1T0MA

Conformational switch in polymorphic h-2k molecules containing an hsv peptide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
278
structure length
278
Chain Sequence
b'GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
molecule tags Immune system
source organism Mus musculus
publication title The structure of H-2K(b) and K(bm8) complexed to a herpes simplex virus determinant: evidence for a conformational switch that governs T cell repertoire selection and viral resistance
pubmed rcsb
total genus 71
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t0mA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1t0mA01
3QQNA 1T1XA 1G0XA 2OM5A 4MD4B 4BSVB 5GS2H 4HKJB 5LGKA 4XP4L 1AHWB 5J06A 2DWEB 4BFBD 5JNYB 1JYWA 2W60A 2W60B 2A77H 4NOFA 3DBXA 2AV1B 3K2UL 4XX1E 2MPAH 2AI0L 2NXYD 5DJYB 2NTFA 1INEL 4MD4A 4RGND 3KYKH 3QA3B 4KMQA 4PJ8C 4AENB 2Y06L 4M7ZB 2IBZY 3RVVC 1XGYH 4TSBH 2FJGA 2IBBA 3QPXL 4GSDH 3V0AC 1G9NH 1N7MH 2BOBA 1WBXA 2YC1A 3IDNB 4CN6A 5D7IA 1OSPL 1XF5B 1XGUA 3IFPB 5EOTA 2V5TA 4U3HA 4XTRD 1WBYB 4A6YL 3KYAA 3DX8B 2A83A 2LU3A 3BXNA 4M4RA 2BXYA 1TCRB 4U7MA 5IFAL 1NAML 5B38A 4L8CA 3H7BA 4H1LH 2D0HA 1UACH 3H3KA 5J6HB 3RWDB 4L4TB 5BZWA 3BVNA 3MRKB 3P40A 4BZ1L 4MJ5A 1TLKA 1UKSA 1EJ6A 1NFDF 3SE9L 1FZMA 3IJSA 3F7VB 3D1MC 2B0SL 3KLDA 3STLA 3ULVE 2Z92B 4OT1L 1YMMA 4P5KB 1PFCA 3RWHB 3FB6A 3UPAA 2CKBA 4QT5A 4PIRF 1OAUH 3O6KH 4KROD 4QHKJ 1N5AB 5I1LA 5C9JB 3LHPH 5D93B 4JR9L 1MH5A 3KLAB 4Z95H 4LCWE 1G6RA 4U1HA 4J4PD 4RX4A 4WFGD 2C7UB 2FIKA 4V3DB 5F44A 4OZFH 1WTGT 1KT2A 5MEPB 2FL5A 5KS9F 3ILQC 5ID1B 1Z9OA 3BGFB 4JFDE 4XNZC 5T5NG 3MFGB 4POUB 5FUCC 2UZIH 3MJ8B 5TDPB 3ARFD 4OCYL 5HI5C 3HNTH 4G6KH 5B3NA 1MFBH 2OCFD 1NMAL 4WDIB 1RIHL 2W38A 1JTOA 1RUMH 2VO5A 1IGTA 4M6ML 5B8CA 4GFTB 1EHAA 5D1QC 5D7JA 1OP9A 5EU5B 1WBZB 5ILTH 4Y16A 4GAJH 1INDH 4HFWA 1XF1A 1G9ML 4IOFD 4OSUH 3P9LB 3V7MA 2Y07H 1I7TA 5EZOH 2IQ9H 4ZUWA 1XH3A 3SGDI 3RDTD 2V6HA 5C0FA 4PGEA 2Q7YB 2EC8A 3GSUA 4K3GA 3R8QA 5ITFA 2HTKC 2MFNA 1JJUA 1J88A 3HAEH 4NP4L 4MA3B 5GRUL 2AK4B 2R39A 1S8DB 3GI9H 3MRJB 4MNHB 2P8LA 4KK5C 5DRNA 4KQ3L 4R4BA 2NY5C 4V2BA 4M00A 2YD2A 1FNFA 3G5ZA 3RX8A 1RZGB 4J8RB 4NZTL 4GRWF 1B3JA 4GUPA 3RWGA 1AGCA 1P2CB 5F7NC 4R7DA 5E6ZA 1M7DB 3LEVH 5FKPB 1EHLH 1ZXQA 2GUOA 5IP4A 3U46B 3PWJA 1IKFL 3G5YA 3QDJB 3MLZL 4ETQA 1A0QH 4WIQA 5D6DA 3MGOB 4XNQA 5JW5B 5C70A 2BDNH 4JVWA 2B4CC 1PY9A 1MCSA 5DURD 3B9DA 3EOYG 2H2SC 3P77B 4X9GA 4HBQA 4PJFB 4F7TB 2CR3A 1DR9A 2VIRA 3RIFF 2YK1H 4YHOL 1K8DA 4JFYA 3RGHA 3V4VH 2Q87A 5I73C 1F90L 4K8RD 3DVFA 3RTQD 3RPIA 2UYLA 5E1AB 2YPLA 3MTRA 4P57A 5DFVC 4H1LA 1ORSB 5IBUB 4WI6A 2A6DA 4NQVA 1QLEL 5F6HI 4BKLA 5E6IC 5I1EH 5SWSE 1S7VB 4UNVA 4LPXA 4HXBL 3MNVA 1NMBL 1KLUB 4CRPA 4D0BB 3BX7C 1HHHB 4J4PA 4RX4D 4XC1H 5HHNA 3D69B 1YEKL 4U6VL 2IFFL 1VFMA 2CUIA 1T89C 3K46A 4XZUA 4YBLB 5IF0A 1YPZA 3LRHA 4P9HL 5F21B 1ZK9A 5HI4C 3MUY1 5FYJH 5FKAA 1UH4A 3TEUA 3OSKA 2YHGA 4Q7DA 3QI9C 5EUOA 4ZD3H 1BZ9A 1IFHL 2RR3A 1UKTA 3VFTA 4HUMB 1SYSA 2GQHA 3FT2B 5GJSL 1F4YH 2P42B 1BJ8A 1D5ZB 1C7TA 2EIZA 3JWNC 3HHRB 5KSUA 1DE4B 2XWBB 5BO1H 4HGMA 3AXLA 1H3UA 3E0GA 2H9GA 2B5IB 3RWIB 3RWEB 4MNQB 1OAXL 1VFAA 5ISZE 4LQFH 4YC2B 1ES0A 1JPSL 3G6DL 4KV5F 3KR3H 1U2HA 2JJUA 4PBXA 2CO6B 5I1GL 2R56H 1T2QL 4JHZA 3W39B 2AXFA 1Z0MA 1JPFB 4O2FA 1YEEH 5EZLA 1JMXA 5E08H 1H9VA 1F2QA 1A9BB 1WWCA 1TJGH 4QHMA 1QP1A 2YUZA 3PWNA 2ZJSL 3JTTB 3LRSB 2EYTB 3UDWC 4MJIA 4TNVF 4G6JL 3TT3H 3DGCR 2HTLC 3QFJA 1U92B 2IMMA 2AK1L 2WIIB 4NBXB 5EN2A 2JE8A 4ZUSB 5JQHC 3DXAA 2NZIA 3MJ9H 3OG6B 1J0YA 3OQ3B 1ZAGA 5D7IF 3D25B 5BVPH 1I1FA 4PJAA 3SKOA 1Z3GH 4GMSH 4X6FA 3ZDZE 3UTSE 1TNMA 3G08A 1RMFL 1RVFL 4YUEL 1HQ4B 5I0ZA 3WIFA 2IPKA 5I66B 4HCRL 1NGYB 5JDSB 1J87A 4KXZH 3R0NA 3MXWH 4CDHA 4JO4H 1YEJH 3DJ9A 4IIQA 5JHDA 1IGCL 3V0VA 1YN6A 4ZS6D 3KYMA 4MX7A 5HYFA 3ZLQC 3MLSL 4PLKD 1R5VA 4P9ML 5D7SH 1HEZB 1M7IA 2CKNA 2WLYA 2FR4A 4WTWA 1QLEH 1I8MB 3H9HB 1KIUA 1JN6A 4JGMA 1R5WB 3S4SB 1AGBB 1SHMA 3BHBB 4ODSL 1ND0B 1U3JA 1FYTA 2J2ZA 1U8KA 3OKNB 3VRLE 5C0JA 1CFVL 1EEZA 5CINH 4Z9KB 3BIKB 1VEPA 5C7XH 3O4LD 2EKSB 5F88B 5F3HA 4PRDA 2DQUL 3ARXA 2MQCA 2BOCB 4GT7A 2FZ3B 3EYSL 5DTFA 5C6WH 3CX5K 2NYYC 3CVHB 2QL1A 3V79C 3ZZ1A 4I77L 1AH1A 3MV9B 2ATPA 4TTDD 3UTZB 5KG9B 2DLEA 1IBGL 4OCWH 5T3ZH 2NXYB 4AIZA 2YEZA 4OFVA 3MOAL 4MS8C 1DQLH 2Q86B 4WCYH 4KMTL 1LO5A 3EDFA 2R2HA 2SEBA 4XH2A 3U0PA 1Q9OB 1TVBA 2CDEA 3RVXD 2H41A 4Y4HB 5T3ZE 1GYAA 4MAYC 4LVNC 5KZCB 3QPQD 2GCYA 4LKXB 2GT9A 1JYNA 4CMMB 5E99H 3EJYC 1CGVA 1J0ZA 1KIPB 1EERB 2JF1A 2VR9A 1BFVL 3VXSA 3CFKA 4GRLB 1BECA 4PJEA 1Q94B 5C0AE 4Y5XC 5AAWA 1NEZG 2ESVB 3JTSA 4XVSH 4IRJA 1J8HB 2Z8VC 4OTXL 4GW1B 1HIML 5E00A 3I2CH 3GIVB 3QAZC 5ETUA 32C2B 2WQRA 5LAXB 3MSPA 4P3DA 3UYRL 4LSTL 3NIFE 2VLJE 4MA7H 4IS6A 4PTUA 1YC8A 3WS6A 4ZFFB 2BSTA 1TETH 4JZJA 1G7QB 4P2QA 1UXWB 4PRAB 3SE3A 4D8PB 5EB9A 2AJSL 5I19H 2VLLA 4M62L 3L3GB 5EU6A 4ZUTB 2DI8A 4LCIL 3QP3A 3BUYB 4I0PB 2V7NA 1N8ZB 4GOSA 4OTXH 5CEXB 2IGFL 3BP5A 4GJTB 1MF2L 5TE4L 5DRXB 3RVTD 2ZNXA 3AY4A 5C09B 4JO3H 5BQ7A 4M6AA 4NNPL 2XPGA 4NO3B 1TENA 2VDRH 3QEHA 1XCTA 