3A 1TCRA 2APVA 4OSUH 4JFFA 2CRZA 1T3FB 2FJFA 3UXFA 2BVOA 1F4XH 4Z5RB 2OK0H 2Q76A 1UH2A 1QFHA 5C0DA 1YMMD 4PRAA 1YY8A 1CFBA 1VGKB 2XZQL 2MHAB 5F88B 1Y6NR 5LXGL 3QQ3A 1U8OA 2P46B 3BDBA 1NAKL 3G9AB 2QHRL 4X6BB 5HDLA 3WN5C 5D4QA 3O2WH 3GEWB 3T0WA 4WY7H 3P4NA 5FK9B 1PG7X 5BXFB 2F8XC 1PG7H 1JZ4A 5IFAL 3N1QC 4K94C 4JPWL 5I8EB 3V0VB 3RIFF 1ZANL 4X8JA 3CU1A 1IGCH 5CMAB 4P9HH 4I5BB 4XNXH 3SE9H 3E2HA 4M1CC 5ISZD 5GQBA 3B5GA 4YEEA 1MVUB 1U3HA 3MJGX 4XNQB 3RNQB 3MLRH 2OCFD 2ZCHL 3BJLA 2ADFL 3SE4C 4KPHH 5GS0D 4ZOBA 2OL3B 2YPLD 4NN7C 1GZQB 3CCHA 4OFVA 3HA0A 4PJBF 5MP6H 1EFXD 3BXNA 3MV9A 1WTLA 3DV6A 1FL5B 5DUBB 3QEQD 2XN9D 3V5DB 4FQXB 5JQ6H 4HIEB 4NO5A 1YN6B 2AVGA 4IDJH 4LCWA 1HSBA 4IIQA 4G8GA 1M05B 1FYTB 3MACH 4JDVA 4U6VL 1ZS8B 4R96A 1W8OA 1OM3L 1V7ML 4HIHB 1AJ7L 3NIFE 2NY4B 2VQUA 1CLZL 1KLGA 2MPAL 3L3HB 5GJTL 1KTDA 1RVFH 5IV2A 3I9GH 3JWOL 5C0EA 4MNHB 2WBJA 4X98A 1OGTA 2ZSWA 1A1NB 3FONA 4U3CA 4XCNB 3KHQA 4WNQB 3WFEH 2VDNL 1A6VH 2BFVH 3UO1L 5EORH 1W2KT 1QSVA 2V9RA 4AJ0A 5DTFA 4BH8B 5IOPB 3U7WH 3GMNB 5JW4R 3OAUL 1HHKA 1ETZA 4X7SL 4JDZA 1BQSA 5FYKD 4A2LA 2F54B 1IM3A 5D5ME 5GGVL 3WLBB 5DYOA 3BQUC 4OQTA 4F7TB 1RJLB 1T5WA 4M61B 2EH7L 5CP3A 4G6JL 4BQBA 4B7IA 4FQQA 2AV7B 1J1OL 5F7EH 3T77B 3VGFA 2AK4A 3U0PA 5DJ6A 4JQVA 1B4JH 3NZ8B 4PJ9A 3L3DA 3WO4C 3GHBH 1C16B 3MRIB 4WV1B 4YK4C 2JB6B 3WEXA 3DX9A 1NFDE 4X6CB 3RY6A 3BUTA 2NY1D 3BKCH 4APQB 2IQAA 1V7NH 3ZDZE 1CXIA 1HSAA 3D39E 3L3IB 5F7NC 4ONGH 5IP4A 3S37X 1DBAH 2HT2C 5E56A 4G7YH 4ZTPL 5CZVH 1RZ7H 1D6EA 2NY6B 4XHJD 1LE9A 1XCQB 1A3QA 4UIMB 4O5LH 4RX4A 3PWVB 3E1F1 2PTTB 5JR1L 1DN0B 4QXTB 3ULVE 4ZNCD 4H1LG 4F9LA 5I8KH 3PWNA 4Y1AD 2BZDA 2P48B 4POUB 3VE0A 1YUHB 3MNWA 3V5KA 1WAAE 3K1DA 4WI9A 2XFXA 5C8JB 4RISH 1E6JH 3NABH 1LWRA 2V6HA 1UB6A 2X1OA 3IDUA 4PJ8A 3VFTA 4XP9H 1MJ7H 3QCUL 4XGZA 4P23A 4GBXB 1IE5A 5EZOL 4JFXB 1XGPB 3PGFL 4BSJA 1YC8A 3VFSA 4UINL 4LVHB 4YDJA 4WHCA 1WUNT 3IKCB 4Q6YA 3C5SA 2G5BA 2XI9A 1BFSA 1X5FA 2E8YA 4KZDL 3OXRA 3W5MA 1OPGH 1VFUA 3WNPA 4HPYH 1DDHB 1O7VA 1C08B 3DX8B 1MH5B 3QUYA 3H0TA 1I9IH 3WJJA 3QIBB 5F44A 3TF7C 4NC0B 4UQ2B 4XP5L 3X3FL 4B0MM 5I2IB 2FSEA 4OZHB 3MJ9H 4S1RH 1N26A 4XNMA 3RWJA 3KPQA 4L3ED 2IBBA 5FHBH 4TYUA 4KK9D 4MZ3A 3SKJH 1QZ1A 4G5ZH 3SGJC 2YRLA 1HCVA 3DTXB 5IMMB 4NUGH 3H9YA 3TJHA 3KS0H 5HHVL 1UM6L 1DVFA 3QI9D 4KKCC 5ITFB 5C07A 4IMKA 5E1AB 1JF5A 2YD8A 3Q6FA 4ZO8A 1QRNB 2ATPB 3V0WH 1WBXA 3DHJA 5J89A 1MRCH 2HH0L 4L1HA 4J4PC 1ZVHA 4M62H 3ALPA 3ARUA 3QR2A 1OAUH 2IALA 2JB5H 4NWUH 5EPMA 2NTFA 