1T0MA

Conformational switch in polymorphic h-2k molecules containing an hsv peptide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
278
structure length
278
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title The structure of H-2K(b) and K(bm8) complexed to a herpes simplex virus determinant: evidence for a conformational switch that governs T cell repertoire selection and viral resistance
pubmed rcsb
source organism Mus musculus
total genus 71
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t0mA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1t0mA01
3MRPA 2CDEA 4JFZH 3RIAF 4V1DD 4JCMA 3V7AE 1QHOA 3NPZB 2AV1A 3WLBA 5F3HB 3S4SA 2WBWB 2N7AA 2CLZA 1DCLA 1S5IL 4CAGA 4P2RE 4PUBH 2BRRL 4PJDA 3QRFM 5A16B 4WNQB 4MJ2A 1PAMA 4WWKC 1YN6A 1TQBB 5TDPB 2A77H 4H88L 3CDGA 2NY2C 4WHYG 4L4VD 1P9MC 3LKSB 4PJIF 1OCWL 2MFNA 1UCTA 3O4OC 4JN1H 2FX9L 3V6OE 2CIKA 2P5WA 2GEEA 3LMJH 4NUGH 3HE6D 4NKMB 4QRPB 5JW3L 1A64A 3NN8A 5HPMB 5IVNA 2MQCA 1U8PB 3QQ4B 4JY6B 3TV3L 3QDJA 1S9VA 3OR6A 1FE8L 4TSAH 4WV1B 3IFNH 3A6CH 4AEFA 1HDMB 1I1AC 4G7YH 4DAGL 3IDMB 1UJ3B 3TO4D 1T1WB 4APQA 5EOCJ 1T2JA 2GUOA 3SDXE 5C70A 4IRJC 4F9LA 5CEXA 1II4E 3D9AL 4YUEL 5TH2A 2NLJA 3SPVB 1A7OH 5DJAA 4NSKA 2DQFA 2IBZY 2R39A 3HI6H 2QR0B 4IS6B 4MNGA 4NO5A 4U1HA 5ANMA 4L8SB 4NGHL 2WIMA 3L5IA 4OM0L 2VXUL 1T6VN 1R5WA 4XVUD 3BRFA 5C8JA 1A1MA 1MRCL 4LNRA 5DFTA 2UY7A 4X4XA 5TQ0H 3MLYH 2A1WH 2XA8L 3QI9D 4LCCA 1EEUA 4RDQG 3WS3A 3HN3A 4KK8C 4WFFE 4WI2A 4JFYB 4EDWH 2VQTA 4CJ1A 3B8SA 5ILTH 1JGVL 5EZIL 3PGFH 1YEGH 3AY4A 3PWPD 2W9DH 3VXUB 1INQB 3ZKQD 5EBMB 5DLMH 1P69B 1VEMA 1QVOB 3O4LD 1JGDA 1I4FB 5A3ID 5DUML 3CVIL 2NY4D 1J1XH 3K7UA 3U7AA 4R2GC 4A2MA 1FZJB 4M00A 2J5LC 4E5XB 2X4NA 4YHML 2OQJA 1W72H 3DX6B 2P43B 2JJWA 4K71B 4IJ3B 2C9AA 1MLCB 4BZ2H 3QJHA 5FO7B 3VG0H 3SKUD 4K7PH 3OR7A 1ZV5A 2X4SB 5ICYA 3V0AC 2X4TA 2X7LB 4JGJA 5GSVB 3FB8A 1AP2A 2FH6A 4HJGB 3FQNA 4FZ8H 5HHVH 1QP1A 4I3SL 3RKDC 1WZ1L 4XAKD 4J4PA 5L6YL 2XG4A 3LIZH 1MCPL 1XIWB 3DX8B 5CMAB 3P4OB 2WUCH 3STLB 4TVPD 8FABA 4N0YH 5J57B 5FOBB 4X7CC 2MTPA 1JNNH 1KCKA 4JO4H 1HZHL 5DO2D 1MI5D 2ENYA 4NM8L 4U6HA 1XZ0A 2IAMB 3KLSA 3PP3H 1BVLA 5DD6B 1IAKA 3VXOA 2WWMD 4FFWC 4PTTB 1TITA 1M7DB 2AAVA 4ZG1A 4P3CL 3HMXH 3RZCC 3LH2H 2YWYA 4HDIB 3BN9C 3DUUB 4BZ1L 4V3EB 3EGSB 2HTLC 1GGBH 3GKWL 3PNWB 1L0QA 1TVDA 3AB0B 3BFOA 4GQ9H 5FYLE 2R56H 1MH5B 2P44B 4P23A 5L8KB 1U8JA 3DO7A 2AJZB 2VLRE 5LGHH 4P4KB 1S7TA 3TN0B 1LP9B 1UA6L 5KSBF 1S8DB 2JJSA 3MRJB 2HP4A 4AT6A 3OHXA 1E4KC 3I50L 1OGAD 5CEYA 2DQCH 3QUKA 1YEDB 2X4RB 3HNVH 4JFED 2FJHA 3RZWA 3BP5A 3UZVB 1MRDH 4DVBB 2EKJA 4YDIL 2XZZA 3O2VL 3R0NA 2XQYG 3UPAA 1TZHB 4O5LH 2DYPD 4JPVL 2FLBT 2N1KA 4GXUM 2YZ1A 1FDLH 4PJAB 4E41B 1U58B 1NUNB 3UTSB 1I8KA 4MAUL 4HIHB 4XB7A 1RI8A 2B7DT 1ZA6B 1ZT1B 4YXHL 3EJZC 4OT1L 1TJHL 5ADPL 1X5KA 3ILPB 4OV5A 4L3EB 4TQEH 1A7PH 4ISVA 1J8HE 3L9RB 4K8RC 1MNUH 1D3CA 1OP5K 2UWEB 3M07A 3OKLA 4L8SC 5JDJA 1LK3H 4IMLA 1JTTA 4P4RA 5F71A 1KJ3H 4CADB 1WBXB 3EHBD 5DEGA 3W81A 1YPZE 4QRQA 5IVXE 1OD9A 4JZJB 4Y4KC 5IMLA 5DJ2B 2WBJA 2ARJB 4WU7A 2Z8SA 3OXRA 5E56A 4EZMA 1AO7A 3T04D 1IGTB 1FNEA 5FA3A 1V3KA 5EOTA 1MWAH 3UJJH 3MODL 4KJPD 3QG6B 2LTQB 3BXNB 4Y4HB 1G7PB 