3MV7B 4OZFG 1ZHNA 1KENL 3SPVA 5KAQF 1MUJA 1IZKA 1YEGH 4XP5L 3E3QE 3MRFB 4AG4L 5DUPH 1T0PB 4NZJA 3MUGB 1R24B 1YQ2A 4N1EA 5GRJH 1ZT4A 3ROOB 1UYWH 4LVHC 2ERJB 2B0SH 1GZPB 1EAJA 1KB5B 2ZKHH 4IOIA 4PV9A 1LVEA 2R2BA 4WY7L 3MLVH 4JRWA 3CZFA 5A16A 1DEEB 1RU9H 1CF8L 4QCIA 5IROC 3ME0A 3N1PC 4JFZL 2DLGA 2YRZA 2Y23A 3UXFA 1X5GA 1V8HA 4BQ6A 1FYTE 3RL1A 3P0VH 3CSPA 5GGTH 2FX9L 2X4NB 2OS7A 1A3QA 5DFTA 4EEEA 3BP4B 5CILL 5HGBA 2XN9D 3MRCB 3K74B 3GJFH 1PZ5B 3TA3C 1FZOB 4H0GA 4TULL 1IFHH 4FZEH 4PGCA 4HK0A 1I85C 3MFFA 4PJHB 5JZ7D 1BJ1J 5E2JA 2C3VA 4IJ3B 4FMFA 3G6JE 1KPVA 3NCFB 4GBXB 3VDAA 3T3ME 3D18A 1WUNT 1XZ0B 4UAOB 4ZTOH 4UZGA 1U91A 5EFIA 4Z0XA 4CU8A 4HIJA 3P4NB 5F9JB 3DVGA 2EH7L 3C5SA 3MC0A 4L8SB 5DA4A 3MLRL 3ZTJH 1PG7X 1T4KA 4JO3L 4HWUA 3NCYS 4HIEA 3QG6B 1HH9A 2QADB 2Q20A 5FO8A 2XACC 4QTHB 4XBEL 4EI5B 2GTWA 2X89A 1UB6B 2NY5H 5TGBA 3BP6A 3MRQA 2QQLH 3QISA 3V7AG 2BRRL 3IDIA 1E4KC 3RA7L 3C60A 4MDJB 1A02N 5CIPH 3V5KA 3OX8A 3VXUD 4PGJA 4JKWA 1H0DB 4JDVA 2P44B 3ULSB 4X9FA 5MEQB 2DI7A 1YY8B 3VFRA 3S35H 1RAMA 1B0RA 3O45A 3BO8B 2BNQE 4HSQA 5DVKA 1D6VH 3V8CA 1FGNH 4N68A 4OQ1A 3GO1L 5GRVK 3MO1A 5DHVA 1U8IA 3SDAA 3RVVD 2BMKB 3V6OA 5TF1H 2PYFA 1BZ7A 4KV5E 2WBJA 3BZFA 2LTQC 2HJLB 3RKDD 4XXCC 1P6FA 1YDPA 1ADQA 1K6QL 3CDGB 3RAJH 2CRMA 4XCCL 3ULUH 4OZGF 1I1AA 1N64H 4G5ZL 4K3JL 1HKLL 4HF5L 1JCKA 2BX5A 4OGYL 3D0VB 1DDHA 2YN5A 4Z7UF 2X4TB 4HZLB 3EYQD 5DD3H 5DSCA 4Z7QE 4MS8A 3QZWB 3TJEL 4LLWB 1IEHA 1T0NA 2X4RB 1PG7W 3C08L 4YEEA 1ULVA 3FTGA 1WZ1L 1I9RH 1OB1A 2OMBA 3GSXB 3IXTB 2LV4A 1H3VA 4G9FE 3RZCB 4I3SH 4D9QE 1KTLA 2CIIB 3I3BA 3ZL4L 1HK6A 3WUZA 5HD8D 3HE7A 4ZO9A 5DFWH 3LEXA 3WSQH 2DQGL 3WNOA 1C8PA 1I9IH 2PO6C 5IM7A 3ZKXB 3F58H 1G0DA 4KK8D 1R3LB 1UJ3A 2C1OB 3TYFB 3MJ6A 5CCKL 3RWCB 1A6AB 3FT4A 3C5ZB 2HT3C 5K9KA 4K94H 4R7NA 2NY5L 1KJ2B 3BJ91 2YD1A 3BKMH 2ZSVB 5JW3L 5EZJB 5CEZE 2YOCA 3IJYA 2DQIL 5DHYA 5D70L 4RDQG 1CDYA 1YJDL 5D7LE 3BRGC 1U95B 3HZYA 3I84A 5D8JL 4XVUD 2E7CA 2XICA 4NHCL 5JOPE 3MCLL 4QOKA 1TXKA 5FGCB 3WIHA 3OKOA 1A7QL 1TVHB 4JRXB 4NBZB 2HG5B 4N1HB 1VEMA 5IVXE 4OCNC 1JWMB 4YDJB 1ZGLB 4JCMA 2XRAL 4Z7UE 5BMFH 4OBSA 3SOBH 3MV8B 1KENH 5ID0B 2FBJL 2ENYA 1PKQB 4M8VA 4OCYH 1AC0A 3X12A 1I1CA 3V4PH 3QUMH 3TZVB 3IDYB 1A4KB 4P23C 3AMLA 3WDJA 3MMEA 1F4YL 4G8FA 1UACL 3B8YA 3MUZ1 1F97A 3QXUA 2VZUA 4LLDB 2E9IA 1JF1B 5BW7A 3VXTA 3KPLA 4OCXL 4YDVA 1IGYB 3T0EB 3WEXB 1UM4H 5FA4B 5DUMH 1GGYA 5HHQA 4JAMB 2QV2A 2FJHA 1ZS8B 3C60D 2JJSC 4QLRA 5HHVH 5CAYB 1D7FA 4UOW1 1OP3K 4N0RA 4EJ1C 1M1SA 4PUBL 1G7PA 3VD9A 4OLUH 1DBAH 1MWAL 5J12C 1SYVA 3ZYIA 3W11D 1UVQA 4R96A 4RMSA 1QSZA 1ROWA 2NY2C 3HC0B 1IAII 5JXAH 2D31B 2OK0H 5KVEH 4HWZB 4I18B 3QNXB 3DGGB 4MJ2A 1FO0A 12E8H 4CNIB 1H5BA 1ADQH 1Y6MR 1S7SB 5FYKE 3O2DH 3QXDB 1T22B 2LVEA 4LHUA 1D9KC 4K94L 4NDMA 3VXNA 4QY8A 2WUCL 4BFEA 4G6KL 1FNAA 4KDTC 1K3ZA 4XAKD 1FORL 3TT1L 5CSZB 3WKMH 5B39B 3QIBC 3SJVE 1BBDH 4S1QL 5BS0B 4KVNL 2XZZA 3O2VL 5J7CC 3D2UB 4HAFA 1S7TB 3PG2A 4MB4A 2CSPA 1J1XH 3L5WB 1SJHA 4ZD3L 1CICD 5HVHB 1MNUL 4N0FB 3UPRB 5EBGA 4E41D 4G8GB 2ED7A 1HQRA 1P1ZA 2FO4B 3MGTB 4HJ0D 3VFGH 3IDJA 1HILA 1MVUB 4Z95L 5DC0A 3BPNC 4BH7A 2LE9A 1D6EB 1DVFC 1T1ZA 4FQXA 1YEKH 4U6VH 1S9VA 3Q1SL 1T21A 5C08A 1EV2E 5IW3A 4DCQA 4PJCB 2QHRL 5TDNA 3WV0A 1OSZB 5DWUL 4Y4FA 1LGVA 1LEIA 3MBXL 4K2UH 4QRRA 3LKNA 1MCFA 4NN6C 5E2UH 1RZKC 1T83C 3J7HA 4GRWH 2C4FT 2VZVA 3TP4A 4X5LA 1FNGB 3VXRA 1EEUA 1CFQB 4HUNB 4FA8A 1MHEA 5ALBL 4ODSH 4E42A 3WHE1 5DEFB 1NGPH 2J88L 4KK8C 2FX7H 3EW3B 4NOBA 4ZQKB 3ARUA 3GO1H 3V5HB 4YIQB 3MLVL 1INQA 5DHXB 1MI5A 3QPXH 4ZQKA 5E7BA 4HS8H 5GS0H 1KTDA 3RU8L 5IGXH 4ZTOL 4PBVC 4V2CB 1NL0H 4LOUD 4KDTA 5E4EB 3QR2A 1SBSL 4LVHB 3KPRD 1CTNA 1ZA6B 4FQ2H 4QHNB 1S9KC 1RZIA 3VXRB 2K9UA 4PRIE 3QI9A 5E8EB 1VKXB 3OJMB 4YUEH 5JA8B 4WCYL 4XVJL 3G04B 1PDKA 4Y4FB 3ZYOA 4ZOEA 1OSZA 4Y5YC 4A2MA 3QNZB 4DCQB 2UV3A 5FV1L 4Z7WE 5DK2A 1L8JA 2C3XA 3N1FC 1S9VB 1NDGA 2X44D 1T1ZB 3QIUD 1YNKH 2ITDB 3A67H 1K3IA 1XGPB 1MCHA 4KRNA 4NQED 4NZTH 2BHYA 2BVEA 1LO3H 2FECI 1VFOA 1P1ZB 3MGTA 2FO4A 5H2BA 5HDOA 2CLRA 4JPVL 4LCWB 3LN4A 1N26A 3VGFA 1S7TA 3H6JA 3K8MA 4PJDF 2VDNL 4LFHG 4GO6B 5GRXG 3X14B 5EIQA 3QFJD 3L95B 4KC3B 2YA1A 5B39A 4KKBC 4S1RL 5C0RH 4JFDB 3K1DA 4N0YL 3O41B 2EKJA 5FYKH 5E4EC 3KWWB 1JZ2A 1Z6JT 1CK0L 1IILE 4QY8B 5FV2A 3VXNB 2F74B 4GAYA 3I6LE 3QXDA 5LGHH 5CZXC 3HPJA 5KN5A 5GRZA 1FZJA 2Z93A 4ZS6C 3DRQA 3SGJA 1FO0B 5DJ0B 3DGGA 5HHOD 5JORB 1F58L 4HGWA 3HC0A 4UOJA 3QDGD 4XMPL 2J6EH 4R96B 1UVQB 1YUHB 1S7WA 3D5OF 4HKXB 2AEPH 1SYVB 2D7OA 5J9PB 1RY7B 3G6AA 4EZMA 3BPLB 5J1AA 7CGTA 4X5XB 4XBGB 4DGIH 3NVQA 4MLSA 5HHQB 5CJOL 3WJJC 4OIBA 2M1KA 4OB5H 1U58B 2PTTA 2F53E 2VR5A 4YDVB 3UC0H 4GXUM 3QIWD 1ACYH 5HJ3B 8CGTA 5D5ME 3HE6B 1Z9MA 4A2LA 5H94B 4OAWB 3GSRB 3EJYD 2V9QA 4O2CA 4G8FB 1J0HA 3RWJB 1LQSR 4X8XA 3B9VA 4Z0BH 2BVQB 3B2VL 2IPTL 4M5YL 2ZCLH 3IDXL 4MD0A 1PKQA 4OD3H 1YEEL 5ID0A 1I7RB 3D3VE 3FFCB 1I3GH 5FK9B 3U0WL 3G5VB 1I3UA 3WHXB 4KQ4L 2DQIH 4UU9A 4IRZH 2HG5A 3WFEL 1FNSL 5LQBL 1BF2A 3F6IA 1C5CL 1NGWA 1ITCA 1DJSA 3QXTA 3N06B 2EYRA 1A3LL 1U8PA 5JHDD 3MX0A 5F7FA 5JW4N 2CR6A 4JG0H 5EORL 