1DL7H 1H5BA 4IJ3B 5EUOE 4O2FA 4ZD3H 5J8OA 3QPXH 3F7QA 4KQ3L 2OSLA 3LV3A 3S98A 5BS0E 4HEPG 5L6YL 1FH5L 3SJVE 1MCOL 4OD2A 3BWAA 3GSNA 4LCIL 3BPOC 5E0QA 1LP9A 3G5ZB 4OZFH 5HJ3B 2WUCL 3TH2T 4P4KA 4QYOB 1KCRL 4HWEL 4OCWL 4MS8D 1DANT 1JNHA 5CEXA 1S9VB 2X9XA 3CSPA 1N6UA 1FLTX 4F9PA 1BQHA 1KLUA 1ZT1B 4NKIL 5CAYB 2IPKB 1IKFL 5DD0L 4CVXA 4U6HB 4RNRB 4KTDH 1UVQB 3T0EC 4KJPD 2ORBL 2G60L 3SDCD 2Q3AA 3LIZL 3WFCL 3DIFB 4G8EB 5C0JA 5IEKB 1CFNB 4QWWD 1CCZA 4IRJC 4OI8A 1EA9C 1YECH 1U8HA 3SBWC 3EDFA 1R3HA 1KENL 3RA7H 1I1FA 1UM4L 1CXEA 3RNKB 4PDCE 1LO4H 1LK2B 5F9OL 4UOW0 4NQCD 1G7LA 3HI1B 3W11D 4ZG1A 1J05A 5D2LB 4FHBD 4RIRA 4NKMA 3MCKB 2RR3A 4CMMB 2X42A 4BELD 4XPAH 3PWJA 1T7YA 3WNNA 2X5PA 1WEJL 4N8PA 2ADGB 3KPLB 3SO5A 1R3JB 4XPFH 3EYFA 1EUTA 3BGFC 2BSED 4R4ND 1U91A 4M8QA 4OCSL 4LSRH 1ED3A 3MX0A 4GQ9H 2R0KL 1EV2E 1TVHA 3DRTB 3CDGB 2H2SC 3MROB 3ARTA 3MFFA 1N0XL 1PY4A 3I6KB 2NZIA 3P4MA 4HIXH 3TNMA 5EN2B 3CC5B 1MQKH 3AM8C 4GKNB 4PP2B 1NCCH 1S9WB 1FPTL 1KPVA 4HLJA 5T1KB 5EBLB 4JM4L 4MA3A 2A9ML 4YXHH 4PJIE 4HDIA 5I66A 4ELMA 1ZLSH 5D70L 3BKYH 5MEQA 1SM3L 4FXKA 4EBQH 5IFHL 5KOVC 3K80A 3X13B 3FB8B 5C6WH 1DBBL 4JKLA 4TPRL 4GAFB 5D96C 4LKCB 1U8LA 4K71C 4YHIA 1MFDL 1WQVT 4PJGE 4YHYB 2OTWA 1I8KA 4PG2A 4RAHA 1I8MB 4LDEB 1AFVH 5CILH 5I1LB 1XR9B 4PS4H 4XPHH 4LF3A 5FKPA 3AREA 5JNYB 1D9KC 2OR8A 4DCQB 2ZG3A 2K1MA 4O9HL 3KPSE 4HEME 3WL9A 3EOTH 4Z7UA 2CK0L 1AD9B 1IGTB 2Z35B 5DK0B 3CDFA 3U0TA 1ZXQA 4U1KA 5IB1A 1B2WH 5L2KB 4NHCH 3KYOB 4ZPVA 4LHUG 4J3UA 1MSPA 1OARL 4BQCA 1CQYA 4U6XA 3AB0B 5BV7H 3GBLA 4HUKB 2FX9H 4Y4FA 4FQXD 2ZOLA 3QHFL 4G6KL 4JRYA 3UPAA 3UJIL 5B4MD 1P4LA 3NOIA 3WD5H 3I2CL 3BESR 1J0ZA 5EU5B 4ZPTA 4RMUA 2DF3A 1FYTD 1C1EL 5KZCD 5CJQL 3FT2B 4UILL 2DQIL 2DAVA 3MA9L 3TO2A 4QHNB 2LU7A 3AROA 1M7DB 2FEEI 3SDAB 3LRGA 4XTRD 5D5MF 1L7TL 1LEIB 2NY4D 2JIXA 4TUKH 5C09A 3H42L 5DRXB 3DSFL 3PL6A 4TOYL 2PXYB 1G9MH 4KKLD 5GS2D 5FECA 5DJDB 4W4OA 4WFHE 4GG6E 3BEVA 4Z18A 1L6XA 1N5AA 1RFDL 3VGAB 4DKDC 2D9CA 1JHKL 2VE6B 2O5XL 3H8NA 5DVKA 3QDJE 4LSTH 3C2AL 1CS6A 4N5EC 2LE9A 2ZNXA 4I9WD 3T65A 2AEQH 3V4PH 3BW9A 5E7BA 3QQNA 1H9VA 5J3HD 4NP4H 3QZWA 3DVIA 1A0QH 3LKQA 1CLYL 1CDUA 2AJVL 3U1SL 2CO7B 4D94A 2F54D 4Z95H 4DVRH 1A6AA 3QDMA 4P5MB 4ZS6D 4ODUB 2JTDA 5E4IA 4KRPC 3TVMB 3MODL 1GPOH 3QXUA 3QEHA 2EEBA 4M48L 2VOTA 4RWYH 1J1PH 4O2EB 4ZSOA 5F1NA 2CPCA 4KROB 2W0PA 3ZHKA 1FLRL 5GRWA 3L5IA 4DK6A 2DDQL 2FZ3B 4XI5D 1ZHLB 3NFPA 1A6TA 5F6HI 3U6RA 5D1QB 2JELH 2OS7A 1IGFL 1QPXA 3S97C 1GC1H 1S7WA 3SE3C 4D0BB 