3VFTB 1JPSH 2W0LA 1NDGB 3QJFB 3O81A 5DMIH 3QYCA 4LLAA 4YAQA 4G42A 2ZUYA 3QXDB 3U7YH 1JPGA 3S97C 2B1HL 2VDRH 2DLEA 5IEKA 4FN0A 3B5HA 2FWOA 4OZHF 4LLMA 4GAYA 3H3KA 2VXSL 3HNTH 3V52L 5C0CE 4W6XB 4BYHA 1JPST 5F7UA 3MJ7A 5MP6L 3KPRA 3Q48A 4HFWB 1DBML 2DQHH 5CCKL 5HVHB 2NY7L 4G6AD 1I8LC 2WLZA 5DHYA 3SE3A 4ZODA 1VSCA 4Y1AD 4NZUH 4YC2B 1KXTB 2NXZD 5D2NB 4LVNB 4JHWL 2ICEB 1QQDB 5CEZE 3WCYA 3QUMH 4PV9B 4F58L 2V9TA 2ADIB 1NAKH 1C12A 5LGJB 1BIHA 4Q9RH 2IEPA 2DI7A 3GRWH 4HWEH 5D7LD 3LS5L 5EZJA 5IMOA 4YFEA 3CZFA 4JFDB 4U6VL 5D7KD 3VXSE 2W0FA 1ZA3A 2JLLA 3HLAA 5EBGA 3T0EE 5EIIA 3WFHA 3SQOL 4XNQA 2YRPA 4KXZI 1ZLSH 1MJ7L 1A2YA 2YD6A 5JMRA 4OKVB 2FH8A 3FQUA 3B9AA 3BT2H 3MC0A 1RUQL 4BH8B 2R1XA 1NCAH 4KKLC 5FYKL 3A67H 4YFLI 6FABH 2G5RA 4R4ND 4HUUB 1T89C 1HYSC 3M1BA 4LFHG 5HI3C 1YY8A 5IW6A 1EFXD 4FFYL 2ED9A 3ULUH 3EDDA 3LRHA 4FQJL 3AREA 4WW2B 2BRQA 3CFEA 5E6IC 5DJZA 3V0VB 2BXZA 3JTTB 4F7EA 1N6QH 1I8MA 2H32A 5LKNA 5B39G 1CYGA 4XTRC 4MWFA 1BFVL 1P7KB 4UINH 1IEHA 2A38A 1RIVL 4ODXB 3U46A 3W0WE 1UGNA 4N8CH 1MCEA 4XMLL 1G7JA 3QWRA 1L7TH 4DWHA 5IB2B 5EU5B 3QUZD 5E4EC 3VWJA 5D1QC 2BMKB 2C1PB 4JY5H 3IF1B 3L3IA 3MOBH 4PR5A 1CS6A 3G04B 3UTTB 5DXWA 4PJXB 5DA4A 4FQIL 4Z8FH 3I6KB 3ES6A 2YXFA 5I1KL 2YPLD 2DMKA 2VDNL 4I3RL 3X13B 4F15C 3MBXL 1DQTA 1LQSR 3F8UB 2VITA 2EC9T 1HSAA 3OF6A 3S5LG 5EU6D 2EYTA 4KY1L 2A9NH 1CGUA 1QSED 4M6AA 4Z7WE 3MRPB 5AAWA 5EC2B 1HH6A 4WEBL 1DQLL 2GTWA 4MLIA 2AV1B 3S4SB 3NACL 2CLZB 3HE6C 2YMXH 4NQDD 4H1LA 5J9PA 3RPIB 4PJDB 4PRID 4P2QD 1EEZA 1YN6B 4LAQH 3QFJE 3CDGB 3CVHH 1YEKH 2V5SA 5CGTA 1KTKE 1YNKL 2HKFH 3QEQA 1HH9A 4K3DL 1RZFH 4XPTH 1VA9A 2CIKB 3EOAA 5I0DA 5I1GL 3UYRL 3T3ME 3NN8B 5KS9E 1KPRA 3I9GL 1FVDA 1SJHA 3D25B 5T1KA 1BP3B 2J4WH 1T2QL 4FHBD 2NY0C 3QDJB 4IRSC 1S9VB 2VKXA 3IAQA 1QO3A 1A6AB 2NY3C 5HYFA 4C56D 3GBNL 2IH3A 4EIGB 2HJKA 1OTUD 4A6YH 3G5YA 3MOQA 1X5AA 5JR1H 5J6GA 1P7QA 4APQB 5T1DH 3T2PA 2GUOB 1CFVL 5GZNC 1MCHA 1XCTA 2XXCB 3IRPX 4OQTL 1G6VK 4XVUC 4EOWL 3BIKA 2AK4D 5CEXB 1U3HD 5TH2B 1VFOA 1DQQB 2NLJB 5F7LB 1QFHA 5DJAB 4QHMB 2DQFB 3C8KA 4LIQL 5CZVL 4LBEA 2AJUH 5MEND 4MNGB 4U1HB 3WUWG 4R4FH 4HXBH 3ZHDA 1F4XL 3CLFL 1FFOA 4YEEA 4ZO7A 5C8JB 1RIUH 3MLXH 1JZ6A 2NY6D 1H5BC 4X6DE 2GY5A 4LNRB 4RMUA 2NY1D 1IC7H 3AAZA 4LOUC 2O5ZH 4GKZA 5IB5B 3VXRD 4X4XB 5GS0H 1LQVA 2B4CL 3FN0L 3NZHL 5A3IC 3GMLA 5HVFB 1QFWI 2B0SL 4DKAA 4LCCB 3WFEH 1BD2A 4P2CG 5DURD 3WS3B 2QADD 4RGND 4WWID 1CD9B 5L0QB 3S37L 1I75A 4EN3D 5GRJL 1ETZB 4WWKA 1D5IL 1JGDB 5ABDE 3V4VL 3INUL 3IXTB 5HYSB 5EUOA 1MVUA 3LPFA 2X4NB 4XPAL 1OW0C 1TVBB 3BGFB 3H9ZA 4NYLA 5C6TH 4WUUE 3FFCE 3WHE0 1MHCA 3QJHB 5I18H 1CD0A 3OR7B 1B6UA 2FJFA 5ICYB 2EIDA 4X6EA 3KXFA 2X4TB 1TXKA 5B22A 4KKCD 3GM0A 1Q9LA 3FB8B 4R90H 1RULH 2EZ0C 5GJSH 3FQNB 4LHUA 2CK2A 2FD6L 1PDKA 3ULVH 3VI3E 1E6JL 5D7IA 3PJSA 1RUPH 3CMGA 2ZUQC 2DKMA 3RU8H 8FABB 2HH0L 2NYYC 4XWGH 1FG2A 2APTA 3UBXG 4U6HB 4P5KA 1XZ0B 3FOMA 2UZIL 3FB6A 3K4AA 2IMNA 5T1LD 3CJJA 1AGFA 3NIDE 3O9WC 4WFGD 1G9MC 2AXHA 3VXOB 1IAKB 3REWB 3H42L 3O2DA 1KTLA 3VXUE 2C4XA 4L4TD 3RY5A 4HS6B 4MA1B 3RGVD 2VXVH 3SGEH 1VPOL 1BQLL 2Q87A 3EFFA 3QIBD 5J6HA 5F89A 2EEBA 3K1DA 3RVVD 5DMGC 4P46D 4P23B 4K9EC 3WKMH 3WE6A 1MFDH 3VXME 1U8JB 5E8NB 