3P11L 5ESVA 4KKAC 3T4AB 3IJYB 1U8LB 2Q76A 1EMTL 1I9IL 1CT8B 3REVA 3FQTB 2VLRD 1E0OB 4UUJB 1D5BB 3BD3A 9CGTA 1RHHB 3QEQB 4W70A 1A6AA 3FT4B 2ATKB 1R3LA 2XQYG 4LLQB 4DQOH 4WHTB 5IM7B 1QFWM 4KI5F 3LEXB 3TJHC 5DDHA 3WNPA 2I07A 4U1GC 1A7OL 2EDRA 1KTLB 4XVTL 5K59E 1HKLH 4OGYH 3OF6A 1A1MB 3GBLA 4UILL 1NGZB 4KK9D 5IK3A 4YGVA 1LMKA 1BD2E 2X1PA 1X6LA 4NN5B 1MFNA 3QUKA 5IR1B 3QDGB 4KI5E 5I8EB 4FZ8H 1U2CA 4JY4A 1WIUA 3O11B 1CE6A 1DDHB 3D0VA 3W82A 4J3XA 3RJQB 3C6SB 4G7VL 6FABL 4CL7A 2J8HA 2QQKH 4GG6E 1FVDB 1MSPA 1KELH 3U4EB 4LLUA 4QHLB 2BY0A 1ZA3A 3KPRE 1A6UH 1QBAA 3CDFA 2IMNA 5C07B 2HJLA 4XMLH 2X89D 3KHOA 3QRGL 3RKDC 1TZGL 2DLIA 3QQ4B 4XI5D 3VJ6B 2YMXL 3TNNB 5DS8B 4GAGL 1VGEH 4B50A 5I8OH 1R0AL 3K1KC 5D7KE 1K4CA 3VFRB 3BGMB 4U6YA 1T20A 4PG2C 4Z78B 3UBXA 5D9SB 5MEQA 1HXYB 1FFNB 3JWDH 4YFLF 1KV3A 1MCCA 3QIBD 5DJDB 1H0DA 1TTGA 3EYVA 3CSBA 4APQD 5GJSH 3EJZC 4RA0C 4JPKL 2MCG1 3C60B 4MDJA 3IDIB 3MA7B 4K7PL 4KHXH 5TH2A 4HS3B 2XA3A 4AMKH 5HHPA 5E2WH 3BP6B 4HT1L 4ONGL 2BCKA 4XP1H 1G1CA 4QTHA 4X7CC 4ZAKC 4GXVH 2CKBL 4RNRB 4KPHH 4DGIL 3Q6GL 5DT1H 4PGBB 3ARBA 3OKLB 4QHUA 2ZG3A 1T4KB 4V3EB 1HXMA 1MCBA 2H8PB 5CGMA 5F9JA 5FB8A 1Q9LB 5IV2A 5IROA 4Y2OA 1UC6A 3KS0H 1U91B 2P5WE 5E8NA 3TH3T 3U9PL 4BK4A 1Z3GL 1V7NL 5KVDL 1MIMH 4FQJL 4F7CB 3KGRA 4IM8A 2I25N 4IMLA 2A9NL 4KXZI 4L1DA 3VI3E 5CILH 1RIUL 2ADIA 2H45A 4F15B 3F65A 3ARDA 3WNLA 1CDJA 4HMDA 4WHYG 2XFXA 3MFFB 4RMVA 1CVRA 5KVGL 3QO1B 1WQVT 3VMPA 4GS7C 4PRBA 1HI6A 5ENWB 3T77A 1MCPL 1WAAA 1FZOA 1X5HA 4KDVA 2IH3A 3MV01 4G8GD 4AEHL 3JUZA 3PGDB 4P23D 3VI4E 1BFSA 1ZT7A 1ZLVH 1BGXL 4PJ9B 2FLBT 1BVZA 3HRZB 1T7WA 4YNYA 2CUMA 2EYSB 2G75B 1HZHH 3OWEA 5I8KH 5D7LA 3RL1B 1A4JB 3WD5L 2JJVA 3J8F7 1FL5B 3U9UB 4JZOB 4PJIB 4U1SB 4YFDB 5LCVL 5D1QB 1CFSB 3S97C 3DUSA 2VZOA 1JBJA 3VXMA 2P4AB 3TGXA 3MV9E 4Q74A 5EDXA 4PV9B 2FWOA 4NNYA 4JFED 2XNAB 5J12B 3VDBA 1EAPA 3SDAD 1R24A 3OF6D 1RHFA 2PXYC 1PEWA 5F89A 1QFHA 1U8MB 3MRFA 3B43A 3D85B 1HSBB 2YZ1A 3P73A 4P4KC 4D3CL 2QTEA 3QCTL 4ALAH 3NCMA 2WWKO 1KACB 4ZOBA 4Y16D 1NCWH 1O0VA 5JW4R 1BAFL 5C09A 2O5XH 1JMZA 2F5BL 3O6LH 2V5MA 4YHIB 4NC2B 5DRXA 1V3MA 1IGJB 1U8OA 3BP5B 4U4BA 3IETA 1CDUA 3MROB 4MMXC 1N8ZA 4I0PA 1G7IA 2F9BT 3D39A 1J8HE 1MVFA 4ZUTA 4PYGA 4JHBA 5F7DB 2FX8H 3LQAH 4F57L 1X5AA 3SDXA 1KBGH 1E6OL 4MJ6A 4P2OB 4ZXBB 3P3YA 1RZKL 4PJXF 4JB9L 5E94A 4UT9H 4ELKA 1IM3A 3IDGB 3PE9A 1KJMB 4JKPH 4IS6B 4HEME 3AM8C 4OD2A 2VISA 2H26B 1J10A 1DFBL 2DM4A 1IC1A 32C2A 3BZEA 5ETUB 5IVNA 5EC1B 4OZIE 3DX7B 4TUOB 4X6DB 2Z4QA 4JR9H 3JTSB 3IDMB 4NO0D 3IAGC 1CQKA 1CLYH 1Q94A 2NY0B 1B9ZA 4QEGA 1EFXD 3LN9A 3UDWA 1I3RA 2CMRH 1IAIL 1UM5L 1M4KA 4JFXB 4LKXA 2V9TA 2CUHA 1IKFH 3MV7E 3U7YL 1WAAF 1JI1A 3CXDH 3GGWA 3SQBA 1OTTD 4P5TC 3VW3H 3UTTA 1F00I 3T0DA 2P24A 2BSSA 4MCZA 1GAFL 3VXOA 4ZYKA 5HVFB 4L4JA 2C1PA 2Q86A 2X1XR 4LKCA 4Z7WA 5D96C 4D9QD 4N0YH 5F7HA 3V6OC 1JVKA 2FD6L 3RL2B 1QFWL 4U49A 4APQC 4JFHE 5DTFB 4HHAB 2OR7A 2CKBH 2VLJD 4GXVL 3HLAA 4OFYA 3HNSH 4PLJC 3W0WD 5F88A 1S7XB 1FVEA 4GG6F 2UZXB 3BIKA 1EBPA 5TF0A 4HV8B 5DRWB 1QG3A 1U8KB 1FYTB 1W0YT 2XTJC 1ND0A 4LPTA 3HAEA 4BZ2L 1R5WA 3O0RL 3S4SA 1KEGL 5CMAA 4KWUA 2ARJB 4XNUL 3H9HA 4GRWE 2NCMA 2P48B 4JO2H 1RJLB 5DJCB 3NBNA 4BH8B 2CLVA 3QFDB 4WI8A 2B1AH 4H8WC 3KYMB 4X83A 1P5VA 3GJEB 1OM3L 2DQFA 5JHDB 5GGVY 1NGYA 5JDSA 4U6XA 1HHJA 1OGAB 4B41A 1I4FA 3HS0B 2ESVD 2BVUA 4M5ZL 5FFLA 4K9EH 3GBNL 1CDHA 2AKRB 2FHBA 4X6FB 1JGEA 2FYYB 1GPOH 3DMMA 4OLXH 3ET9F 1KB5L 4O5LL 2Z31C 5HHOE 5C0CE 1MLBB 5EN2B 1IC4H 1JWUA 1VGKA 4MB3A 3F62A 3GKWH 1OLZA 1UT9A 4JY6A 3HPLA 1VPOH 4NO0B 4ZODA 1XIWD 1KXTB 4S0UC 1IL1B 5T1MB 3LRSA 3JTTA 2D0GA 4QHMB 2XZQL 3ARZA 5ICYA 1XR9B 3DHJA 4MQ7A 4V1DA 3UTQA 4Y0GA 4Y5YB 3L6FA 2H2PD 1BVKB 1A22B 3QB7C 4XP6H 4LDOB 1FSKC 1P4IL 3O81A 1DQQB 3LEYL 2BNQB 3V6OE 2QADC 4LF3A 1LE5B 3JVGA 4XPTH 4KJWD 3CAFA 3TPKA 1J5OH 4TSBL 1ES0B 4O58H 2BNRB 5A40E 1AD0A 5BRZE 3WS6C 4TNVK 1CFTA 2VH5L 2CDGA 2IWGA 1JHLH 1U41A 4P2RD 4ELMA 1O7VA 4S10A 2D7MA 2AJYL 4P46A 4Y16C 5CZVH 2B4CH 3SO5A 1LILA 1F4WL 1DE4A 5KSUB 3BFOA 3KPSB 4PRPA 4X8JA 2EIZB 1D5ZA 1SMOA 2XXMB 5CFHA 3FT2A 5DK0A 2X70B 4R4FL 5I1AA 4WU7B 3RGVC 1QBML 3GI8H 1J8KA 2DDQH 5FKAB 5HYJE 1Q9KA 2Q6WA 5IJKC 1IEBA 3U0WH 1M7XA 5D7KD 3NH7H 4J3UA 3VGHA 4YBLC 3UO1H 2NR6C 1YPZB 5I1EL 4LSVH 3W81A 1SM3L 5KVFL 3U7WH 1IARB 1N6UA 5KJRH 1LDPH 5I74B 3BMVA 5HHNB 3P9WB 4NKDA 2EDKA 2D9CA 3HRPA 4D0BA 5GSRA 3BIAX 1YMHB 4RWYH 5EORH 5GGRB 3CC5B 3W11C 3T2OA 3D39D 4FABL 3FRPA 4HFUH 4BKLB 4NQVB 4XCFH 1JNLL 3CUPB 1F90H 3R06B 3EFDL 4ZTPL 5K9OA 3VI3F 3WBDA 4I0KA 3ZHKA 4P57B 3E2HB 4FNLH 1LEKA 4Z5RA 5HHXL 4ODUA 3SY0A 3AC0A 1JPTL 3O4OC 4WWKB 4RMWA 3BDXA 2D4DA 2XTJD 1F6FB 3FJTA 2IQAA 5I1KH 2D7TH 3IJHA 4MJID 4L3CA 2WV3A 2E6JA 5D72H 2IPTH 4FTVE 3ARGA 2RQ8A 3C6LA 3B2UD 2VXTH 4KJPC 2I9LA 4RMUA 3LB6D 3MV11 3SKMB 5JW5A 4EI5D 5GHWH 2P1YA 1RUQH 1SBBA 1MCRA 4LVOC 3VRIA 1JI2A 5FKPA 3Q2CA 4NUJA 4R7DB 2CK2A 5I71B 4TVPH 4KHTH 1CFNB 4UTAH 4C58B 4QRSB 4FQIH 5GS1B 3GSVB 5A2FA 5DD1H 3QDME 2ZOKA 5I1JL 2AJXH 2G60H 1A3LH 2V2WA 2XQBL 5I1DA 4LEXL 1S7UB 1D5MA 1OAKH 2Y07L 2ADGA 4OSUL 3QFJE 3QRGH 