5ACZA 1UACH 3EDEA 1N4XH 1P84K 3MRHB 3RWHB 2XKNA 4APQD 1BAFH 2VZ3A 2NY3B 4XCCH 4TNWF 4P2OB 1NDGB 2B4CC 3V8CA 1A3RH 1G9NH 3X12B 3MV7B 1U6AL 1EVTC 1I1AA 5I6XB 1AGCB 4JFYA 5BZWB 3HNSH 3IJHA 4HKZB 4JM2F 4OKVA 4YBQD 3C2SA 1S7RB 1EAJA 3TH4T 5ESQB 1FBIH 4UUJB 4ODTH 4FQHB 2HT4C 2D4FA 2R56L 4BZYA 3RPIB 1Y0LB 4F80A 3QUMH 4MCZA 5IM7B 1UQSB 4JFPB 5CD3A 3TFKA 3DROB 2H2PC 5I1EH 1ZT4B 4BFEA 1KJ2L 5HSFA 2QR0A 3MYJA 3HC0B 1YN7B 3FT3B 1S7TB 4LSSL 3SKOB 2FJHA 4GXVH 1NSNL 2PCPA 3G5YB 5HDBE 2QBWA 1UM5H 3I6LE 3TO4B 5MENA 4LCCC 1T66C 2P7TB 4KKAD 4KI5D 1GGTA 5IBUB 5HYJE 2OTUB 1U58B 3QIBD 3BIKA 2Q8BH 2ZOKB 2R0ZL 4R4FH 3UJJL 5EUOF 1R5IB 1KGCE 5CGTA 4YXLH 5AD0A 2E7MA 2E27H 3DI2B 4MJ2A 3ARRA 5KS9E 2OM5A 4PLKC 1J5OH 2LTQB 3VRJA 4OGAC 4GMTL 4AYFA 2BVYA 2Z93B 4YR6A 1H3PL 3GMLA 3PP3K 4XX1E 4PV8B 5F6IC 1BWMA 1BVLA 1IZKA 2ZKHL 5IB5B 2D03H 1J0JA 3WS3A 1XF2A 1Y6KR 3P0YL 3P30L 2Z4QB 3FQTB 3VGHA 2YBRB 1G7PB 1UWEH 5GGSA 4N0CC 1E4WH 4NNYB 5JORA 5E2JA 4XWGH 2N7AA 3CFJB 4GRWE 5IHZB 4QTIH 1MJJB 4X4XA 2NW2A 4V3DB 2XPGB 1JPTL 3GKZA 3LKOA 1INEH 3EFDH 4J1UB 4CADA 2HP4A 1G7IB 4XCEB 5K9QG 4QRPA 3RVVC 3EOBA 4AH2A 3TN0D 3MUJA 3RIAF 4JPKL 2EDBA 4PJAA 5C7XL 1QYGH 1UCBH 4YGVB 1HXMA 3U7YL 1CU4L 2PO6C 4GQPH 4P2CG 2FYYA 3VXUE 4MJID 2AJZB 3O3UN 3WJLC 4R7DB 4D9QE 5DVMA 3VGEA 5D5MB 2HJLA 4L5FL 1ORQA 1YY9D 3WNKA 1XH3B 3G6AA 4EKXA 1T0PB 3B9VA 1PQZB 1MAML 1GCFA 4Q58C 4G9DA 4Y5XC 4HFUH 4PB0L 2IMNA 3K0WA 1AHWB 3DRQB 1AXTH 3QUKA 3EYVB 4H5SB 1IGML 4JFHE 1CI5A 1NC2A 3U30B 4P99A 4K23H 2KZWA 1JGVH 1I7UB 1NFDB 4G43A 4FFYH 2F8VA 2EDWA 3D39B 3EHBD 4JFOA 4V1DA 4PGBB 1S3KH 4RFOH 3MR9B 1NLDH 4PJIF 1VFAB 3U9PH 1K8DB 2H45A 1DJSA 3O0RL 5IBLD 4RMVA 2CXGA 3B2VL 2XG5A 3PQYD 3CUPB 5CJXA 4EI6B 1XGUB 4U1SB 3L7EB 3BZ4B 3MRNB 5D7LE 5GS0L 2YUZA 1ZA3A 3PNWA 1BF8A 3QISA 5JIHA 4PJGF 1AI1H 2QSVA 1H0DB 5FGBC 2Y1VA 3TT1H 5GGSY 4P0DA 5GRZA 3X11A 3L5JA 3TCLB 5T1KD 3HS0B 3RRQA 3QDAA 3ME0A 3W5NA 1GGBH 1WCBA 4W70A 2AXHA 3ULUC 2YC1B 4EI5C 3VMPA 4UQ3A 1F3DJ 3RUGF 3WIHH 3VFWA 2B39A 1BLNB 4K7PL 2VLRE 3PV7A 5F89B 3ULUL 1MIEL 3IDJB 5J1TC 1RIVH 1P7QA 3P4OB 5JW4Q 1RIUL 4ZUUA 3MZTA 2ESVA 4W81A 5LGJA 4YUEL 5JUEH 1XCTB 5IEHB 3B8YA 1EAPB 1QR1A 3RKPA 2C3GA 3QJHB 4PV9B 4LLWB 5FCUL 3W39B 3O3DB 4IRSB 1OP9A 1MAJA 1YNLL 4M6NL 4M1GL 4LU5L 5HHOA 4PJDE 5I75B 3TBSB 2IQ9H 2JJVA 4LQ1A 1S7QA 2NW3B 1I4FA 3VGDA 3G5VB 5F93C 1OB1B 2XTJE 3BKJH 1FIGL 5L2KD 3K46A 3MLUH 3NFNA 5I1DB 1YMHB 2E7HA 3LAFA 3OPZL 3Q6GL 5EUOB 3UZQA 3V8OA 3F5WB 5IVXA 4GG6F 2PUQT 2VDOH 4MSWB 1RUAL 