3DO7B 1T03L 1RUAH 5K9QI 1S7TB 4S0UC 4DK6A 3RDTC 3U82B 4AT6B 3I2CL 1DBJH 1RIHH 3O2WL 2VDLL 3OHXB 1VHPA 5CEYB 3N0PB 5DK3A 2CLVA 3ZT7A 3QUKB 5EDXA 2E9BA 2FJHB 3BP5B 4ORGA 1QKZL 3DETD 3D48R 3GSUA 2FEEI 5JZ7C 5EBLA 4DQOL 1G0DA 3QNZA 1NPUA 5IB3B 1NLDL 1QSFD 1DEEA 3WSQL 2DQDL 5JW4Q 4V2BA 4KDTC 2Q20A 2ORBL 2BVPA 5DFVC 4QGYA 5EA0L 4I0CC 2D4DA 4CMHB 4JVPA 4XAWH 1U93A 5CGMA 3H0TA 1MHEA 2FZ3A 4K7PY 5C0EA 4OV5B 4ISVB 1RUKL 3DARA 3NIFF 5E08H 5IBTH 3OKLB 1BQSA 1SJXA 2JIXD 2IAND 4P4RB 4KJPC 3UTZB 2VR9A 2GKIA 5I8CA 2Q8AH 4PV8B 3S34H 5DEGB 1LP9E 3TWCH 5I6XC 4OZGA 3MRIA 4Z7VA 5IMLB 3LAFA 1KV3A 1OAYH 3AS2A 4WU7B 3OXRB 3D3VD 1C7SA 3R8BB 1BFSA 1I1RA 5EOTB 4WFED 2E7BA 4WIQA 1XGPA 5FM4A 1TENA 2DTSA 2ZOLA 4XP4H 4M7LL 4MB4A 4YAQB 4G42B 3MRQA 1AGCA 1RURL 2XRAL 1RQ5A 1N26A 4XB8A 5IEKB 1ND0A 2FWOB 4PJBE 4Y5XA 5C0NC 1FBIH 2NXYD 3UTSE 1NGYA 2YUXA 4GAYB 4RZCA 1F2XK 4G6KH 3F7QA 3MUJA 1T5XA 2EDDA 4XCCL 3FFDB 3MJ7B 3BPOB 3KPRB 1KB5L 3FHQA 1FPTH 4ZAKB 1V7NL 4Z7QF 4S11A 1T0NA 3VXNA 3W11D 4RAUB 1JFQH 5SWZD 5DHYB 1XGYL 4XC1L 4OLYL 4G6JH 1B88A 3GSNL 2FHFA 5C09E 1JV5A 3MV7E 3GMMA 4HWBH 2R2HA 1R3IL 1C12B 4HCRL 5A40E 3T0AA 3ABZA 3SO5A 4IHOA 1AQDA 5HHME 5EZJB 5IMOB 3CZFB 4EDXA 2PYEA 2VE6A 2W0FB 4M5ZL 5C07E 2CDGA 3HLAB 5EIIB 1GOFA 3RX8A 3RUGE 5K9QG 3R4DA 5CJ5A 4X7SL 5J8OA 4OCSL 2WUBL 4JFFA 2PW1A 3FQUB 3O8XD 4NQCE 4JO3H 2R1XB 3X3FH 4RMTA 5GGTA 1VESA 3P3YA 3V95A 1BF8A 1JZ3A 1KIRA 1NUGA 4XBEH 3S7GA 3QCTH 5HDQL 5TFSL 1OWRM 3M1BB 4DUVA 2JB6A 3VXPA 1N59A 3L7FA 3AREB 4U1LB 5LWYL 4OFVA 3CFEB 4YHYC 3MBED 4JKPH 5J12B 4B50A 5A1AA 1NMBH 4F7EB 4JO1H 5F7DA 2H32B 4NQED 4PJCA 4MWFB 5FA4A 1CZ8L 3KYKL 2FGWH 3Q5YA 3U46B 3QDGD 5F9OH 2ICES 1G7JB 1UJTA 4G8FA 5EZOH 5C0FA 5JOPD 4PJHA 3MJ6A 3IFLL 3GBLA 4M43H 3D5OF 1VFBB 4JFDE 3L3IB 4XVJL 1EO5A 5DT1L 4PR5B 2K7QA 1G7QA 4WI9A 4LCYA 4UBDD 2Y6SD 4BFBD 1YMMA 5E2VL 1I8LA 3ES6B 3ZDXE 4GSDL 1E4XL 5C0AA 2JTDA 4K3HA 1MCDA 3H9SD 1BZ7A 3WIHH 5HDBE 4FXLA 4NRZA 4L5FL 3U9PH 3MRDB 5J11B 3OKYA 2VITB 2EYTB 3S37X 2DM3A 1NJ9A 5LXGH 1U8LA 3CPLA 4U3CA 5CJXA 5FYJU 4FZEL 4OD1L 2F5AL 1HH6B 2P8MB 4X4ME 3VH8B 3PV6B 2GJ6D 5DR5H 4H1LB 5J9PB 3C6LB 1PJ9A 3JWDL 3H7LA 4M6MH 2BHYA 2YD2A 4JM2C 1EEZB 4BZYA 4LLUA 1J87A 4BKLB 1PW3A 5C2BL 4YHOL 1NGPH 2AGJH 1I9IL 1HH9B 3REVB 1YEEH 2VYRE 1K3IA 4JVWA 3EOAB 4O58L 5FYJH 2HFEA 1MJ8H 4I0PA 1DLFH 5IBLD 3U7WH 4M1DL 2FJGA 5KOVC 2X05A 2BCKA 3QSKB 4MYWB 1FVDB 1SJHB 4LPXA 1MIML 3WO4C 3S96A 4K3EH 4XNXL 4KFZC 1QO3B 5J56B 1I7RA 3VJ6A 4PY7A 4QRRD 3UC0L 4GG8A 5IW1A 2HJKB 1S7WA 1NGXA 2WSKA 4M48L 3G5YB 4JCLA 1LMKA 5J6GB 1XCTB 3D85A 3ZLQC 1UKTA 2P5EA 3CXHK 1P53A 3BIKB 3EFDL 4MD0B 3G6JA 2OK0L 4KHTH 1MJJA 3UDWA 3C8KB 1C5CH 5I1JH 1FN4A 3RJQB 3WN5A 4V1DA 2NPLX 1V7MH 2J6EA 4G8EA 5HPOA 2H9GB 4F3FA 4PYGA 3LDBC 1QYGL 4KQ3H 1S9WA 4HIXL 4NN7B 1A6UH 4M03A 5BS0E 1XCQB 1Y0LB 2EYRB 2WWKO 3QXWA 4PJ5D 3AAZB 4GKZB 1GPOL 3EYVA 3F7RA 4WTZG 4L4VA 4ZO8A 4Q97A 2I9TB 4Y2DC 1BD2B 1CK0H 4EI5B 3RTQC 3Q1SH 5KVGL 3HE6A 4FOMA 3UCRA 1ADQL 4ODHH 5I1HH 2CK0H 5E8DL 4LL9A 1DBBH 3LQAC 4U3HA 1AHWB 3JWNC 3ZL4L 1TNNA 1G6RL 5EUOB 1MVUB 5IHZA 3DMMC 1ONQB 1NCCL 4PRPD 4Z7UE 4TUKL 4NYLB 3GSOB 4NDMA 3TVMD 1CDJA 1MHCB 2DDQL 3C8DA 3TO4A 2YA1A 3C60C 4G8IA 1E4WL 