3MV9D 4LCYB 5ITFB 2AS5M 3BT2H 4OCRH 3NACL 1HH6A 2Q7YA 1P7QA 3MLUH 3ZE1F 4XGZA 3DTXB 4D94A 1WZ1H 3WFBL 5D6CB 3ARDD 2E27L 4ZUWB 2XI9A 1PG7H 5J3HC 1A64A 1QNZL 1A6PA 3QULA 4JO2L 5EU6E 3DV6A 2VDNH 4MNGB 4P4KA 4APQA 4HFWB 1P6AB 2NQCA 5A1AA 1IGTB 3CSYB 1W72L 1UCTA 4WDIA 4QF1A 3ETBF 3FOMA 4KHXL 4K9EL 1VEOA 1YY9C 2VYRE 3HI6H 3NFNA 4WFFD 3FAWA 1NFKA 2NY4B 2QEJA 4ZO7A 1MHHA 2DF3A 4HMCA 5HY9B 3S34H 3KYOB 4MGXA 4MMZC 4G6ML 4G80B 4P2OD 2FIKB 2ZUVA 5TF1L 5ESAB 5KW9L 1G7MB 1JF6A 5I17B 1I7UB 3BWAA 1MH5B 1FL3B 3KLAA 4M62H 3LQAL 4F57H 4ZNEA 2HWZL 4HWBL 4OZHE 3O3EB 4ZO6A 5CEZL 4FQHA 1E27B 2CKBB 5EOCH 2VL4A 2YUXA 3NA4A 3RWHA 1JV5B 4U7KA 1A7RL 1I1YB 1S5HB 2HRPH 3STLB 5CJQL 1ED3A 1AE6L 2I26N 4J12A 4DZ8B 4DFIA 5CSBA 1QRNB 3HNVH 3JWOC 2A6KA 2A9MH 4JRYB 4Z77B 2J88H 3S5LA 4K7PY 4L4TA 3NCYP 3AFLA 5DVOA 5FUOL 1JZ6A 3QQ3B 5LBSL 1YEDB 2JB6B 2Y06H 1L0XA 4ENEC 3BXNB 3VXMD 2HFEB 4U1JA 4NIKB 3ARGD 3GK8H 4YC2C 3HI1B 4U1IA 5I15L 5KTEH 4WUUB 1Q38A 5D7IB 1UWEH 1EA9C 4FFZL 2UWEB 2OMNA 4UILH 4WUKL 2FJGB 4HDIB 1DL7L 1DBJH 4X9IA 3HFML 4CVUA 3IDXH 2ZCLL 3FT3A 3QA3A 3L5XH 3GFUA 4BSWB 5C0CA 1T6WA 2NTFB 2AVGA 2Z91B 2AV7A 5D2NA 5C0DA 2AV1A 4KKCC 4I5BA 1BQHA 1E6OH 3OL2A 3R1GH 1ACYL 3VH8G 1QFUH 2VE6A 2EO9A 1ZHKB 3BAEH 3TPUA 5I16A 3TPUE 1KCSL 1T1XB 5DZOA 1A6ZA 3SCMB 4FXGA 2VL5B 1JPGB 1KLGB 2OJEA 4FQ1L 5L8JB 4U1NB 1A3RH 2VLRE 3LEYH 1TQCC 3LKRB 5TJWK 3OR7A 2R0WL 2NXZD 4Y4KD 2A0LD 1WCBB 1QA9B 2BHZA 4KZDH 4OCSL 1MHPH 5JOEA 1CDGA 5E9DB 2WLZA 5JQ6L 3I6GB 4F8QA 5EO0A 3LKPA 1WSST 5E2VL 1KFAL 5EBLB 2DRUA 1WC7A 3G9AB 2X40A 2UY6A 2XWTA 1JFMA 3F7RA 4JM2F 1CDBA 1YEIH 3W9EA 2H2PC 3OMZA 3C8HA 5CWSA 5FYKL 2Y36H 4LGSB 5E8OB 5IB5B 5C0BE 5TQ0L 1YEJL 5HYSA 4JN2B 4HWEH 4WV1B 2APWA 3PQYE 5CP7B 3Q1SH 1DQJB 5FDWB 1SEQH 3OGCA 1D9KA 1MPAL 5ISZD 2GJJA 1DUYA 5ERWB 4WW2C 1J1PL 3ARBC 4MQSB 2EEAA 2OZ4L 3WYRA 2ZUSA 4MWFA 2RGSA 3PHOB 1OAYH 3FOLB 4JRYD 2H32B 3DVNA 2PETA 5HGGS 3U1SL 4X7SH 2YXMA 1N3NB 4KGLA 1AJ7H 4TOYH 4AIXA 4NQSB 4ORGA 2Y36L 4TUJA 3VXUB 2HMID 1QRKA 3F58L 3X3FL 2YWYA 5IMMB 4F7MB 1WCQA 4PJGF 5DQDL 3KJ4B 1ZLSL 4M4PA 4JDTL 1DP0A 4S1SH 2GTZB 1FRGL 3I85A 2HTLD 3F7YB 2XA8L 1VADB 3D3VD 1WZMA 1E6JL 3JV6A 4XPBH 5KZCD 5MENB 3NZHL 2PW1B 1MJ8L 3WO4B 4M6OL 5E0QA 4FG6C 1ZWIB 1DBBH 2AXGB 3AREC 5EIVA 5IVXA 5HI5D 2LU7A 2P8MA 3G6JA 4POZD 5SWQB 4J4PC 2AXJA 1S9YB 2DQEH 4FZ8L 4U31A 4F3FB 1FPTH 4ONGH 1WF5A 4KK6D 3ULUL 1LO3L 1U93A 4BA8A 2FEDC 4UINL 1GC1L 3ILQD 1HSAA 3PDOA 1R3HA 2A9NH 2XWJB 1IAOB 4YHML 2CDFB 3M07A 1TVDA 3G5XB 3GSQA 3MR9B 3AU1A 5FDYA 4F2MB 5C3TA 5E9DD 4LL9A 2VLRA 1V7ML 5B21A 3QXAA 1R0AH 3WNMA 2FBOJ 3QO0A 4YHYB 3DUHA 4TSAH 1QR1B 4Y2DD 3TO4D 1MI5D 3BMWA 3CMOH 3VFUB 3TJEH 3BW9A 2IPUK 3EHBD 1OARL 4R26L 2R2EA 5B4MD 4NZUH 3FB5B 1FVCA 4N1CA 2F5AL 5BXFB 3LKQA 5L9DH 3X13A 1J8HD 5IB2A 3NGBB 2X1WL 4EQ3A 2R0ZH 2C4FU 3OAUH 5KSAA 2X5PA 2MSPA 5DK3A 3JUYA 3TIDB 2GSIB 1UZ6F 4WI7A 1SJVA 4UT6H 3T4YA 4OV6F 5KJRL 2VXUL 1JZ3A 2G2RA 4K71C 3VGEA 1T5XB 5IFHH 4X0KA 1I9JH 4JVPA 3FONB 2EDNA 3D0LA 1EEYB 1FL6B 1KTRL 4GKZB 5DYOB 5FYKU 3QAZB 4PRNA 2EDJA 4K7PX 5C0AD 3EIFA 4PJ8B 4LIQE 4H20H 1NBVL 1I9RL 4FQPA 3NN8A 1GHFH 5KSAD 3CFDB 1MJUL 3HZMB 5IWLC 3V4UH 1OD9A 3PDDA 1MRDH 4HJGB 4K94C 1A6TA 5EZIH 5H37H 3MBED 4N9GB 4Z7VE 2A2QT 1BBJB 4ODVL 5DMGD 4YX2H 5E6YA 5MHSD 3V4PL 4U0RC 4PY7A 3Q3GB 1YPZF 4EUPA 5J56B 2VITA 3P11H 2I9TA 5L8LB 1K9TA 2VABB 3DXAD 5I30H 1G1YA 1NC2B 4OZGE 3NZHH 2L0DA 4I3GA 3O6FC 1DBKH 1FYHB 1I75A 2Z31D 4NHCH 1HHIA 3HG1D 3MZTA 3IS1X 4MZ2A 5C0GA 5EO9A 3NIFF 3Q3GA 2DYPD 4XCNB 1MRFH 4N9GA 4UOW0 5CJ5A 5CP3H 4FQLH 4XNXH 1S7RB 1DSFL 1GPOL 3RZWA 2IPUG 1JPST 3QCVL 2VXQH 4P59L 3HZMA 1CXEA 4XBEH 1IE5A 3AVEA 4ZPTB 3BH8B 1UB5A 3SDCB 4CU6A 4PJ8A 4O4YL 5SWSA 3FCTB 3P30H 5EOQL 5DYOA 1OTTC 1FL6A 1FIGH 4NBYB 5GS1C 2GITA 5T5FL 4U1MB 3TBWA 5IHZA 5DJZA 2AJSH 3MBEA 4FFEX 1BFOB 4NPYB 5DD5L 5C92A 1TZGH 2IANA 3DETC 3VXQB 1B2WH 5C1MB 3I75A 4LSSL 1U8NA 4IOSD 1FO0L 1VSCA 3IB4A 2RAMA 1EMTH 4OB5L 3ECBB 5L2JB 4HQQL 4AY0A 3FFDB 4Q0XL 3MRBB 5ADPL 3T2NL 5D1XD 1FFPB 2GY5A 3VXME 4X7DC 2FRGP 3LKQB 5BXFA 2EDEA 3MNWA 1FZKA 2R2EB 4ODHL 1IT9L 3EDDA 4JN1H 1QO3B 4IDJL 4N5ED 3ILPA 4PRHD 1NFDA 4F58H 2HJKA 3QUZB 1NLBH 3O4LA 1VA9A 4PJ7A 1BFVH 1K4DA 2KDGA 3QDJD 1L9MA 4PJAE 4RGOL 3QXAB 5INCB 5CJBA 3S35L 3O9WC 4HJ0C 4WGWB 1T7YA 5EU7E 3DXAE 3GSQB 3G5XA 3X3GL 1IAOA 2XWJA 1UXSB 3DETD 3VG9C 3MRDB 4KGJA 2BDNL 5FUZL 5IB4A 3PDOB 5LJYH 1F4WH 4PTTA 3VFGL 5KS9A 1LP9F 5JOFB 4NGHH 2P8MB 1WWAX 2Y72A 1OGAD 4R3SA 5GIRA 2DYPB 3WIHL 2K7QA 4LSDA 3C8KB 3SN6N 1Q0XL 2PW1A 3UZQA 5I15H 1DFBH 3A67L 4YXLH 3TNMA 1QLFB 3CDCA 4W68A 2GTZA 1LP9E 3PP3K 4G7YH 3FMGH 4Y1AA 4OQTL 3ULVH 1DANT 2R1YA 4FFVD 4I4WB 1N59B 1RUPH 5D1ZA 2B1HH 3AMKA 3PXJA 4ODXA 3VXUA 3KYNA 4HIHB 4K3DH 4QRPA 3MYJA 5DR5L 5J11B 2PW2B 3PGCB 2EDQA 3EDKA 4NRZA 1KIQB 3N9GH 2H32A 4WW2B 3RU8H 2YD7A 2DMCA 4YR6B 2O61A 1OAZH 3PHOA 3QG7H 5HYSG 3C2AH 4MWFB 3P4MA 4XT1C 2GFBA 4UI2A 5J6GA 1K5NA 1JWSA 5SWZB 3ZKSD 1KB5H 3WNNA 1CTOA 3ZHDA 1NGQL 4N0UA 1RJYA 1SVCP 1HIMH 2WBJC 1VACA 1KJ2H 1XGTA 3FMGL 3WUWG 5ERWA 4L3EE 3BISA 1EEQA 5IKCA 4GQPH 2YD6A 2J8UF 4JPIB 