4EQ2A 5I1IH 3PHOA 3BMVA 4X4MA 1UYWH 1X7QA 4DFIA 4DZBB 5BS0B 43C9A 4HK0A 1EO8L 1MHEA 1MRDH 3LN4A 4WW1A 1Q38A 3DVNA 2XRAH 2BY3A 3OXSB 4AMKL 4X7EC 3GIZL 3TBYA 3VFRA 5DHYA 1TZIB 3OJMB 2DI9A 2HKHH 4DEPC 4OCXL 3SDAD 1S7XA 5AZ2H 5I73C 4BM7A 1YMMA 1C12A 3MREB 5TQ2L 5IROC 4M43H 4MD4A 4UMGA 4M4RA 3W9EB 1A3LL 2XWBA 4OM0H 4XAKD 4BSVB 5IK3A 4NC1C 4OIIH 1AQDB 1DQJA 5FUCE 4RQQA 4JQXC 3MGTA 4XP6H 2J8UA 5EU6E 1JF6A 2YZ8A 4NN5B 4LGSB 3OR6A 1NGXB 2IJ0C 1ZT7A 2IC2A 4U1MA 2Y72A 1XGRB 3QFJA 4WEMB 1EEYA 3RWDB 5DUML 3PP3H 3IDYC 3FB6A 3O6FC 4OSUL 5E2WH 5ISZA 2Q7YB 1P7HL 2OK0L 2O26U 2R0WH 1U42A 3GI8H 3TVMD 1DEDA 1KELH 3C60C 4UBDD 3ARWA 2YPLA 3FO1A 2R2HA 1U8NB 3S36X 1EFXA 1NDMB 2D0FA 4ZDHB 4P9HC 3S36H 4MDJA 1XF5B 3WFDL 3MNZA 5H94B 4OCYL 5B38A 3QEQA 2X4TA 4NJAH 3H3PL 3CDYA 3S3PA 1JZ8A 1AKJD 1PG7L 3RX5A 4OZGA 5D1QD 3QI9C 5FA4B 3NTCH 5I9QC 3TA3B 3MGOB 4PJHF 4XNXL 1TQCB 3FFDA 3SE9L 2NY3D 1FL3B 2Q8AH 2VLLA 3I85A 4P2OD 1BWWA 1RUPL 2E7LE 4H1LB 1NCAL 3MV7D 4MD5B 5FFLA 5DD1H 4KPHL 2Z8RA 1BZ9A 1T21B 5CSGA 5HHPB 3RWGB 2E7BA 5BRZE 1B0GA 4U1NB 3WHXA 4MJ6A 1XF3B 5TDPA 3BN3B 1L9NA 1E28B 1H15A 4PD4K 3EW3B 4PJIB 2FGWH 5HPMA 5JQ6L 4K7FB 1U3HC 1O5DT 5DA0B 4RA0C 5GISL 1PZUB 4MS8C 1FVEB 3ARFB 2P5WA 3MACL 3GB7B 5GRJH 1BFVH 5CP7B 1HOCB 4K8RH 2EICA 4ZNEE 3IDGB 2YKLH 2XWJB 4PJGB 2HRPH 4Z7VE 1F97A 2YD7A 1PAMA 3I9GL 2C1PB 3NCJH 5TE4H 5J06A 2BVPB 3IDNB 4YBLC 1M7XA 5FYLH 3TO4D 1U8KA 3N85H 4IM8A 1U93A 5T1LB 1UENA 3WFEL 1MRFL 5JPMB 4JVPA 5ETUA 2BFVL 3BD3A 3OX8B 5EORL 1AXSA 5JHDE 3I3BA 4M7ZB 3SOBH 4QEGA 4G8FA 4GRWF 4HCRA 5FO9A 3KYAA 3SDXE 1QR4A 3KPSB 1MJ8H 1UB5A 4LFHD 1HYSC 4L4JA 5ANME 2HJKB 2WBJC 3UPCA 1N6QH 3FL7A 3F65A 1G6RB 1ITCA 3RFZC 1XGYH 5E95B 3T2OA 2Y5TB 4OLYH 3NIGE 1XAUA 2W0FB 4KUCF 4Z76A 5KVGL 1A4JA 2ZG2A 5F7EL 5AG8A 5CD5D 3P9WB 4E42A 4Y1AA 3GGWA 3NGBB 3OF6A 3U9UB 1B4JL 3UTQA 1FDLH 4H0HB 3P11H 3QDGE 5A2LH 4GLRH 2GSGA 1JWSB 1XGQA 1FN4A 3H7LA 5C3TA 5SX4I 4CVWA 3IKKA 2J6EH 2WSKA 4LARH 4M3KB 3BKCL 3W0WE 1GXEA 3PDGA 4URTB 1QSZA 1BQHG 1FNEB 2VAAB 2B2XH 4AIZB 1FNGA 1DBAL 2R1XB 1NJ9B 4G7YL 3S37L 3E6HB 4HS8H 4K7PY 4ENED 2KUTA 5DRWA 5EC2A 3ARPA 4FXLA 4ZFGL 4O5LL 5ENWA 4GG6B 1REIA 4YHPB 5KTEH 3VFGH 1Q1JH 1MY7A 5JXEC 3BMWA 2XNAA 4N8VA 3QDJB 3QUXD 2AXGA 2XKUA 1P1ZB 2VXTH 4U6YB 4GS7C 4X0KB 1KN2H 4YHKH 1CD0A 4MX7A 1ORSA 4RISL 1E6JL 2Y25A 3NCYP 3Q1SL 5JMRA 4MNQA 5DEGB 5FM4A 5GHWL 2C3VA 1MJ7L 5I71C 3F7PC 3WKMH 2DWDA 2IH1B 3EIFA 3S7GA 4GW4B 1X5LA 2OYPA 5JTWA 3AAZA 5IMOB 3GK8L 1DUZA 4L4TE 2CLRA 3HC3H 3IXAA 