2FJFB 1QNZL 2AS5M 3KXFB 3U36A 3D18A 2XZAL 2LU7A 1Q9LB 2VKWA 5FHAH 1EMTL 4S1SH 3IJHA 2Z31D 3ARDD 3UPCA 4LHUB 4UV4H 1Q94A 4MZ3A 4PB9H 1EUTA 1A9BA 2P7TB 5D7IB 3PJSB 4HGWA 3TJHC 3G5ZA 2GT9A 1OQOA 1JCKA 1FG2B 2B1AH 5EORH 3GBMH 5J3HD 4P5KB 3FOMB 5EOCL 2FL5A 4G3YL 1BAFL 4N9GA 3ULUD 1IGJA 3GNML 3GHEH 2BDNL 1W8NA 1AGFB 2FHBA 5EOQL 4GW1A 2BHUA 3HRZB 1WUNT 1KPUA 2FATH 5IB1A 3QI9A 1YPZF 3HC0A 4Y16D 3SDAC 1NFDA 1KTLB 4KVNL 2YPKB 5IVXF 2NCMA 1BEYL 1YECH 5HHQA 2R2BA 2B20A 3PWPA 2BZDA 4WHCA 1I8IA 4DTGH 3EFFB 3WD5L 1CFSA 5J6HB 5F89B 3O4LA 2LVEA 1NMAL 4GBXC 2HWZL 3WE6B 4HPYL 3MA7A 4QLRA 3W5MA 2H41A 1YEJH 1N7MH 5BMFH 1TETH 3DVNA 2R4RL 5IG7A 4JG0L 1GRWA 3KHOA 4M93B 2Y36H 3T2NL 2CLVB 5F6HJ 3E3QE 3UJTH 3CFDA 3MRKB 3MNWA 3GSUB 1A9EA 2AQ1A 4YZFE 5EBLB 4ERSL 5IJVA 3QNZB 1X5LA 1DEEB 4M8VA 1BQHB 4JO2L 4HFUL 4R8WH 1FH5L 1MI5A 5IT2H 3BPNC 3DX7B 5T1MA 1T0PB 3QHTC 2VC2H 3HR5A 4W4OC 3NCYS 4UT9L 5BVPL 2XQBH 1U93B 2PF6A 1TJGH 1MHEB 2NY5H 1ZTXH 3H0TB 5HY9A 1KFAH 1CGXA 3TYGL 4M6OH 3DRTA 3K74B 1CD1B 1SBSL 3IDUA 3DX9A 4FNLH 1IQWH 2EECA 1U42A 4JQXC 3WJJC 5JHLL 5I8CB 4NN7C 2CXKA 4I2XE 4ZUWA 3DO3A 4OZGB 4OZIA 1MQ8A 3L5WA 3MRIB 4Z7VB 2X1WL 5HYJD 5I1EH 3LN4A 4DJMA 3SHSA 1MCBA 2E27L 1C08A 1JGUH 3VGDA 2Y07L 5DJDB 2EDHA 1RVFH 1MHPH 4M7KH 2ZG3A 3QHZH 4UNUA 1XGPB 4I5BA 4S1DC 9CGTA 1OGAA 4BA8A 1UXWA 3NBNA 4P3WA 43C9A 1RSFA 4JFEA 3DHMA 1JI2A 1HHHA 4G9DA 4N0UB 1AGCB 4QT5A 3V6FB 1ND0B 4FFVD 2DYPA 4PRBA 4Y5XB 5D5MA 5T3ZE 5E8OB 4RZCB 4QF1A 1MF2L 1YDPA 1FGNH 5BW7C 4PBXA 5I30L 2FB4H 5D8JL 5E5UB 5IV2A 2WM0A 5LG1A 4ZFGH 3MGOA 4N5EC 4F7MA 5GS0D 4N1EA 1KSRA 2MCPL 1ZVYA 1T0NB 2CR6A 2B2XL 4XC3L 5DS8A 3VXNB 5A2JH 3L3HB 4ZTOL 4P9ML 4DEPB 3QRGH 1NAMH 2G75A 1JV5B 1MEXH 3QZWA 4BQBA 1FRGH 4X99A 4ELME 1NQBA 3OJVC 1IC4H 1GOGA 4I77L 4QHLA 2HA1A 1AQDB 3MLVL 4EDXB 2PYEB 3WXWL 1IEAA 2VE6B 3LEXA 1OT1A 2CDGB 3U9UA 5E1AB 5FKPB 1WZMA 1RZ8A 5AZEH 2A6DB 4LSSH 4JFFB 5AD0B 2PW1B 4B7LA 5J13B 3DUSA 2CDFA 5IESH 4BM7A 3DYPA 3JUZA 1DL7H 2B4CC 4GKNB 4U0QB 3TEUA 4YGVA 5E99H 2FO4A 1FVCA 5F96H 1KIRB 1JNLH 3ULVD 3RY6C 1P4BH 5L9DH 1F13A 3MRFB 3T3MF 3B83A 4C83A 2JB6B 2Z8RA 1N59B 5KS9F 4MA3B 4LEOA 3BPCA 3HNSH 3U4BL 5D1ZC 2VDPL 4HS8L 3G6DL 3BSZL 2IPKB 3MXVH 4OF3A 1A47A 1F6FB 3HI1A 1AI1L 4PJCB 5FA4B 4H0IA 1CDCA 4Z77A 4Y1AA 3MLRH 4MS8C 4NFDA 1HILA 2L7UA 5C0FB 4PJHB 4KHXH 4YBLB 5GQBA 3P11H 2PXYC 5M94B 2G60H 1FZOA 3HMWH 2EH8H 4M3KB 5T5NG 2VWEC 1G7QB 4LCYB 1CFTA 5JXAH 3ERYA 5D7LA 4GXVL 1YMMB 4GO6B 2D7QA 3GSNB 2QQQA 3F12B 5C0AB 1MELA 3ETBF 1R5IA 3CDYA 1BZ7B 1KN4L 1QBML 1C7TA 3QXVA 2KH2B 1YYLL 3WFCL 2QQNL 3RBGA 4X6DF 4Z5RA 1NJ9B 2ZJSL 3N9GH 3CPLB 3S35H 4XVSH 3WXVH 3ULSB 1X9QA 2CRYA 2B5IC 3OKEA 2AJSL 3VE0A 4LSUH 4OZFH 4NRXA 5E7FA 4MB5A 2YZ8A 5IBLC 5KSAD 4KKAC 4I0KA 3N1FC 1EFXA 2EXYD 2XWBB 5J4MA 1QLFB 4MMXC 1INEL 1GGTA 2HFEB 4R7DB 4I0PB 4CMMB 2FJGB 4OJFH 2BCKB 4ACPA 3LKPA 1Y6MR 2EIEA 1IQDA 1FCGA 4RX4D 3S96B 2FHCA 3QUZA 4OTXH 4K07A 5CIPA 1I7RB 3VJ6B 5C6PB 2QTEA 4GG8B 5IW1B 4YK4B 2X4UA 5J06A 3WFDH 1NGXB 3BUYA 4L8DA 2DQTL 5GGVL 3VI3F 3RA7L 4NKIL 1QBAA 5TE4H 4JVUA 2YPLA 1WTGT 2VH5L 3THML 4BSWA 2FX8H 1PSKL 3K8MA 3G6JB 1X6NA 1MJJB 3S8WA 12E8H 4AIZA 4TRPH 5EU6A 3VW3H 1QSEA 1VFAA 4LVHC 3NIDF 3ZKXC 