1QPXA 2VLKA 3DURA 4XPGL 3FN9A 5CP7A 5D1ZD 3TH4T 5AD0A 4M3KB 3H3PH 1NBQA 5E8OA 5GGSA 5IB5A 2BRQA 1IAMA 1U8QB 2BC4B 4GG6A 1OTSD 3TJHD 1N4XH 4NQDD 5HI3D 4AH2A 1EUUA 2DD8H 4HCRH 3TZVD 1ADQL 5EBLA 4XNYH 2P7TA 3VFNA 3GDBA 1EHNA 3I6GA 1KEGH 3U0TB 1AD9A 2VQTA 4QXGL 4XRCA 1HYSC 4K9EC 1NL0L 4Y7MA 3QWRA 2HVKB 4DZBB 43CAB 2AJVL 1DQMH 3PWPD 5ICXA 1HZHL 4OKVA 1VFUA 3HZVB 3CPLB 2VJXA 1BX2B 2X4OB 2ADJA 1JPGA 1NGPL 2VL5A 2E8ZA 2F8VA 4G43B 2Q8BH 1CD1A 1T89A 4DN4H 1A6ZB 1QR4A 4XVSL 2YZ8A 4YZFF 3T1FB 3M45A 5I16B 1ZHKA 3D2UD 4AEIH 1DSFH 3DRTB 2QLVB 3VWKB 4ZNCD 5H35A 4GKNB 1X5KA 1KCUL 4M7JL 5EU3B 3I6KB 4W6YB 1G9NL 4NNXA 1JFQH 4I5BB 2CRIA 1RK1B 3RVTC 1U8JB 5DQ9B 5EIIB 2XN9A 1R3IH 4FOMA 1FLRL 2AV7B 4LLAA 5C0CB 5MEOB 1LO2H 4LASL 5IMOB 3FT3B 1DQML 4EI6B 4R9HA 4ODWA 4PR5A 4RCAA 4HDIA 4L5FH 4RFEA 4M1CD 5IIEA 2G5BA 4KMTH 3GMMA 3RHWF 4PJBB 4PGDB 4XP4H 1X5YA 3HI1A 4U1IB 3FKUS 4PG9B 2HFEA 3K0WA 4U1JB 3GMQB 4DEPC 1OAXH 2JB6A 1YEDA 3QQ3A 3L3DA 1X3DA 1CICB 3S5LB 3VXPA 1BBDL 4Z77A 5EU6D 1NSNL 4GMTH 2GYSA 1UWGL 4DZ8A 3O8XB 1LO4H 5FA3A 5EUKB 3T3MF 2IALB 1NBZA 1S5HA 1I1YA 3GMNB 2CRZA 3HAEG 2G9HA 4LSUL 4POZC 3KPMA 3PP4L 4NKQB 4YWGH 3QIBB 4WTXA 4M7LT 4YHNA 5KVEL 3KNBA 2ZJSH 1KPRB 5C0AB 3BWAB 1I7UA 4M7KL 5GRYA 3DX9A 5CZXD 1FFOB 4B0MM 4PS4H 1IBGH 4JPWL 1X5JA 3NFPB 3EO9H 1ZLWH 2HFFA 1BLNA 5HHVL 1AFVH 5HY9A 4P5TB 43C9B 1YN7A 1MHHB 5D70H 3QH3B 2MTPA 2IEPA 5I0DA 5IFJA 3Q6FA 5HYJB 4NQEB 4P2QD 5GQBA 3UZEA 3KDMB 2EE3A 4LSUH 3R4DA 4Y5VA 4X7EC 5DMKA 4Y5VC 4LCUA 1UJ3C 3O3DB 1H15B 1UM6H 2W9DH 4MNGA 3DV6B 4P4KB 4APQB 3QULB 5FM8A 1NUDA 4HGKC 4DN3H 4NO5B 4UINH 4JZNB 1BD2A 1BEYH 2QR0A 4XPFH 1KIRB 4IRJD 3KPRA 2LFGA 5BOZG 1QFPA 5IQ7H 2GJZB 4LCCA 3LIZL 2ZUXA 1RPQA 1S9WA 1NKRA 4TSAL 1S7UA 1I8KB 3H9YA 3NAAH 5I1DB 1DVFA 5IB3B 2EEDA 4WI5A 2R0LH 3OJDA 4M8QB 3S7GA 2IFFH 4MCYB 1HDMB 2XXCB 4U6HB 5GS1A 1RUKH 3S5LG 2X9YA 4QNPE 2AK1H 1CLOL 4JRXD 4NUJB 2YRPA 3VRIB 3SEPA 3I50H 1AXTL 4Z7NE 2EDBA 3NGBC 3LS5H 1XCQA 4F8TA 5MERA 2GJ6D 4XXDB 2IAND 3EYOB 5EPMB 4WNQB 4HG4J 2WINA 3HZKB 4QTIL 1H5BC 4TRPL 1K2DA 2B5IC 4I3SL 2EICA 3GKZA 3ULUD 3VFSA 2IQAB 4WUUD 1FFRA 5LGJA 5JUEH 4XNMB 3IXAA 3AB0B 2CJUL 3IFLL 1A6WH 3FFCD 3K7UA 5ILTL 3PGFL 4Z5RB 3E2HA 2ICWI 4IRJC 4YO0A 1RIVL 3DV4B 1XGRA 3T0XA 3OBAA 5KSVB 1HWGB 4H88H 4XC1L 4NN6B 3NIGE 4KJQD 3BKYL 4J3VA 5IVZB 4GG8A 3R06A 5D1XB 4P2RB 4YE4H 4GMSL 2HLAA 2W9EH 4HIIB 4ZFZA 1A2YB 3ZKNC 3S96B 1CG9B 4PRHB 3EYFB 2RBLA 5IG7B 4Z7WF 4BFIB 1KC5L 4F37K 4HLZH 4NKDB 4HEPG 2CPCA 1JZ4A 5ABDE 2I24N 5DEGB 1KYOJ 4RGNC 5KANG 5IMLA 1NDMA 1JTTA 2EXYD 2UVFA 1F6AB 3OZ9H 5IBTL 1FNEA 3OKDA 4Z7NF 4C55A 3KG5A 3WO3B 2R0ZL 1BJ1H 1HOCA 1XGYL 4WU7A 3GBMH 4NHUB 5FECA 3LV3A 4K55A 4GXUN 1Q1JL 5LGHL 1NLDH 1INEH 4Y19A 3JWOH 1JGVL 3WLBA 4KZEH 2V7HB 2IADB 3QUXB 3TIEB 3K8KA 4GAJL 3OR6A 1I3VA 4W6XB 1AD0B 2BNRA 4MVBA 1DLHA 2W0KA 4XPFL 4G8IB 1AKJA 5HSFA 1QBBA 1LE5A 3FB8B 2MCPL 1BVLA 1LEGA 4L9DA 3ZE1E 3IF1A 3Q0HA 2FEEI 4F7PA 4YDIH 4OZ4B 5IT2L 3GRWL 3O3AA 4Y5YA 3UTQB 1KJ2L 5C07D 3VCLA 3TO2A 3HC4L 4N90E 4KVCH 4XCYA 5ESQA 4DUWA 4WUUE 1P4IH 5E8PA 1EXUB 1LO0L 3DO7A 5EG6C 2J8UE 3WCYA 1IQDA 3LH2L 3VWJC 1AGFB 4LASH 1DBJL 1VGKB 3B9EA 3NZ8B 3INUH 3IVKB 1JWUB 1MCOH 3MLYH 4OM1H 4MDIB 1WVZA 1KBGL 5HYEA 2X9XA 3C9NA 5GS0L 3E6FB 4X4YB 5MEND 1ZV5A 4WU5A 1CE1H 3ARGC 4ZFOB 1I4FB 1MHCA 5GGUB 3FO2A 4MA8L 4U6XB 3WFEH 3VA6A 5BVJA 3RVXC 4PJDE 1CR9H 1DVFD 4RAUB 3QJHB 4YGAB 3U7AA 1OAZL 4MA1B 1BOYA 3N1GC 4DUXA 3QFDA 2CLVB 2XV6B 3ULVC 5EWIH 4LPYA 2XY1A 4KFZC 1RJLA 5D2LE 5DJCA 2N56A 4Y4KA 4QKXB 4OZFA 5INDB 3CFIC 3X3FH 3KXFD 4MAYA 3PWVA 4L4VB 3FO0L 3FQUA 3EOBB 1I7ZB 1L0YA 4CBPA 3MZGB 5DRWA 4HV8A 2QQLL 1J12A 4HXAH 3STBA 1O7SA 4LP5A 1FIGL 4H8WH 5ECJE 5DUBA 5C0BB 5HYIA 1IM9D 1UFUA 1T0MA 4Q6IB 5AZ2H 4YXHL 1QVOB 3L9RB 4KVNH 1NCCH 1QSFA 3ZDZF 4QRRE 3MV8E 1C08A 3EBAA 5TQ2H 1G6VK 1F8TL 4JQXA 5IEKA 4LKCB 4PLOB 5C08E 2GK0A 3SDAC 4ZYKB 3VXOB 4LLYA 1A14H 5GGQH 3RDTA 4PDCE 2VDOH 1ZLUK 2BSSB 2P24B 2MQ0A 5AWNL 3UTTB 1TJGL 4WW1B 4GRMB 2NPLX 3GGWB 3RTQC 1CQYA 2E27H 2R4SH 1XFPA 3BWUC 4OBRA 4JFXA 4BJLA 3HMXL 4PV8B 4K3DL 4X6BB 1TFHA 4HPOH 4OUUB 1I3RB 2X05A 4OCWL 5T3ZL 1SQ2N 4R4NC 3P0GB 4XHJD 5L6YH 4TVPE 5GSVB 5F71A 3KS0J 4O2EA 4X6DA 3FQXB 4TUOA 1LE9B 3RJDA 1RURL 5ICZB 4JREC 1B0GA 1RK0B 1ZHLA 4G6MH 1RZJL 2X41A 3VH8B 3TN0B 2H26A 4P2QE 5BVPL 4OD2B 5DT1L 1A1OB 2KZWA 2V2XB 3M17A 5D1QD 4CJ1A 5D7JD 2DQTL 2ED8A 4Y19E 3LMJH 5E94B 2RB8A 3T0VA 1VB9A 1EX0A 4IBLT 2O26U 1JNLH 4O00A 1ZHBB 5J0BA 2WIMA 4MJ6B 2VAAB 2IF7A 1CXKA 3U2SA 4ZPVB 4XNXL 5F7DA 1NBVH 4Y88A 1G7IB 4K7FA 4TQEH 1KTKE 4LMQI 3SO3B 3IETB 1FV1A 2FATL 3B9KD 4GW4A 2PYEB 5E2TL 5I8OL 1IGJA 3C8DA 4NO2B 2MHAB 1JRHI 2OYPA 2DQUH 3CXHK 5IW1A 1NLBL 4NKMB 2DDQL 4LAQH 1OHQA 1J1OH 5FXCH 3P73B 2XN9E 5CJ8A 1BWWA 5DZNA 3WLWD 4BQCA 4KH2A 4L8SC 4PYHA 4P0DA 1D5IH 5IESH 2VLME 2JCCA 1AQKH 1CICC 1E4XH 1EAPB 2A6IA 3WUWB 3CLFL 4NNYB 4GQ9L 2DBJA 2AABH 4MXVF 2YD8A 4YPJA 2V9RA 4PJGE 5IHLB 4JZJC 5C09D 3LPGA 1WJ3A 5F3BA 1CFSA 1RZ8B 5SX5H 5D1QA 5D7JC 1MFEL 1KN4H 2ZP0T 4WWKD 2YD3A 3NAAL 4PJIA 3KPPA 1CL7L 1NANI 4E9LA 2I60L 1FL5A 1A4JA 3A6BH 2E3VA 