4MVBD 1X44A 3L3OA 5CEYA 1OPGL 3QIWB 3WHE1 1SJVA 1NUDA 3N06B 4HPYL 4EN3B 1NFKA 4LHQB 4ONHA 1I9IL 4JY4B 1JHTB 2PYFB 1A9EB 1YDPA 3G5XA 4LPUA 4WUKH 3MJ9L 5JW5A 3RZCB 3GSQA 4E5XB 3D39D 1T03H 5FHBL 4NRZA 3MRLA 2JK5A 3D1MC 4QCIA 1EJOH 2P8PB 2CIKB 4F33A 1I8LA 3SKJL 1D5ZA 5E8NA 3RJDA 4WWID 4P57A 1DBKH 1TVBB 4X7TA 1IGJA 1IC5H 4NUGL 4Q6IB 1NGWB 1YEEL 2DJSA 4XBGA 4LSPL 3MRMB 4EDXA 3ULVD 1NGYA 5DMKB 2NY7L 4LBEB 2A74A 3V0WL 4JZNA 5ID0A 1MRCL 5JDSB 1DTUA 1K4DA 1E4KC 3CFEB 4M62L 3VH8G 1OAUL 1V3KA 1LDPL 4ORZC 4UTAL 4NWUL 3K2MC 1E27B 4XNYH 3F7VA 4DVBB 3SDCA 3MUGA 5I17B 1TQBB 3QPXL 2Z31B 5C9KA 4YXKL 1NCWL 1XIWD 3MRQB 4NQSB 4KKLC 1J0IA 4GUPB 3CVHA 5E94B 2I26N 1QBBA 2I9TA 2B0SH 3MRKA 2AQ3A 3MBXH 4OD1H 4P5TB 5BJTB 4Y4HB 3F58L 2V5TA 4IMLA 4TSBH 5FCSH 5HY9A 4RMQA 4NQCA 3EYUH 4HF5H 5HYJB 3HNVH 3MRPB 4CNIB 3VG9B 4NHUE 4HT1H 4LRIC 4FQ1L 5J3HC 1ZOXA 4P4RB 1QFWL 5HHNB 2V2WA 4KTDL 5KS9B 1A1MA 1DE4A 3RWEA 4QXGH 4ZS6C 4M00A 5IWLC 2OJEA 1ACZA 2N56A 5F3HA 4FQCL 1MREH 4IRSD 3R06B 3S3SA 2HG5B 5DK2B 4KTEL 2FWOB 1NBZA 2R23A 4PRHE 2HAZA 4YWGL 4LHUB 1NAMH 4F9PC 4J3OC 4HXAH 1GSMA 5HD8D 3B43A 3FQRA 2WINA 3HRZB 3C6LB 2NXZC 4GW1B 4BZ1L 1FVCA 1UJ3A 2HA1A 1HHJB 4F7MB 5D1ZB 4WWKC 2EDHA 3ZE1E 3EGSA 1T0NA 3RWCA 4N9GA 4GRWB 4X6DF 2JJTA 3O3AB 4XPAL 5LCVH 3AS2A 3BN9C 4XPFL 3STLB 3VRLF 1YJDH 5ADOH 2BOCA 4LSRL 3BRGC 1A7BA 4GQ9L 1T3FA 2GUOB 3VA2C 2WAHA 4Z5RA 4XRCB 4FQJH 1VGKA 2MHAA 1CFVH 5F88A 3QZWG 4N0YH 1IJ9A 3EYSL 1ITBB 4HIXL 4S0UC 3VXUB 1IMHC 2KKQA 1WT5A 2VB5A 4HG4J 1R5VB 1EFQA 3MLXH 4PBWD 5FK9A 5BXFA 2BVQB 5IESL 3RVXD 3JXAA 4MA1B 3CLFH 1WZKA 5I8EA 3V0VA 3L1OH 1F58H 1I3VA 4Y88A 3RZWA 5CMAA 2EXWD 4I5BA 3B83A 3NZHL 3RTQC 3AS0A 2AJUH 4P3CH 1MVUA 4C55A 4XNQA 4M7JH 4LSUH 3RWIA 1KC5H 4CN6A 2W0KA 1NCUA 3GSRB 1D6VH 1MIMH 2OL3A 2LABA 1GZQA 3EO0B 1AFVL 1YEDB 3CX5J 2FX8H 3T8XB 1FL5A 5DUBA 4S0TD 4GRMB 4XPHL 3H9ZA 3V5DA 2MQCA 4FQXA 1CK0L 1QEWB 4HIEA 4HH9B 1YN6A 1JVKA 1WFOA 1SEQL 2ILLA 3HAEH 3TA3D 5HGBB 5GJSL 3BVNB 3O4OC 1M05A 1FYTA 1U8QB 1ZS8A 1FNSH 3V6OC 1Z0MA 5D7LB 4HIHA 3EOTL 2LQRA 3DXAE 5I8CB 5BV7C 4EUPH 1X5XA 3L3HA 1B2WL 1AC6A 3QAZC 3IJYB 1ES0B 3C9NB 1CDBA 4NHCL 3DSNA 4S10A 4NGHH 4MNHA 5EU4B 3HC4H 1A1NA 4HJ0C 1NCNA 5IW3A 4M3JA 4XCNA 5BV7L 1KBGL 3OB0K 3KLHD 2FECL 5I15H 3NMEA 3OAYK 3LQMA 3B9KD 3WD5L 1KPUB 5DS8B 4BH8A 1G9MC 3TN0C 5IOPA 1EHLH 5DO2C 3ARFD 2VLRB 5KSBE 1DBML 3VG0H 1HZHH 5ALCH 4JO2H 3LPWA 2IGFH 2R9HC 1YEJH 2F54A 5DFWH 1UZ8B 3OG4B 3PWLA 3UTOA 1P5VA 4F7TA 1G9ML 3X3GH 4M61A 1S78C 3STZB 