3ARSA 3WN5B 4RMVA 4V1DB 1J1PL 2N7BA 3JTSA 4DN4L 3BEVA 4G8EB 5FIEA 4F3FB 2D03L 1C5BL 2EICA 1ROWA 1XGTA 1S9WB 4NQDA 5FYKE 5A2IH 3BKML 4PRHD 1QLEH 5IFJA 4PRIA 3LKNA 3NCCB 1QFWL 4P2QA 1SYVB 3EYVB 4AENB 2Y06H 1IC5L 1W0VB 2ENSA 4FTVD 4L4VB 3V79C 1N64L 4Q6IC 2EIZA 4YDVA 4KPHH 2Z92A 2EXWD 3IFPA 4RNRB 4JRXD 3T8XB 3C5ZD 5FAAA 3C2AL 1EJ6A 1R5VB 4PP2A 1I85C 2HT2C 1MY7A 4KRPC 4GMTL 5IHZB 1MFAL 1RZIA 3K4DA 1KF9B 4JPIB 2AEPL 4KTDL 4C56A 1KXQE 1RV6X 2BERA 3IU4H 1IJ9A 4X0KB 5EO0A 4N8PA 1NDMA 1YYMH 2BVQB 2PYFA 2DQGL 4KK6C 4G8IB 1F6AA 1HINH 3CX2A 3D18B 1PVHA 3F6IA 2AK4A 2BJMH 5D71L 1U3HA 5KVDH 4HK0B 5IOPA 3IJHB 1YEIL 2ZPKH 4XMPH 3QUYC 4HJJH 3KWWB 3ROLB 1Q94B 5MENA 4LPVA 1JMXA 3FRPG 1TPXC 1KGCE 5A2LH 4NHUB 1H3PH 4HGWB 3G5ZB 2GT9B 4QNPE 5B8CC 1I3GH 2AERT 4Y2OA 1Y6NR 1H3UA 1T66C 1IGJB 3VXRA 4CVZA 4KK9D 3MJ9L 4GW1B 3B2UD 2BFVH 5IB1B 1KPUB 1LP9F 3QI9B 1NFDB 1NKOA 2ADFL 3UPRA 2EDJA 4MA8L 3BPLC 1CFQB 3MLSH 4RAVA 5HHQB 5ISZD 2F53E 4U1NA 4EN3A 3PWPB 4MDIB 1FYTB 3FMGL 4IOFC 4XP6H 5C0RH 1I8IB 1CFSB 3O4LB 4CRPA 1IC1A 1T2XA 2NY4B 3BD4A 5DK0A 2K9UA 4ZS7L 1UCBL 1IGML 3MR9A 4HUMB 1JN6A 2R2EA 1KENH 2XXMB 3MA7B 4I1NB 5FKAA 1FGVH 2VISA 4PGCA 4LLVA 3B9EA 4XP9H 4UAOB 1K8DA 3DVNB 3F62A 1XF3A 4PJBF 4O9HL 5TQ2L 2R0WH 4NRYA 4QTIL 1FLRH 1ORQA 1HNGA 2CRMA 5IF0A 2FEEL 1FNAA 4M4PA 3CFDB 3CXDH 4AIOA 4HZLA 3M17A 3W39A 4M02A 5MHSE 3OKKA 5IM7A 4LIQE 2F19L 3SCMC 1SYSA 3TPUA 2DJ4A 2XFXB 3BGMA 3NCEB 4OSUH 4POZC 4YDJA 1MI5B 1FJ1A 1I9JL 2VOTA 3BQUD 4JDTL 4NJ9H 3IAGC 1VCAA 5I71C 5T1LA 3HR5B 4ALAL 4G8GE 5D6DA 1RJYA 5HY9B 4JAMA 2OL3L 3DRTB 4MNQE 1P6FA 4QEGA 3F7VA 1S9KC 4HC1L 4FRWA 1QRND 4L4TA 3H8NA 4X7EC 3DX9B 3HI5L 1BOYA 4YLQT 5J89A 4MXQD 4NHCL 3RGVA 1KEMH 3RUGF 2ERJB 3PWUA 1IAII 3QIBA 3TH2T 1XMWA 4OZIB 3L5WB 4P46A 2ZNXA 1A3LL 2CKBL 3MUY1 3DVFA 3GK8H 3EOBA 1C08B 2XZQH 3MJ8A 3TBTB 3JWDC 3BISA 3VWKC 1A7BA 5DWUH 1UXWB 2VXQL 3MLUL 1F4HA 2PTTA 1C8PA 4NN6C 43C9B 4HZAA 1IGFL 1SJEA 1FNSL 3DECA 1HHHB 5D4QA 4G9DB 4L9LA 5HHNA 1MQKH 2CMRH 1BGXL 4QT5B 2DYPB 5D5MB 5D2LE 3BAEH 1QSFA 2WBKA 4QF1B 4QHUA 1PZUB 4HH8A 4LPUA 1YDPB 4KKBC 4CU6A 1CVRA 4GG6E 4KQ4L 3CCHA 5IV2B 4WRLA 3PV7A 3RWEA 4NO0D 1I1FB 1I9RH 2HFGH 1I1YB 4F7MB 4MAYD 1BIIA 2CUHA 4ODSH 1JPTL 1CWVA 5T5FL 4MVBC 1W2KT 1DBAH 1NCBL 5DS8B 25C8H 2F58L 3ZDXF 3PHQA 5B39B 2WMPA 1YEHH 2G75B 2JIXA 3QZWB 5HDBF 2J3SA 4DVRH 3FT4A 1NCDL 3OKNB 2CGRH 4QHLB 3FQXB 2E8ZA 3L3OA 3C09B 4F2MA 1IEAB 3ARPA 3LEXB 3D3VA 5F3BA 1WZLA 3U9UB 4UOW0 1U41A 2M1KA 5JHDE 3HAEG 1YEFH 1RZ8B 4XWOC 2V2WA 3O6ML 3WJJA 4N0UE 2IFFH 3DUSB 2CDFB 3DV6A 4KMTH 1FO0H 1Q0YH 3W5NA 4YGVB 1FVCB 4OLWH 1QOKA 3RL2A 4X9HA 3QDMD 5DJ6B 4HAGA 4Q9QL 3CX5J 4GAGL 1G7HB 1M71A 1P4IL 4C83B 1S7RB 4LEOB 3BPCB 4HKXA 4OZ4A 2I26N 1F90H 1F4YH 2KUTA 3VG9C 5AUMA 3N85L 1U6AH 1YN7B 5FYLH 1UACL 2KZ1B 3PL6C 5IROC 5SWZA 4Z77B 3C08H 4Y1AB 5CKAA 4CVXB 3MACH 2NXZB 4YWGH 1L0YA 1HILB 2H2PD 4OF0A 4ZPVA 1A3RL 4MCYB 4I18C 1TVHA 4ZTPL 2BXYA 2I27N 1FZOB 2VB5A 3C5SA 4M1CD 1SMOA 1QA9A 1F8TH 3TH3T 4DZ8A 1AXTH 4JPKH 5JOFA 5CP3H 5D7LB 1J10A 3GEWB 1BF2A 4BK5A 5D93B 1W72A 4IOSD 1BVKA 3DXAD 4EJ1C 1EHLH 1AJ7L 5KAQG 1D5XA 1E6OH 4UT6H 4Y4FC 4CN1A 4NNPH 5EU7E 5DZNA 4HT1H 3O8XA 4Z5RB 5CILL 2O93L 3LV3A 4FQXD 2XKSA 