1P69B 4PRIB 3ARFC 3P30L 5I1KL 3PWLA 5I2IB 1AGDA 4YXKH 1KEML 2IH3B 4J3SA 1G6RL 1F6LL 1H8NA 3Q5TA 5I75C 4PP2A 3T77B 5HGHA 5ENWA 1HI6B 4NN7C 3RRQA 2AEWA 2FEEL 5T1DL 1K6QH 1QQDB 3BPLC 2NW3A 3ARDB 4NWTL 5F1IA 5CSGA 1SEBA 2MKLC 3VD7A 3W9DA 4FABH 3BN3B 4IMLB 3BUTA 4WTZA 1RULL 3MRGA 4X6CB 5FUZH 2NZ9C 4D0DB 5CJQH 3MOAH 4HIXL 2UUDH 5DQJA 1Q9LA 2FIRT 4NCDA 2NW2A 3O9WA 1B2WL 2ZSWA 1HXMB 3I02B 4PJ5A 3DSFL 5HHMB 1EH9A 3AUVA 2ZOLA 2CLZB 3TA3D 1NH6A 4Q9CA 1W72B 4A6YA 1U3HA 2ERJC 3A6OA 1NCUA 2BCKB 5I1HL 3ARFB 4KJYA 1YNTA 4HS3A 2HT2C 5J8OA 5DC9B 4X7SL 2Q3AA 2FH8A 4L9LA 2APXA 1IKNC 3S6CA 1FFNA 1P7KB 4NFBA 4HQQH 4BYHA 4U33A 4L9LB 4XP1L 3UBXB 4Z78A 1T20B 3SGKC 4EOWH 4YH6A 3PIQA 3I3EA 35C8H 3ARFA 4KJYB 3T0WA 5JZ7C 2YK1L 4YHOH 3TNNA 4OJFL 4W4NA 1P7QD 4D0CB 3MA9H 4JO4L 1M71B 5EBMB 3QUZC 2L7JA 2QKIB 4JGJA 1W72A 4L8BA 2CLZA 4J3OC 3MNZB 1JIBA 3P0YL 4PJ5B 3I02A 4M9PA 1A6WL 3PABB 2R69H 5FYJE 4M6OH 3O9WB 5C09E 3QIWA 2LAAA 4JM4H 3VG0L 1CIUA 1N2RB 4Q9BA 1ZA3B 5MP6L 4HXBH 3F7QA 2PO6A 4QHLA 4QWWC 5CZKA 5DGRA 4KAQH 4ODTL 1AY1H 3RHWK 1TJIH 1GJIA 3TBYA 4Z7OF 5TFSH 1GC1H 3RY5A 3ZO0A 3QDGA 3BZ4B 2I5YL 4FQLL 1NFDE 3HNTL 2ICWA 1G7JB 2FGZA 4YGVB 3T0BA 1AGDB 1I8LA 1PEZA 2H3NB 3WS3A 3BP7A 4IIQC 5K9JH 3MRRA 1BM3H 4JM2D 4G9DB 2QQQA 3UJJH 1KXQE 2VQ1B 3LAFA 4S1SL 5CJXA 4WHTA 3WFDL 5GRJL 2NY7L 2ATKA 1QBMH 1EVTC 2OTWA 4L3AA 1RHHA 3QEQA 3VFMA 2XKUA 3TV3H 4Y4HD 1A7OH 5DJAA 1RUAL 4UUJA 3WFZA 5JMOC 1KPUA 5I1CH 1U8LA 2Q76B 2VDRL 1QEWB 4Z76A 1SY6L 4TSCH 3H3PL 1JPTH 1QSFD 2BJMH 2VTFA 3MRIB 4U2ZA 1QTYT 1IM9A 1BIIB 5KAQG 2LTQB 2VXUH 4OF6A 3B5GA 4WI3A 2EYRB 2APVA 5JQ6H 7FABL 3NFSL 4HJJH 2F54B 1URLA 4L3EA 1EGJA 4UIKL 4UV4L 4UU9B 2OL3A 1CR9L 1BMGA 5E56A 5FK9A 2GI7A 5IESL 1JGUH 2Z31A 4EN3A 5FYLE 2MHAA 4EN3C 2XKNA 1EK3A 3DIFB 2VRAA 1MJ7L 1AI1L 1FV1B 1IC7H 5EZOL 3SGEH 3THML 2W0LA 5DR5H 4R26H 3TF7C 4KK6C 3UO1L 1YEIL 3LKSA 1IC5L 3GSRA 4FQCL 4OAWA 5H94A 4XTRC 1PVHA 3U2SB 1ZHBA 5E2VH 4H26A 1MFCH 2PTTB 2J3SA 4WW2F 2ZCHL 3HFMH 3M17B 2V2XA 1BAFH 1AGEA 1KCGC 3MUJA 4OLVL 2X1QA 2X7LB 3GMRA 1CGXA 2J4WH 1Q0YH 1ZHLB 4XHQA 3RUGE 1ZANL 3HTLX 1YUHA 3WIHH 3CCHB 5K93A 1LE9A 3SKNA 1PAMA 3KXFE 4HGWB 4JHWL 3CX2A 5BJTB 1NEZB 5HPMA 5AEAA 5KN5B 3HPJB 3ZKND 5K9QI 5SX5K 2F74A 4K71B 4OUUA 2OQJB 4X6BA 4XMPH 4OFIA 3OKKA 3R0MA 4ONHA 2GJ6E 3EDJA 3NACH 2QSCH 3AS1A 4KJQC 4LSRL 1HNFA 3L95A 1KOAA 2DKMA 4RAVB 2CQVA 5GZOC 2L7UA 1MJJB 2ZUUA 3ARRA 3VFWA 4JKKA 4NZDA 2H1PH 5C2UB 2E7HA 3QCUL 1T66D 4P3WA 1C08B 3GM0A 4Y2DA 3TO4A 4KHTL 2E7LA 1QSFB 1QVOA 3L9RA 4JCLA 2ITDA 5C6PB 4M7LL 1NCDL 1NPUA 1P4BL 4F37F 1EO7A 3SKUD 3HR6A 3OJVC 1IRAY 1S7QA 4Y5XA 4PJIF 1AE6H 3GZKA 1MCLA 3EOBA 3X11A 1JUFA 3MJ9A 4LSSH 2ZPKH 3SHSA 1BD2D 1VKXA 3PWVB 4MA1C 4OZFB 3KJ6H 3AGVA 1AY1L 4KROB 2DD8L 5IJVA 4GW5B 1FG9C 1FG2A 3VG0H 2FDBP 4PJIE 1MI5B 4MXVE 4P46C 4YIQA 2NY4D 1KLFA 3V5HA 1WLHA 3GEWB 1M6OB 2EDXA 5GGUA 5JUEL 3X17A 4E42B 3LQAC 1EFQA 4WU5B 3CFJA 5C2BL 5FUOH 5I1JH 2FLRT 4P5MB 3D3VA 2YRLA 4NKIH 3TH2T 4X4YA 3E6FA 2FX7L 1E4WL 2WBKA 1LEIB 3LD8B 3I6LD 1T04A 3NFSH 1J05B 4HJJL 1AGFA 2HKHL 4X6CF 1MAML 3K3QA 3TBSA 4CVZA 3UBXI 3MPCA 4YLQT 5J3HD 5D7LD 3JZ7A 5E8PB 2FX8L 3BPNB 1GAFH 1EFXA 1T83A 1HILB 1MVUA 3IDJB 1PKOA 3FB7A 3QHTC 4G8GA 4OD1L 4YK4B 1AI1H 1S5IH 2VN7A 4OZ4A 4NRYA 5ISZA 5AZEH 2E9BA 1LEGB 4NN7B 3W5NA 5D6DC 1CBVL 2UUDK 2NY7H 1KELL 2FHFA 3UTPD 1AKJB 4GRLC 4KRLB 4I9WE 1DLHB 4JFPA 2PTVA 2HA1A 4LHUB 4XWGH 1KJVA 4X4XB 1S7SA 3RUGA 2JLLA 3C6LC 1EJOH 4JE4B 5FHBL 2AI0H 3QUXA 4LAJH 4HWZA 4I18A 5EUOE 2IAMD 3WLBB 4OZIB 3KPOA 4LCWD 3BH9B 1P4LB 3TA3B 4LMQE 3FO1A 1AXSA 3ZSSA 3O2DL 2V2TA 3N0PB 1A7RH 4DKAA 3GMLB 4EVNB 3G6JF 4NHUA 3MACL 1NGXA 3SDXE 5BOPA 2FGWL 3OAZH 2VDQL 1K8IB 5CEZH 4JAMA 1I9JL 4XBPB 5MI0C 3OKDB 1FNEB 3I9GL 3CMGA 1MCWW 5FA4A 2OL3H 1IC5H 3MRHA 3T0EA 3VXTB 3QYCA 5ANMB 1IKNA 1JF1A 5D1XC 4OF3A 4C56A 3VFPA 4NQUA 5CGTA 2RCSH 2AGJH 1DTUA 2ORBH 2X4SA 4BFIA 1F11A 3Q6GH 5DA0B 2JK5A 1A7PL 5F70A 3T08A 4G42A 1AQKL 4KRMB 3TZVA 2JIXB 5DLMH 5CP3A 1PYWA 5GHWL 2X4QA 3MV8A 3EUUA 2Q8AH 5IVZA 3ARPA 3O9WD 1XGQB 1T7XA 1XGRB 4EXPX 1ZGLA 2OLDA 1OCWH 1KGCD 4HUVA 4XNMA 2HP4A 2VOTA 1JGLH 3GSWB 4QOKB 3JXAA 3U36B 4LSQL 5LGJB 3GI8L 1U95A 3HZYB 3S3PA 2B1AL 3PP3H 5EUOF 4H88L 4FQQA 1A5FL 3S36H 1W0VB 3IFOA 4X5WA 5DVLA 3EYOA 2HVJB 5K9KB 2OSLB 3RWCA 3TYFA 5IB1A 1LO2L 3TCLA 4AM0B 4DKFH 4GQ9H 3HCVA 4G7VH 6FABH 4FXKB 1GGBH 2AXHA 4LLMA 3LRGA 1FP5A 5LWYH 3ZDXF 4Y1AD 2R1WB 1FDLH 2J6EL 4MCYA 3VD3A 1VGEL 1NCTA 1DVFB 5IB3A 3MJ7A 2Z9TA 1S9WB 5DO2C 2X4RA 1T0NB 3CZJA 1ZLSH 2XZQH 1AP2A 4P23A 4WEMB 3F6LA 3QZWA 5DSCB 3T2QA 3OXRA 3ZKQD 2P5WA 1V3LA 3CH8A 4X80L 4HXAL 3P9MB 3T2PA 4JZNA 5JA9A 4NO5A 4OIIL 1XIWC 4YQXH 1S78D 1MFEH 4RSVA 1GGBL 4AL8H 2VUOA 4R0LC 5F6IB 1H15A 1ZT1A 3O3DA 4O02H 3C87A 4HF5H 4Y5VB 5HYQB 3BZFB 2R23B 3KDMA 4ENED 5I76B 4WHYH 4E41B 5HVGB 4JFQB 4KTDL 4KJPD 4HKBB 2JIXD 2PF6A 43C9A 5DJ6A 1DLFL 4PLNC 2VB5A 3BO8A 1EIBA 3WXVH 3TJHA 2FSEA 4UT9L 5D72L 1LNUA 4JEGB 3QCUH 1D5XB 1LK3L 2F53B 1CL7H 3O6ML 1MQKL 4ZUVA 4DTGH 3SE3C 5I18H 4PJEE 3OAZK 3NH7L 3OX8B 3V9FA 4AT6A 3QIBA 4MHHI 3VXSE 1EHXA 1F4XH 3KPMB 5HGAB 