3NCMA 1JV5B 3OZ9H 2KQMA 2AV7A 5T1LD 1YY9C 1KT2B 3T77A 1H8OA 2FO4B 1EUUA 4Y5VB 3NZ8A 4JO1L 5B8CB 2CO6B 2WZPD 4M5ZH 5KVDH 2AEQL 1C16A 2VXQH 4PJDB 4WV1A 3V4PL 2JB6A 4X6CA 3V7AG 1SJEB 3LRSB 3KPSD 4APQA 5J9PB 4NP4L 1R3KA 2VR4A 3VXQB 3L3IA 2XTJB 4DVRL 1FG2B 1R3LB 4U05A 4XXDB 3FN0H 5E6IB 3I75B 3MC0A 4ODWB 1EZVY 1XCQA 1QG3A 4WUUE 4UIMA 1GPOL 1RZIB 3PWVA 2PTTA 1C5BH 5BOPA 1DN0A 1J1PL 3T0EE 1GC1C 4QXTA 4U1GB 3UAJC 3MV11 5FKAB 3KDMB 3LEYH 5TDOB 1LD9B 3MPCA 3BZFB 3SHSA 1G9NC 3ZTNL 4LQFH 1YUHA 2E9JA 2EDDA 1MCQA 3TZVC 1AQKL 2JELL 2P1YA 5BZDB 5C8JA 1UACL 4BUHA 1AGFB 1BAFL 1MCBA 3CU7A 4GBXA 1XGPA 1A3RL 4NM8H 4QKXB 4Y2DB 3WYRA 3IKCA 2VABB 2F53E 1N59B 4JZJB 5LGHH 3JBG7 1FZJB 3ILQD 2NYYD 4WFHD 1X4YA 4QGYA 4JG1L 1I9JH 1FBIL 4R26L 5J13B 4PJCE 1QSFD 5EU6B 5FUZH 1DDHA 4JLRB 1C08A 4RFEB 3DX8A 1MH5A 3FN9A 1K6QH 1BX2B 3QIBA 3PUCA 4XH2B 4UQ2A 2NXYB 5A3ID 5I2IA 4OZHA 1JPGB 4YC2C 2CMRH 1VSCA 1U3YA 1G1YA 5AEAA 3DTXA 1MCLA 1ODAA 3RVTD 2AK1H 5IMMA 4GXVL 1JUFB 1A47A 5C0BE 4MZ2A 5ITFA 4L9LB 5E1AA 4JREB 5DZLA 2D2OA 1JI1A 1QRNA 4MJ4A 1UM5L 3QIWD 4TN9A 2VZUA 4K07A 1D5XB 4OFIA 3ZSSA 5D72H 4HWBL 3WDHA 4FG6C 4R4FL 2WBKA 4NKQB 3IS1X 4ODHH 1U8JB 2E27L 1T22B 1N6VA 4KXZI 5IF0B 2X4OB 3F62A 4K3GA 5CJBA 1GIGH 1TTFA 4XVTH 1D5BB 4XC1H 5BRZB 3QEUB 3FB5B 1SJXA 3G5ZA 2D03L 2BNRE 5HJ3A 4HW6A 5GRVL 4CRPA 4QYOA 1FRGL 4CGTA 1S9VA 1UWEL 2VLJE 5DEFB 4QHKJ 3P9LB 1ZT1A 2IPKA 2VDPH 4WTWA 4U6HA 4RNRA 4XWGL 3BPNB 3P0VL 4KK8D 2IH3B 1UVQA 2HMID 4L8CB 4QTIL 3DIFA 2Z31D 5IEKA 1CFNA 2YXMA 1G7JB 4LLMB 1F90H 1Q9LB 3D85B 1T2QL 3EJJX 4Z7VB 1INEL 3EFDL 4XXCC 2FR4B 2YK1L 4PRDB 5JMOC 5IHUH 4P5TD 3UZVB 2EE3A 4Y4HD 4HK3J 3D3VE 3RNKA 1KTLB 3I6LD 2ICWJ 1RU9L 1LK2A 4DWHA 5M95B 5HYJD 3DVGB 5HI4D 3HI1A 4KFZC 2H1PH 1R5WB 1QBMH 5D2LA 2J8OA 5K93A 2DQUL 5JHDB 1Z3GL 1UCBL 1LP9F 1F4WH 1KGCD 4DW2L 3M45A 4NFDA 3JWDH 4CMMA 2YSSB 2NY0B 3SDXB 4KZEL 1WIOA 3LZFH 4KVNH 5E2VH 1KCVH 2ADGA 3KPLA 4IS6B 5ANMB 1R3JA 4PFEA 2ICWB 3FHAA 5BVPH 1M6OB 4CU6A 3KJ6H 3DRTA 5EIVA 3CDGA 4HFUL 4OLWL 5JQHC 3C6LD 1KB5H 4JANB 3V52H 4YPGB 2X9WA 3I6KA 3JVGC 1IC1A 4RFNC 5D1ZD 1X3DA 1Z9LA 3QDGB 8CGTA 2LV4A 2YRPA 3OB0H 3DV4B 4YHZH 3Q3GB 5EN2A 2QSTA 4GG8B 2H32B 3CC5A 5DHVH 1GL4B 1JGVL 3OAYH 4PP2A 4R97C 4FFYL 1S9WA 3W0WB 5T1KA 3NPSB 5EBLA 2IAMB 1EGJL 1ZWIA 1S3KL 4RFOL 4Y7MA 1NLDL 3U4BH 3U9PL 1T1XB 1C5CH 3O8XB 1V3LA 5HDQH 1N3NB 2DM2A 1GVIA 5DUPL 3VWJB 4AG4H 4HJGB 1X5YA 1OT1A 1AXIB 3VRIB 1IEHA 4L29B 4PG9B 4Z0BH 3X13A 3FB8A 3EKCA 4FRWA 1JNLH 4OIAA 4LKCA 1LE5B 1AI1L 