3TIDB 5F6IB 3ZKMD 2D9CA 3OJDA 4PBVC 3BMWA 2R0LL 2XICA 1M7IB 4XNYH 4KROD 3VE0B 4NRXB 2VR5A 1XT5A 3WUWB 3EYUL 1YC7A 4XCFL 5I8KH 2A9ML 4UTAH 1NLBH 3P77A 5GZOD 3FN9A 4P57A 5HHOD 5IQ7L 3TNMA 1T20B 3VGEA 3MBEA 4XX1G 4D9LL 3DI2B 3M8OH 4LARL 4NP4H 1I7UA 2OTPA 2KL6A 3QHFL 4AL8H 5ERWA 1Q9WA 4HUKB 4NQEA 3V4UL 3NCBB 4Z7UF 1CICC 2AABH 1ZK9A 1Q72L 3HMXA 3QDGA 3VGAC 3LKPB 3MQIA 2AJYH 1NC4D 4MQXD 4TULH 2HMID 3FZUC 1EDQA 3QUZB 2WV3A 2BNQD 4HPOH 1CXKA 1F45A 4D9QE 1UZ6E 4KRLB 5KVEH 3GMQA 2X4UB 4IIQC 5EC1A 1EGJL 3GDBA 1CGWA 5BZWA 3CH1A 3H9SA 2P8LB 4BSWB 1P1ZA 1B6DA 4FABL 4AIZB 4KZEL 5EU6B 3RWGA 4G59A 1QSEB 1VFAB 4GAJL 1BVZA 1MAML 4JHAH 3TBWA 3NAAL 4X5XA 3JTSB 1YUHA 3BEVB 3E2HC 2EXWC 2GJ6A 3FO0H 4NJAH 4CBPA 4JQVC 3FO1A 1JFMA 2F54D 4KDVA 4PRIB 5GS3A 5I76A 3LKNB 3UBXB 4P2QB 3H3BC 4JQIH 5DJXA 4RBPK 3SJVE 4OCWH 1UENA 5TGBA 4B53A 5CEZH 4ONFL 1MFEL 4KMQA 2EIZB 4YDVB 3CUPA 3IFPB 4H5SA 5D9SA 1JYVA 3QAZB 1DTUA 1HXYA 2JKXA 3NCYP 1F6LL 3TPKA 4HD9A 2C4FU 2HRLA 3BHBA 5LQBH 1WEJH 1FIGL 1RZIB 5DI8A 3CFCH 4QRRA 4N9OB 2VLKE 4YZFF 1A3QA 2PYFB 2R8SL 1MREH 3P2TA 3RVXD 2NR6C 1LEIA 1F6AB 1NGQH 4U1IA 3G9AB 2DTMH 4EUPH 4QWWD 1MWAA 4XNUL 1X4YA 4JRYD 2AK4B 1U3HB 1BZ9A 5E1HB 5ID1A 1Z9LA 2OP4H 2QHRH 1ZXQA 2HG5A 3HPLA 5EIQA 5MENB 5MI0B 3WFBL 1QRKA 1TTUA 4X9IA 4NWUH 3CFKA 3WFZA 3BVNA 2YA0A 4JDZB 5DC4B 2VDOH 3QIUB 4JG1H 3TFKD 1SM3L 2FX7L 2NY6B 3BKYL 1UM6H 4PJ5A 4EBQH 2NY1B 3VXRB 4CVZB 1CE1H 4OLZH 2AKRA 1IKNC 5I2IB 4QRTA 1IBGL 2ZUVA 3WIIH 3ECBB 5DURB 3UPRB 2QADB 4RGNB 5DRWA 5INCA 3ARBC 1U8QA 3RP1A 3U0TB 4RAVB 5LAXA 3X17A 2Y5TA 1QFWM 4U1NB 4EN3B 3TA3C 3SDCD 1CIDA 3GSWA 4QHNB 3STBA 3X12B 3OPZH 3QCUH 5FGBA 1N5AA 4Y5VB 2BY3A 5DK0B 3QUMA 2ZG2A 3MR9B 1JN6B 4S0SD 4OGYH 5F7FA 4UTBL 4Q6IA 2VISB 3T2QA 4KK5D 4PGCB 4LLVB 4PRPA 5GHWL 3GRWA 2GY7B 3TVMA 1K8DB 3TJEL 1ZS8B 3ZTJH 4NQVA 5GGUB 2BVEA 4NRYB 2X4QA 1UVQB 5IF0B 1ZVHA 2ZG1A 4NHUE 4HS3A 5I19H 2Z31A 3ARDA 5F1NB 1MRFL 4HZLB 3M17B 3W39B 3PDDA 4NZTH 2CJUH 1GGCL 3OKKB 5DD1L 5IM7B 3IKKA 4J6RL 3A6BL 1KJ2H 3VDCA 4L1DA 1T6WA 3TPUB 5IGXH 4YDJB 1FJ1B 3T77A 2F8VA 5ESQA 4OLUH 3WHXB 1KTRL 3GIZH 1WFOA 4C57C 5GRUL 5AWNL 2D0FA 4YBHA 2JK5A 4XPGH 3MLWL 1VGEL 3QQ3A 1UADC 4ELMF 1G1YA 3OXSB 4LKXA 4OIIL 4JM2F 2R0KH 3BIAX 4WUKL 4Y16A 4QXTA 1FYTE 3R1GL 3F7VB 1WAAE 3B9KD 1OPGL 3TF7A 4L4TB 1Z0NA 3HUJA 1SHMA 5CD3A 1ACYL 3RGVB 3UZEA 3FN3A 4K3JH 3PWUB 4JREC 5FFLA 3QIBB 3HG1D 2YK1L 4P46B 1OB1B 1KT2A 1DBKH 1CDYA 3S3SA 3CFJA 3IDJA 1KTDA 3MJ8B 4OD3H 2DD8L 3QQ9D 2EYSB 3JV5A 3NABL 3FQRB 1IT9H 1FHGA 3IDYB 1JHLH 4X7DC 2PTTB 3E8UH 3ZE1E 4WFHD 5I0ZA 4QOKB 4Q0XH 4BFIA 4LVEA 1A4JB 5DDHB 4L9LB 5HHNB 4HF5L 3K0WA 4MAYC 1Q1JH 4OGXL 4XVTH 2J8UA 4CGTA 3L5HA 2PO6D 1QSFB 3T4AA 4QHUB 4X6CB 5D72H 5I17A 2G5BB 4Y19B 3U4EB 2BOBA 3ARFD 3FB5A 5AYUH 3CCHB 3C2SA 2PKDA 3RWEB 1C5DA 3LZFH 4H0HB 3QR2A 4ZOAA 5D70H 1KULA 3WLWC 3UO1L 3ZZ1A 3H3PL 4AG4L 3RVWD 4U05A 1MOEA 1ZLUH 1KNOA 1MIEL 5HGDA 2RCSH 1TFHA 3PHQB 3LKOA 3S88H 1J5OH 4U1MA 1OARH 2JIXB 1D6VL 2IANB 3DPBA 4G9FB 3ZT6A 1H3XA 3PE9A 4FXKA 1NSNL 1WWWX 1XR8A 2ARWA 4K8RH 2DL2A 5HYJA 4F2MB 5F3BB 1A6VH 3OAZH 4A6YA 3SKOA 3EO0A 2V2WB 4G5ZL 4RGOH 1JTPA 3DV6B 5K33A 3DIFB 2P8PA 5GGTH 3MROA 2OTUA 3DVGB 5KG9A 4M1GL 3DHJA 