4PP1C 2BNQD 2GTWB 1MFAL 2G9HB 4PFEA 1NUGA 4IMKA 5EUKA 4MSWB 5FA3B 3VRLF 4BELD 4KKLD 3QG6A 1GVIA 1FH5H 1KNOA 1KXVC 2EE2A 2Y9RT 3QDMA 4KRPD 1F5WA 2BRRH 4Q9RH 3P4NA 3PP4H 4JGUA 1XT5A 3L3DB 1XZ0A 2DS4A 1T1WB 1ACZA 3GMQA 4LAQL 3O2DA 3MLTB 4PG9A 3BYYA 4NKOA 5ACMA 3SGDH 1I3GL 4PGDA 4PJBA 2NNAA 2NLJB 5GPRA 2C3VB 1YZZA 2VDQH 4RFEB 3HUJF 4HK0B 3MLZH 4PGCB 4PR5B 4ODWB 5J13C 1G7LA 3MCKB 2FATH 4EXKA 2QSCL 3B6SB 3O3BA 5F1KC 4UQ3A 3T3PF 3GM8A 3SDDC 1CN4A 1LO0H 3DUUB 4N9OB 2XZCL 4YHMH 1QSEB 3BP4A 1RK1A 4FMKA 4N8VG 3I6KA 1F4HA 1QSEA 3DRTA 4U3CA 1H3XA 4CKVX 3N85L 5JIPA 5DD6B 3E6HB 4BSJA 2AABL 1KF9B 2ZUWA 3B6SA 4S1RH 5C0RL 1FLRH 5F7LB 3ROLA 5T5NF 6CGTA 2ADJB 4MXWL 4G9FA 3E2HC 3RY6C 3WXWH 3HZVA 4OKVB 3RQ3A 2L4OA 2HYMA 3MLTA 1UGNA 4XP6L 4IMKC 4DZBA 1S3KH 1T1WA 3OKYA 1F58H 1ZT4B 1L6XA 3MXVH 2CGRL 1J1OL 3MUGA 2P7TB 4F9PC 4AEEA 3EDEA 4AH2B 2E6PA 1MUJB 3QDMB 4FQCH 4GG6B 1KNOB 1ZHNB 1VCAA 3MV7A 1XCTB 5KW9H 4HBCL 4NO3A 4Q6YA 3HB3D 5BQ7B 1PSKL 3DURB 5C0IA 2VDKH 2VLKB 3O6FD 4JPIA 1HKFA 3JSSA 2ITCB 4XP5H 5E03A 5IBTH 4AT6B 1B6UA 3P4OB 3T3PE 1EO5A 2NXZC 4Y4KC 2X10A 4ZUVB 1VACB 2V5YA 1V3JA 1D5XA 1T7ZA 1MNUH 1ZANH 3LQMA 4HS6A 4N0UB 1F8TH 4P5TD 5TQ2L 1LNUB 2NMSA 5EU6B 2FB4H 4MNGE 1JWSB 2VLLB 1YNKL 1HN1A 2DIAA 3L3KB 3Q5OA 4D8PA 3JWDL 1P84K 4HKBA 1G7QA 4P2QB 4PRAA 1KIQA 2YBRB 4L1HA 3TT1H 2Z35A 2PW2A 1C7SA 4E41A 5I76A 4QRPB 4AIOA 5HYQA 4P3DB 4ODXB 1OLLA 4X80H 5ADOL 1CIDA 4I18C 3GIVA 4KDWA 5I6XB 4J1UA 1J8HA 4IRJB 4HUXB 1OGTB 1A21A 2ESVA 2F58L 2E6QA 1BQSA 5IFAH 2APTA 2YA0A 1CK0H 1QLFA 4RGNE 1PGRB 4GRLA 1C5BL 2ZWLT 4HH9A 4PLKC 5DFVD 2P5WB 2E5EA 2NY1C 4JM4L 3C8KA 3OXRB 2P5EE 3G6DH 3CFCH 1QFWH 1OTUD 2DYPA 1LHZA 2BY3A 4G7YL 3JBG7 4CMMA 4TNWK 4JHWH 3PXHA 1J1XL 5SX4I 3UTSD 5JOFA 3LS5L 1TVBB 3BGFC 1QUNA 4OGZA 4PTTB 4XH2B 2R1WA 4LDLB 4D9LH 1BEYL 1MRCH 3MODL 2XZAL 4DGYH 4LLMB 4TSCL 3MRDA 1ZMYA 1OPGL 4FXKA 2MJWA 1GGIL 1A1NA 4GBXD 4LSRH 5IMKA 4AIZB 4KKNA 4AM0A 1V7NH 3AS0A 5AUMB 4J6RL 5KG9A 5EOCJ 5D7IE 5INCA 3CVHA 1K4DB 1NMCB 5TPWH 3JTCA 4OZIF 2HVJA 5IBLC 2K3TA 2YPLE 3O4LB 3V52L 1PZUB 4NWUH 3B3IB 3BKJL 2JCCF 3ILPB 1OCWL 1QO3A 4WFED 2XKSA 1C1EL 2B8OT 3OKNA 4X5WB 5ITBL 1AR1D 1WZLA 4PREA 4FQQB 3QDJE 1AGBA 1MJ7H 3BEVA 1FFPA 4Q6IC 4EUPG 35C8L 1JN6B 1SJXA 3O6LL 3U36A 2A9ML 2F19L 1UM4L 1D9KD 4HUVB 1R5VB 1U9KA 3ELAT 1CFVH 5CINL 2EE6A 3BSZL 3O6FA 1WAAE 3S98A 3GIZL 3VMOA 2E7LC 2AP2A 3V0VB 2GK2A 1LDPL 2X4QB 4F33B 2MQ3A 1YNLH 2IPKB 3F8UB 5I66A 2AERT 5IHZB 4G42B 3BRDA 1PQZA 2GITB 4X7TB 3I9GH 4LGPB 1F11B 3UP1A 4YE4L 1WT5C 4LRNH 2HFGH 5D2NC 3OG4B 4PJXB 4E5XA 3SE4A 4C56B 1QD0A 3D25A 2F8XC 2VLMD 1WV7T 1OARH 5SWSB 5ANMA 4QHKI 1ZE3C 3TBVA 1JRHH 4W4OC 1HCVA 1U92A 3MRHB 1J18A 4ZPTA 4G9FD 3NCEB 1MCKA 4XBPA 1K8IA 2WUBH 3SQOH 4CN4A 1F4AA 1NGXB 4K7PH 4UV7L 3RKPA 4QXWA 3GMLA 1VESA 4EOWL 3T0AA 1YA5A 7FABH 2XT1B 5CHNB 5HPOA 1J0JA 1KC5H 1U3HD 5T1DH 3PWNB 1A9BA 1NKOA 3KPOB 5D93C 3CD4A 5FUCE 4I48A 4M1DL 4O2FB 3PUCA 2XIDA 4WEBH 2AXFB 4OLWH 5CCKH 4X4XA 3I50L 5FM5O 3RZCD 1FLTX 3MOQA 5EULV 4EN3D 2Z0BA 4JFPB 3BDYH 1X6NA 1ZVHA 1NC2A 5ALCH 2DL2A 3LDBB 4DEPB 4WY7H 4ZSOE 4MNQA 4WVRA 3EJZD 4WO4D 1DANU 5ISZB 2VITB 2PXYB 4TRPH 4EUPB 4YBHA 3TVMC 3D39E 4RDQF 3QHZL 4PY7B 3BKCH 1II4E 5IOPA 2Y1VA 4KI1A 5TE7L 3GB7A 3IDUA 4WEBL 4HJGA 1MEXH 5LXGL 4C57C 2FHCA 3GBNH 3OTTA 4TTDC 3TBSB 4CVZB 4UQ2A 5B3JF 3NIDF 1C5CH 4I0CC 1T04B 4P3CL 5E70A 3NN8B 2OP4L 5CKAA 3JV0A 4B7IA 3V6BR 2BVTA 4MLIA 5EO1A 2V5RA 3D69A 2B20A 4LFHD 2R0LL 3RVWC 5DMYA 2D7TL 3FONA 1KLUA 3CFJB 4XVJH 4X0KB 1S7VA 1GHFL 3TFKD 3IAQA 3CVHH 1IGFH 2G2RB 4KI5D 2YUWA 4HMEA 3LQZA 5HDLA 5IUSA 1H3TA 1ORSA 3TIDA 4POYA 2C3WA 1Q72L 1PY4A 2P5ED 1FG2B 2XTJE 4LSTH 1YJDH 4DN3L 5IJVB 3DWTA 3T0ED 4MQTB 3HUJA 5JHDE 1T2XA 3OB8A 1QBLL 2VIRB 1FAKT 5E1HB 3FB5A 4PJFA 4F7TA 3HR5B 1ZSDA 3EFFA 5CD3A 3QXVA 4Y5XB 4YHZH 1S7QB 3GHBH 3MOBL 2ARWA 2DTML 1Q0XH 1MIEH 5DURB 1P7HL 4DVBB 1JYXA 2WK2A 4ETQB 3NA9H 2KQMA 2VDLL 3GSNL 3QDJA 3S37H 3TESA 4YXKL 4WHCA 1MFDL 4Y2DB 3TO4B 4U1GB 2OZ4A 2QQNH 3UX9B 2CK0L 3C09B 3PWJB 3U46A 2GUOB 5ACZA 2Y4SA 4R4FH 3CSGA 2AJVH 2CDFA 2YPLD 4H5SA 5KSBF 1M7DA 1KCLA 3CH1B 3RWGB 3VFWB 2VSCA 1MJJA 1OW0A 4GUPB 4YJZL 4JDZB 3UCRA 1ORQA 1UZ6E 2VXVL 5I74C 1S9YA 1JHTB 2YSSB 5L0QB 1A14L 3V95A 1TITA 4JO1L 3REWA 5CJOH 2AK4A 3OKKB 4MA3A 4XAKE 4I0PC 1UWGH 3Q5YA 1J11A 4MZ3A 1ZWIA 2ADFH 1TJHL 1MIEL 5A3ID 2A1WL 1ZEAH 3RAJL 3JV6B 3F7YA 4OLVH 5BJTA 4R90L 4F9PA 4MA8H 1U42A 8FABB 2OR9L 2DAVA 1I7TB 2VDMH 3P9LA 3SKNB 3A6BL 1I1AD 3AREA 2MNUA 4LCIH 4F7MA 2FNBA 1WBZA 4LSPH 5D7JB 5EU5A 5I19L 1AGEB 4KK5D 4TUJB 4NJAL 1FO0H 5FF6A 2R4SL 4UT7L 5TDPA 1MCJA 4N8PA 2GJ6B 4OZGB 2P47B 3KLHD 4BM7A 5DD5H 3FOLA 4XNYL 4YHYC 3EYSH 5ADOH 2VLJB 3QQ9C 3C60C 4FN0A 1DCLA 1IGIH 3RIFK 5I1LB 3UYPA 1FC1A 1OT1A 2XKNB 1G9NC 1QSFE 3OAYH 3FB6B 4N0CA 3TT3L 4JN2A 3GMPB 4CADB 4WI4A 1YMMB 5E2UL 2Z92A 4R8WL 2DI9A 3IJSB 1FZMB 2F54A 3HMWL 2AEIT 1BF8A 1CLZH 3VWKD 1C5DA 5KS9E 3LH2H 2DLHA 2XWTB 2J5LB 1RIVH 5E5UB 5BZWB 5J13B 1JNNL 1YQVH 3IYLW 1A8JH 4MD5A 1RMFH 1WWWX 3ZKXC 5TQ0H 4KZEL 4Z76B 4OLZH 5GGSY 1G84A 1WCBA 5JR1L 2A83B 1KPUB 4PLJD 5GISH 2PKDA 4EDXA 