5I30H 4PGZA 1I8MA 3VXUD 3QQ4B 2RJMA 5ALBL 4AIOA 5I1LA 4D9QD 4PUBH 1PD6A 1XR9A 3FO0H 3NFSL 3T4AB 5K9QI 2ARJB 4NC2B 3KXFE 4HIIB 5DZNA 4WEUD 2COQA 5JNYA 2N4IA 3CVIH 3FAXA 5GSVB 4NBYB 4Y5YB 2O5ZH 3GNML 4DCQA 5I18H 4L4TB 2IPTH 4Z7WE 3RPKA 3WIHL 3ARZA 2HFEB 3IGAA 3G6DL 4OCMC 4NOBA 2R8SL 1LEKB 1AD9A 1MOEA 1IGTA 2Z35A 2P45B 5DK0A 1J8HE 5CZXD 4ELMF 5IIEB 3PP4H 5L2KA 3P4LA 4LPTA 1NCDH 3TIDB 3SDDB 2ZWLT 3OKDB 3IAPA 3KYOA 1DZBA 5KOMC 5ICZB 1MFCL 1RZGB 5JOFB 3TIEB 2H9GB 3QUZC 2DMKA 4YQXH 2W1NA 5EU5A 4YHOL 3WN5B 3FT2A 1IRAY 4Y8AA 2IQ9L 3MRJB 4QHNA 2RIKA 5D7LD 1M7DA 3TWCH 1DQLH 4NDMB 3SDAA 1LEIA 5C0CE 3ZTJG 3BD5A 2PXYA 4OZ4B 5HXMA 3MLUL 5EZIH 2BCKB 4BQ9A 2HTKD 4F15C 5DJDA 1EX0A 2C4FT 1NEUA 3HZVB 5CKGA 4MHHG 2VDOL 4DGVH 3ELAT 2VE6A 3PGCB 5I1IL 1UYWL 4JFEE 5FGRA 5TF1H 5DD3L 3L3KB 3QA3B 2VIRB 5JOPD 4UOW1 4BFIB 4NN7B 4KHTH 2XRAL 4HMDA 5E9DE 4GW5B 1EEQA 2J7LA 2X4QB 3ARBA 4MQ7B 3QUXC 3LS5L 4UT6H 1IC7H 4QY8B 4TUOB 4PRPE 3M8OH 4QXUH 4P5MA 1RHHB 1HKLH 4ODUA 4NHUB 3TVMA 4M43L 4JY5L 2J12B 1A21A 4MXWL 2AABL 4GKZB 4OM0L 3P73B 4O2EA 4CU8A 1UG9A 1JL8A 4OIIL 5I74C 3VI3F 2UWEE 3KPMB 5SWSE 1Y6MR 3VXSE 4KC3B 2FZ3A 2WWMC 3FTGB 2DM4A 1ZHLA 2FBOJ 4NZTH 3WE6B 5D6DC 5D1QA 1ZE3C 4MQXC 4PRHB 5DR5H 1EGJA 15C8H 4D0BA 1VEMA 3RWHA 1CGWA 4LRNH 2ZPKH 4YE4H 5E2WL 3S5LG 5EBMB 2PR4H 3SGKA 4P2OA 1NDGA 2R0WL 3X12A 2WLZA 3MV7A 4PRNB 5E6ID 3AU1B 1AGCA 2VR9A 1GOGA 1CIUA 4HKZA 5DK3A 1KELL 3EUUA 1S7RA 4LOUD 4FZ8L 3K7UA 3Q2CA 4UUJA 1GRWA 4FQHA 3S36L 2E9BA 3RPIA 1JTPA 4YHMH 5E8PA 1Y0LA 2XV6B 5IM7A 1UQSA 4JFPA 4OT1H 3BQUB 1P4IH 4H88H 2VERN 3DROA 1QSEA 4NZDA 3NTCL 3BP6B 5K9JL 5D1XC 2CKBH 1IC4H 1ZT4A 2LVEA 5D7JA 1I8IB 3WIFB 3D9AL 3HC0A 3D0LB 1YN7A 3RDTD 3FT3A 1R24B 1S7TA 3SKOA 5EFIB 2R2CA 2PTUA 4Y2DD 5EOQH 3KPTA 2YA0A 3WO4B 3GMRB 3ULVL 4YK4B 3G5YA 4NQTA 1P2CB 1L4IA 2E6PA 4F57L 2CGRH 5JHLH 2VH5H 2R39A 1XIWC 3TO4A 1FGVH 1HNGA 2VLKE 3VI4E 1ND0B 5CKAA 2P7TA 5EU6D 3DVFA 5DQ9B 5GPRA 2NZ9C 4K8RC 2OTUA 1U58A 3BISA 2FGWL 2ZOKA 1EK3A 2NXYD 2ZJSL 2DQTH 1R5IA 3Q5OA 5A2JH 4X4YB 3EJYC 1OW0C 1NANH 2XN9E 3BAEH 3UYOD 3PABB 5FO8B 1UWGL 4M93C 4K8RL 2OTPA 4U3HA 4JGJA 1SEBB 2PYEE 5CUSH 2Z93A 3LQAH 4I0PC 2DI7A 3MXVH 1PGRB 2DWEB 4YIQB 4DQOL 2HRPL 4PV8A 3ROOB 4I2XE 3MRGB 2EIEA 3V4VL 3NCJL 5IB5A 2OJZH 4Q2ZB 4H8WH 1I85C 2BVTA 2A6KB 4OGXL 4U1HB 4G6AD 2Z4QA 2A2QT 1ZVSB 3FQTA 2YBRA 4IRSC 1G7PA 4FA8A 3ULUE 3L6FB 3WUWB 2ATKB 4NNYA 5FYJH 5HD8C 3SOBL 3CFJA 2EECA 5CLWA 4UZGA 5IHZA 1MJJA 4R8WH 3F7RA 3DXAB 2XPGA 3V6ZB 4TQEL 1N6QL 3JTTB 