1M05A 3S4SG 1JZ7A 3EUUA 4NPYA 3RL2B 4Y5VC 3MV8E 2NXYB 5CGYC 1J0ZA 1M71B 5DF0A 2W92A 3MXWL 4HKXB 4OZ4B 4XGZB 2X9XA 5EO1A 3SGKA 4MHHG 4FQPA 3MCKA 2H2PC 1JWUA 2H2SC 3MX0A 2V5RA 3WEXA 1IKFH 4J8RB 1XF4B 4M1CC 2V9RA 3V5HA 1N0XL 2DM4A 1Q0XH 4PJFA 1MCWW 5CBEA 1UYWH 3Q3GA 1H8NA 2E7HA 3VFMA 4H25A 1WF5A 4ZPVB 1TVHB 4HWUA 1G9NL 3AROA 4CUCA 1QA9B 1A6PA 1GGYA 5JOFB 3OKOB 4LP5A 3MV9E 2XTJB 4JHBA 2XY1A 3ILQD 1W72B 1BVKB 5C08D 5D6CA 5GGSY 3HS0B 1HQ4A 3UMTA 5HJ3B 1XR9A 2IWGA 3D39E 1EHAA 1XEDA 5IK3A 5I75C 1CL7H 1SY6H 4JDVA 5JQ6H 2IPUG 2SEBA 1RUMH 2FECI 4PJ7B 4LSVH 4P59H 4P2RD 2DMCA 2C3HA 2XN9E 3OJDB 1F02I 1CLOH 4J3TA 4U2YA 4FG6C 4PJ9B 3ZE2E 5ACZA 5F7EL 3DURB 3VFSA 1A14H 3P77B 4P57B 2VTFA 1AE6H 1PEZA 1X6LA 3I02A 4MQXC 1JBJA 3MBEB 2JJTC 3EW3B 5C0JA 4HKJA 5ERWB 1Q9WB 4M3JA 4NQEB 4OB5L 4GMSH 4NM4L 1Z3GH 1X5ZA 2YXMA 3P0VL 2R69L 4M5YH 1BOGA 4GOSA 2WANA 1HSBA 1RY7B 2A73B 1UT9A 5CJOL 1ED3A 3SKJL 1FCCA 2OZ4L 3SOBL 2IG2H 2ATPA 3FL7A 5BZWB 3JWOH 4QNPF 3CH1B 3ARGD 1QBBA 3H9SB 3KYAA 5I8OH 2E7CA 1TZIB 5IFHH 4X80L 3BDYH 3RWGB 1L9NA 4WEUD 4LLDA 4OCRH 1OAQH 3GSRA 3IGAA 4YE4H 2QQLL 3TBWB 4L8BA 4X5XB 2NW3A 1YUHB 2OMBA 2GTZA 2WQ8A 3LEYL 5SX5H 4F57H 5C7XL 2YRLA 1RJCA 2GJ6B 5KSAA 1F3DH 5EU4A 2W0PA 4YDLC 3WNOA 3FO1B 3ME0A 1JZ4A 4WEMB 5I76B 1CGTA 1SJVA 3FB7A 3D0LB 4Z7OE 5DJXB 4NC2B 5TGBB 4OM1H 4PD4J 5C3LD 5I9QC 1LO4L 3WBDA 4C4KO 1QZ1A 4Z78A 1UXSA 4YHLL 3PDOA 3AMLA 2NZ9D 3CUPB 3LD8B 3MRCA 4O2CB 5I74C 5D9SB 2V2TA 4KC3B 1T7XA 1HXYB 3GIVA 2DQIL 4RX4A 3VD5A 1KBGL 2AEWA 3H9YA 1JF6A 2VERN 4LCIH 1X4XA 3R06A 3V4PL 3VFPA 2BSSB 5DI8B 1EIBA 2X1QA 2X40A 4QRRB 4HGMA 4JN2A 4HKBA 3OWEA 4LLYA 4D0CA 5BRZE 1LEIB 2MCG1 4XP5H 1VACA 4XZUB 1PY4A 1MWAB 4LMQE 2DOCA 1CR9H 3C6SA 4BUHA 3ZKNC 2EH7L 5KTEL 5ID1B 3HPLB 4UB0H 3K2UL 5E00B 4NCC1 4IIQA 4C58B 5BVJA 2V2XA 4LLQA 3CFKB 4OF5A 4QXUL 4WO4D 3MZGB 4EQ3A 4XMKH 1YNLL 2JCCE 1JGEA 1OTTC 1W8OA 2D31B 3R0MA 4MLSA 5FCSH 3FHAA 4ZXBC 5I73C 2OS7A 2D7OA 4PRHA 3O3DA 1ZWIA 3BN3B 4MCZA 2J88L 4PJ5B 3RBSA 1T21A 2AKRB 2R0ZL 1WWCA 4KI1A 2CSPA 1N6VA 1PG7L 4LF3B 4FTVA 4QRTB 4UILH 2UVEA 2E3VA 2D7NA 2XT1B 1HQRA 5INCB 5DRWB 1P84J 1U8QB 1E27A 2PR4L 5LAXB 1WWAX 5FYLD 2ILLA 2Y5TB 4PJIA 3QWRD 4JQVA 5T3XL 4JRXA 5AG9A 3BGAA 3C5ZA 1HKLH 3GSWB 5ALBL 1U3ZA 5IVZA 1GH7A 1J0YA 15C8L 5HHXH 3MA9L 3O6KH 5CJQL 4QGTA 1N5AB 1HYRC 4WI3A 3QUMB 4PJEE 4MJIE 5EBWA 4UIKH 4PRPB 3NGBC 3PQYB 4WGWB 5IMMA 2O5XH 3TVMB 4QRSA 4D9RE 5CZXD 2F9BT 5D2LF 4NQVB 5GS1C 3TT3L 1F4AA 2X4QB 4CNIA 1OAKL 4HMDA 3IJYA 1EUUA 5E2UH 4GG6F 2FIKA 5L88H 4HS3B 1TIUA 3IJSA 3RWDA 2Z31B 3ARDB 5SWSE 2O5YH 4P2OB 4CU7A 4MXWL 4LCWB 2MQ3A 4TVPH 4DGIH 1MCKA 3QEGH 2CH8A 5DUPL 1RU9L 3LS4L 1JRHI 4JPWH 1TZGL 4PBWD 3T77B 1HN1A 5ESQB 2ZP0T 5H2BA 4J2XA 5IFAH 1NL0L 4O4YL 3IFOB 1A7RH 1J8HD 3QEQD 2JK5B 4Z95H 2HFFA 5IMKA 2H26A 3B9DA 5ETUA 4LGSB 4LKXB 4XPFH 2LABA 2W9LA 5GSRB 5CAYB 4Y16B 2B8OT 4L4JA 2A2QT 4S1RL 4GW5B 4O00A 4OCXH 4DN3H 4N5UA 3HUJB 1IAIL 5CD3B 1N4XL 5ISZA 1S9YA 2VQUA 1G9MH 1MFBL 5JLZA 3UYOD 3QQ9C 1FFPA 1IKNA 4Z18A 5CP7A 4ODTH 2E7LA 2VMFA 4JB9H 1P7QD 4U0RB 4ORZC 4FQ2L 1KPVB 4B41A 1OSPL 3GSQA 3SGDH 2XWTA 5CBAA 1FAKT 3VFGL 2OI9A 3O6FD 3Q6GL 3IDJB 1KTDB 1BBJA 1OM3H 1ITCA 3T0DA 4K9EH 4H20L 3WIHA 