5L2KB 3LKRA 4K07A 3MUHL 5EOTB 5DJAB 4XVUC 1T2QH 4NM4H 1WBXB 2YC1B 3KLSA 2BOBB 3VFMB 4HC1H 4UB0L 3ES6B 3BE1L 5HBBA 4FXGB 4LVEA 4CMHB 4AENA 3CFBB 4UTBH 3L3HA 3WIIH 3QCVH 2VQ1A 2VE6B 3GNMH 1MEXL 4N8CL 5DJYA 4G9DA 2FCBA 3DO3A 1T5WB 5FOBB 3BP7B 1YYLL 2DWEA 3WS3B 5JNYA 1UCBH 2H3NA 2J7LA 2Z91A 4J2XA 4U0RB 1VENA 2EE9A 3O8XD 4BSVA 2HMIC 4BSWA 3MLWH 3QEGL 5JXAL 4C4KT 4NJAH 2VXVH 3LS4L 3D85D 1DBML 5CIPB 1UM5H 5GGRY 3TBYB 3L3JA 4Q58C 3RY4A 3EO1B 4P48A 4FQ2L 4PGZA 2BNRD 3LOWA 5T3XH 5EWIL 4PJHE 3IAPA 4K3JH 4JY5L 3SE4C 1N5YL 2OI9B 4QXUH 1JNHB 1JGLL 3QIWB 3JV4B 3OXSB 3PABA 1QRNA 1FORH 2XTLA 4JFOB 3MNZA 3PQYD 3ZE0E 4YHZL 1MCEA 5E99L 2VXSL 1ED3B 1SY6A 2QKIA 5EBMA 4QGTA 1JV5A 5LBSH 1U0QA 1E27A 4FQHB 3EO0B 3FQWB 3PIQB 3O3EA 1X5IA 4PJBF 1FL3A 5SWSD 4U1LB 3DECA 1J86A 1P7KA 3PGFH 4JLRA 4ZXBC 2HRPL 5CBAA 2B2XH 5EU7C 1MCOL 3EGSB 3MLYL 4G6FB 4G80A 3M8OH 1CD9B 1QKZL 2R4RL 3RNKA 4NM8H 2KPNA 1EO8L 2YKLH 4CU7A 5F7UA 2AQ3A 3VXSD 1U3HB 3K2MC 4GRLD 4A6YB 3NFNB 4NQCD 4CW1A 3RX5A 1CXFA 5HHMA 4UV4H 4QF1B 5GS2D 4G6AC 2ZSWB 2NY1B 2Y5TB 2VSDA 3MRPB 3SKJH 5DQJB 4N8VA 3TVMA 2K1MA 1AO7B 3UBXG 3O2VH 3H7LA 2O93L 2F19H 1DUZA 3MRGB 4X6CA 5F8RC 5HVWA 2XZAH 1NC4B 2ADFL 2Q3ZA 2DQCL 3VWJD 1FPTL 2B7DT 5F1IB 4JRYE 2DLTA 1P7QB 2BY1A 1HH6B 2XQYK 4NZUL 1TMCA 2NW3B 4LCYA 2P43B 3PQYA 4DKEL 1S9XB 3F12B 2Q7NA 5HGHB 4OIIH 5F93C 5T1KB 5SV4A 5IEHA 1C5BH 2V2WB 2ZOKB 3HN3A 1UKQA 3PWLB 5I2IA 4M3JA 1NMCC 4PRIA 2DOCA 5KSAC 2QQNL 1FYTD 4QRSA 1QACA 2J5LC 4OD1H 4X6EA 5JXED 3BPCA 1JZ7A 1G9MH 1XF4B 1N64L 4G5ZH 4G6AD 2DQCH 5JW3H 5FGSA 1DQDL 1E4XL 3GJFA 5C7XL 3MV7D 5I73B 1RZ8A 1MREL 3QDHA 1EPFA 2VAJA 4JQVC 3T8XA 5F7KC 5IBUG 4PG2A 3BN9C 4D9RE 3T65A 1X5FA 3ISWA 3SKMA 4NP4H 1N6QL 4LP4A 2IG2L 3B2UC 2A6IB 3C6LB 2JCCB 1YYML 2ID5A 4L3CB 3IJHB 1NAMB 1AFVL 3T1WA 4NM8L 1ETZB 1ZKAA 2VZ1A 5FO9A 3RGVB 4OLZL 1PKQE 3L3IB 4W81A 2R69L 4XPHH 4ODUB 4R2GC 3SY0B 5EA0H 3RIAK 4NKMA 1TQBB 3SDDA 2J8UA 1MCIA 5IW1B 3U79A 5K9OB 1A0QL 3HMWH 1QSED 2GSGB 3LDBC 4JFDD 3CUPA 4LNRB 4NO2A 2VWEE 4G59A 5FGCE 4X4MA 2APFA 2PYEA 2HFTA 4GW4B 5GGRA 4YHKL 3VRJB 3PWPE 4ODVH 2DQTH 4I13B 4YDLC 4YX2L 3O0RH 5GSRB 5EC2B 1M05A 2JJWA 1UCBL 5CGYC 1F13A 2NY3C 4JFEA 3L3OA 2VAAA 4TTGA 5GGTL 4BFGA 4QYOB 2GIYA 5DLML 3DROB 1ONQB 4Q2ZA 3LCYA 5F9OH 1QLRB 1Q9KB 2Q6WB 3MRLA 4IRSA 2UY7A 4OM0L 1A1OA 1J0KA 3CFCL 5B4MC 2A6JB 5I1AB 1RU9L 3VH8A 3TBTA 2OJZH 2X70A 1E6JH 5DK0B 1RUKL 4RFNB 5ICZA 1XIWB 3T0EE 1A7NH 5F6HJ 2W0FB 1ZVSA 3P4LA 3FQXA 3RNQB 3DPBA 4Q9QH 5H37G 1QRND 4HH8A 4JFFD 1IGMH 4GAFB 4P46B 5GSVA 3ZDXE 3KPSD 4RMQA 3UJIL 4LARL 4ELMB 1JNNH 5GRWA 1V05A 2NX5B 3BKML 1CFTB 1UH2A 5DJ8B 2R2CA 3KPNA 1CLZL 1JK8A 1H3WM 4NYLA 1LP9A 4QRUB 2ZCKH 2Y7QA 4PB9L 5KOMC 4L29A 4NQEE 2R0KL 2BNQA 3U1SH 4Z7VA 4Z6AT 1F3DH 5GGVL 4QOKD 1WFTA 4GRMA 4WWID 1B88A 3V8OA 1CVSC 4GS7B 3WLWC 4FTVD 1BVKA 5T1LB 5MHSE 4FS0A 4LLYB 3RDTB 4MQ7B 4V1DB 2E7BA 2VUYA 1XR9A 1BOGB 2BVOB 2M26A 2GK0B 3H9ZA 3QBTB 5KVMC 3OKEB 3SBWC 4PJCE 3ZYZA 1EZVY 5JPMA 4S2SB 4WFGE 2RFXA 2DM2A 3K80A 1HHGA 4OGXH 1IL1A 1WFUA 1RV6X 4Q6IA 5CBEB 2YD5A 4NO0A 4F7EB 3HPLB 4FZEL 5C0BA 3CU1A 5DUBB 1ZGLM 2F58H 3EOTH 4LNVA 1A9EA 2HJFA 1TPXC 2DIJA 4NNPH 1FJ1B 4M6NL 3HE7D 4X4ME 2HWZH 4HWBH 3FQUB 3S3SA 4L4VA 3DMMB 3KAAA 3GUTB 2FYYA 5CEZD 2FX9H 3HG1B 5J89A 3GK8L 4G8EA 4JG0L 4U1KB 2AKRA 1RSFA 2NXZB 4Y4KB 2P5WD 5L7XH 4X9HA 1QBLH 5KBNC 5DJ2B 3PHQA 5E8DL 3K4DA 3UYOD 5AYUL 4LVNB 3QJHA 4RAUA 4YXLL 3HNVL 4NM4L 3VXRE 2DQFB 4XPBL 2J6EA 3RDTC 3WFCH 4EDWL 5BVJB 1D6VL 4PJ5D 5T33L 5ELIA 5JLZA 3FO2B 1TETL 5CLWA 4OM1L 3PHQB 4ZFOA 5E2TH 3KPTA 1R3JA 3N50A 5FYLL 1B6DA 1GGUA 1YQVL 4G8EB 2ARJA 4U1KA 4DFHA 4FTVA 3GUTA 3VFVB 4LLVA 4BZYA 1FJ1A 3C5ZD 1LK3H 5J1TC 1YEHL 3RUGF 3D48R 1KB9J 3NZ8A 3IVKA 3L5XL 3UC0L 2HJFB 1A9EB 1BHGA 3S8WA 3BT2L 5M7QA 1IQDB 4P2OC 4HHAA 4F7EA 4JFFB 4U0QB 3WFHB 3DO7B 3RL2A 4WFHE 2VLKE 2FB4L 4XCYB 4XI5C 5ESQB 5GGVH 3MODH 4DGYL 4ZOCA 3H9SA 3K8LA 2VQUA 3OKEA 5JPMB 4Z7WB 1IMHC 1TZIB 4XX1G 2BVOA 1BOGA 5D71L 2C1PB 1MY5A 4ODHH 5D1ZC 3DSNA 3O3AB 1EGJH 4G3YL 3TC9A 1P4BH 5T1LA 4MCZB 5TE6H 4F7PB 3W0WE 4GSDL 2AJZB 3IF1B 4HX1B 1MRFL 2FECL 1GOFA 2X09A 3H3BC 4Z7VB 4HC1L 2NY3B 3FB8A 4KY1H 3H8NA 5JIHA 2Y7QB 5T1LD 3C09C 3OHXA 1DBMH 3QUZD 4G8IA 1JK8B 3RY6A 5DJ8A 2PCPB 4DOHB 4PUBH 4QXGH 3KR3L 1OD7A 3TIEA 3V5DB 3FQRA 4XAWH 4FQJH 4C56D 2V7HA 1YYLH 1NAMH 1BQLH 4HK3N 5BV7B 3IDMA 2KZ1B 2Z4QB 2ZNWA 3E8UL 3DX7A 5EC1A 2C9AA 1AIFA 1I8IB 3KHQA 2ZZUT 4NUGL 2C4XA 3BZEB 3TBTB 1CZ8H 5BO1L 2AEQH 4ONFH 1UEMA 1HOCB 1FQ9C 1PX3A 1UG9A 2IBZX 4R97B 4EKXA 5BRZA 1IM3B 3IDGA 3VGDA 2ZG2A 4ELKB 1W0WB 1NDMB 5IMLB 3LD8C 3DROA 1QFUL 3BAEL 4QYOA 5DEGA 3ZTJG 4ZXBA 4LHQB 4P2OA 2IAMB 5AG8A 3SOBL 3ARQA 3FO0H 2DQHL 4DJMA 5EC2A 4J7RA 2DM3A 5IG7A 3EYFA 1CG9A 4PRHA 4FP8L 2APBA 1YEGL 1EDQA 1U8OB 4WGVB 2HLAB 4HIIA 4ZFZB 2VC2L 1Q9WA 3WNKA 2DN7A 3GRWA 5D1XA 4GG8B 4NQCE 3ZSTA 3S88H 1UQSB 3PV6A 5KSVA 15C8L 2KBGA 2J8UB 4YO0B 1GZQB 4P2YA 1IT9H 1CD0A 3BDYL 4OCSH 1NFIB 2EC9T 1U8MA 1ETZA 5FO9B 5F89B 1IAIM 3VFSB 4YFEA 2Q1EA 1NAMA 5DD1L 5IW6B 1JGUL 3CVIL 2RIKA 4YZFE 3ZTNL 5F7EL 1KCRL 3HZKA 3EZ8A 2XNAA 3QDAA 4WNQA