5JXAH 1XGYL 4J1UA 1FFRA 4PJ7E 1IVLA 2BRQA 4XCEA 5BRZD 3VH8B 3ECBB 4BKLB 1BQUA 4M7KH 1ZHKB 1NLBL 3GBML 3ZYOA 4Y16C 1VPOH 1JZ3A 1N0LA 4EOWH 5F71A 1BECA 5GSRB 3QT2A 4YGVA 1FDLL 1BEYL 1F3JA 3P11L 5AAMA 2WIIB 4OUOA 1MCHA 3AY4A 4N68A 1DBJH 2DMBA 5KSBB 2WLYA 2AJZA 2J6EL 4R7DA 1UA6H 5GZOD 3R0NA 5D5MA 3UTTE 5B39A 3D85D 2W91A 4X5WB 2ITDB 1XH3A 2AV1B 3MLYL 1Z5LB 1DLFH 1Y18B 2VXUH 3RKDD 1PQZA 4V3EB 4D0CB 3AS3A 5JPNB 4U33A 1AHWA 7FABH 1G7HB 3DRQA 4MVBA 3VFGL 3EYVA 4H5SA 3RVXC 1Q1JL 1Q9KB 2LU3A 2DLIA 5JHDD 2EXWC 2VXTL 1I7UA 1NFDA 3BPOB 2NY0D 4MDIA 3KPPB 1FFQA 3D39A 4PJAF 4KU1A 1S7SB 4OAWB 4PGBA 3MR9A 1FORH 1QLFB 2PNDA 2V2XB 2ZUUA 1VFAA 3AVEA 3WKML 3EDKA 5T3XE 1K8DA 4WUUB 5GGTH 5GRYA 4MWFB 1CICC 3RU8H 3T0EB 2VN7A 1HN1A 3HC3L 4NC1E 3CUPA 1IEBB 4EI6A 1XGUA 4U1SA 3L7EA 3MRNA 3BZ4A 4IRJB 3CLEH 2Y6SC 4YFEA 3QDGD 4PJEE 2VQ1B 1RZJH 2DOCA 1VDGA 3GO1L 1XGTB 3HZMB 5DURB 3SGEI 4WHTB 1IGIL 1UEYA 3TCLA 3HS0A 2IAMD 4FQ2L 2CR3A 2I27N 2V5RA 4S2SB 2JCCE 3JV4B 3N1PC 2YC1A 1MWAH 2EC9U 2F53B 1DBKL 1IC5L 4L3EE 3VWJD 4HK3N 1BLNA 5DJAB 5E5MA 1AR1D 4DN4L 5CHNB 1MCWM 3KLHC 1EH9A 2KDGA 2EXYD 1K5NB 5F89A 1A7QL 1MCPH 4PJCB 3QHZH 3BGFB 4DKEL 3IDJA 3DECA 3B9KC 3P4OA 4MJ5B 5I1GL 3HPJB 1XCTA 1AD0B 2EKJA 4HIJB 5IEHA 3D69B 5DGRA 4XNYL 1EAPA 3UTZB 5DF0A 4PV9A 4O58H 4LLWA 4PP8C 3O3DA 4NUJB 1ADQA 5C0BB 4L4TD 2B0SL 3TBSA 3MBXL 5CS7A 3KNBB 4OD1L 2GYSA 3FQUB 2NW3A 4TSBL 1NH6A 4GXUN 3G5VA 5DJZB 1OB1A 5F7FA 4HF5L 3U83A 3HNVL 1KB9K 5FB8B 4XVUC 3NPZB 4HT1L 1YMHA 3IFNH 3SDDD 5I1DA 4HKJB 5EUOA 5F96H 3F5WA 1KCSH 1RK0A 1FL6B 2P24A 1MCFA 4BZ2H 4QXGL 1TLKA 4OKDA 4DZBA 5BS0A 5CFHA 5D96B 1LO5B 1P7KB 1A7RH 2BNQE 4K71B 4WENB 2X4NB 3SJVA 1MREL 3S8WA 1EHXA 3IDMB 2L7UA 1BFOB 3WS6A 3IXTB 4AQOA 3OG6B 1OCWH 1G6RL 2BNRB 1TZIA 5J56B 3DETC 1KXQE 4S1DD 3WSQL 3MREA 2VLJB 1D9KB 1E4XI 1JIBA 3ZMRA 3W9EA 2IBGA 1J86A 4D9RE 1YJDC 1OT2A 4BSVA 1D7FA 3NN8B 4M1CD 3WFZA 1AQDA 2HLAB 5GGQH 5I1AB 2D7TH 3SDYH 1PJ9A 3CFIC 1FCGA 1SY6L 4QF1B 1NGXA 5IVXF 2NYYC 2P44B 1YJDL 4Z77B 2PKDA 1F8TH 2F58L 2AERT 3HR6A 4F2MB 2DLHA 3RWDA 4W6XB 3D3VB 1GAFH 4Q9CA 2Q7YA 4NJ9L 1T20B 5INCB 1EJ6A 1GJIA 5J11B 1ZEAL 4FNLH 3C87A 4OLUL 5A3IC 1FAIH 1CFVL 4N0YL 1MFNA 4ODVL 1U8NA 1ZK9A 1QO3B 1P6FA 1NDMA 2CLZB 4ZDHA 3GMQB 2C1OA 2W65B 1XF5A 3PDOB 5H94A 5MEPB 3MLXL 5TE6H 3MXWH 3CFCH 3OWEA 5FA4A 3AXLB 3CLFL 1Q72H 3LVEA 5EA0H 2YZ1A 3L1OL 5CIPB 2BJMH 1F58L 3MGOA 3TA3A 3CFKB 1UZ6E 2DQCH 2FJGA 3OR7B 1FL3A 2J8UF 5GRUH 2MJWA 2CK2A 3ZKND 4H1LA 4P3CL 2AJUL 3BJ91 4LSUL 4MD5A