4LSRH 2V7HB 1FL3A 4H26A 2VDQL 2VXTH 5F7KC 5IBUG 4GRWH 3WNNA 4WY7L 5I1CL 4BFIB 3EYQC 1RK0B 5E2TL 4I4WA 4M6NL 4XNZC 5C0CD 4NKQB 2V7NB 5E5RB 3ZYIA 1Q9OA 3AU1A 3T4AB 4MJ5B 4POUB 1R24B 1NBQA 4LU5H 4AEHL 1CTOA 4HXAH 2BOBB 3EYOB 3LPWA 1GIGL 3FB5B 3PDGA 4TUOA 5JW4R 3LB6D 4TPRL 5D1XD 1C5DB 2GFBA 3BQUA 1RFDL 2BC4A 4AIXA 4L4TE 3CVHB 4ZUSA 2YD9A 5JA9A 1R0AL 5KVFL 5CEZD 5HGDB 5JXEC 3LKOB 5DRNA 1QRNA 1BM3L 5DJCA 3VRLE 2GITA 4MXQA 3WS6C 4JKLA 5I16A 4RA3A 2E6QA 4LRNH 2AQ2A 3VXSD 3VRJA 1LO2H 2C3XA 3T0ED 4FXKB 2Z4QA 5DVKA 1JF1B 1F58L 3IDNA 4NZRL 3NCJH 1CF8H 4LLWA 5HYJB 1FORH 3N1MC 4AY0A 2FEDD 4A6YB 3FQTB 5B3NA 4GUPA 4QOKE 5F7HA 4F7TA 2P8PB 3MROB 1I3RA 5KSBA 2OTUB 1J1OL 1I1AD 1OP9A 1KLUA 4X6CE 2IPTL 5MEOA 4LAJH 4H1LG 1A1NA 4Y19E 1S5IH 2BRRH 4IRJD 2GCYA 1IM3B 3BP4A 4H88H 4HIIB 2HVJB 5EO1B 4PJGE 5JPNA 3MCKB 1JWUB 1OCWH 1ZLWK 5FV1L 2FX9H 4NO0A 1UQSB 3W0WD 2H3NA 4MAYA 4X6FA 3ZHKA 1J8KA 5JW3H 1UZ6F 5F1OB 2IANE 4PJFB 5CBEB 3Q3GB 2I24N 4G9FE 4YH6A 3TV3H 4H25B 1GOHA 1K4DA 4URTB 3F7PC 4L29A 1VKXA 3OMZA 3QDAA 1FE8H 1UB5A 3L5XL 2V5MA 3HE7C 5AAMA 1AQKL 4DAGH 2Q6WB 2X09A 1D9KC 5IIEA 4KK8D 3O0RL 3GKZA 2G9HA 3UTPE 5D6CB 3D9AH 4W4NA 4YUEH 1I7TA 1XR9B 2VZUA 5IK3B 3U1SL 1KC5L 2F74A 4JDVB 4R2GD 1KEGL 3GJFH 2NMSA 2SEBB 1XF1A 3DSFL 3SY0A 1ZHKA 2R4SL 3FONA 4NGHH 1UM4L 4RDQF 4OM0H 2VXUH 1W0WB 4L1HA 3QDMA 3QFJD 4DOHE 1MRCH 5ACZB 1T1ZA 1Y18A 3CMOL 3SGJC 5D7JC 3VFSB 1HKFA 1AR2A 2XA8H 4WI5A 1QSZA 2Z35A 4OZHA 3RHWK 3I02B 3ARZA 2P1YA 1WIPA 5GRXG 5C0JB 5I15L 4OI9A 1JGVH 5EZIH 3UTOA 4CKVX 1BJ1H 3VDBA 4AQOA 2HFTA 4JJ5B 2VZTA 1CIUA 5DUMH 3CVIH 3ARGC 4Q9BA 2GYSA 1HSBB 1JNJA 2XTJE 4YHMH 1NBYA 4FFWD 5DEFA 1DQML 4U1JA 3OKDB 1YJDL 1NKRA 3DTXB 4K55A 3TBVA 1ED3B 3RZCD 5F8RC 5C0IA 5T33L 1KB9J 3BN9D 2HTLD 4P5TC 2ATPB 3DXAA 1OP5H 1PG7X 4PJ7E 5L2KE 1CLZL 4PS4L 3OAUL 4LHUG 3OSKA 4ZFOA 2E7MA 4I3SH 1WZ1H 1AIFA 5L6YH 1JHKL 4FQXA 4LLDB 3U6RB 3GSRB 1MCPH 2MNUA 3AUVA 3V5DA 4L8BB 1CXEA 2OSLA 3IDXL 1HZHH 2GTZB 4NM8H 5KSAB 5EU4B 1JE6A 5DVMA 3FO2A 1BX2B 3MUHL 3FB7B 5HHOA 4EI6A 5FGCB 2A6JA 4TYUA 4P3CH 4A2LA 1JGLL 1OD7A 1I7ZA 5SV4A 4BZ1H 4N8VA 3ZSSA 3QCVL 4RGMC 3PDOB 3GKWH 4CW1A 3MRCB 2V2TB 1MJUL 1G7IB 1T83C 1J05B 2HVKA 2IH1A 3KLAA 1NC4A 5FK9A 4WUUD 3FFCD 5IWLC 2W38A 2BNQA 3R06B 3EJZD 1LEGA 3SDDC 1UA6H 4ETQA 4K8RD 5JO5B 2VN4A 4TSCL 4JN2B 4HKBB 4YHZL 3I50H 4D0CB 1ZHLA 1JPFA 1VEOA 2DWEA 4LGRB 3MSPA 2R23B 4P3DA 3C6SB 4YDIH 1JHTA 3O2VH 4PGBA 2DQUL 4Y4KD 2QJDA 4R97C 2XKUA 4JPVH 1RMFL 5BVJB 3VMPA 2DL9A 2V2XB 1KCGC 4JFQA 5CSZA 1JGEB 2DLIA 4PDCE 1WAAF 4HWZA 4RFEA 2VDML 4NT6A 4MAUH 4PRHB 1GZQA 3O3DB 1H9VA 1ZWIB 1IEBA 2DLFL 4GKSB 3NH7L 4MCZB 2F54A 5FOJA 1T1XA 4YXHH 4KAQL 4OT1H 1TJHH 1ZEAL 5ADPH 1H3VA 4KH2A 4FTVB 3A6OA 5DD0L 5CHNA 5INDB 5FUZL 4FQCL 1E27B 4Y0GA 1NMCC 5FCUL 3KR3L 4PJIB 2FYYA 3IB4A 4JRXB 1RK1B 1RZKL 3C5ZB 3VXMD 1F3DJ 2RR3A 5IVZB 5CFHA 2VDKL 2Z8WC 1NAMA 4JY4A 2HTKC 4IRZL 4BH7B 4NN5C 5GRZA 1EEQA 5EBWB 3ZE1F 4Z0XA 4F9PC 4XPHL 1RZ7L 2XNAA 3MODH 4QRSB 3SE8L 1XIWD 5KBNC 4IBLT 1A0QL 4CNIB 4DKDC 3IJYB 2AI0L 4ENED 4JRYA 2FIKB 4X9GA 2B1HH 3H7BA 3IJSB 3RWDB 4LVOB 5DJ8A 1DE4A 3QIWC 4ZNEE 1MAKA 2VXSH 1G9EA 3V52H 5AYQA 5AZ2L 5IR1A 3CIQA 4GT7A 1FLTX 1IAOB 5MP6H 4FA8A 5EULV 3TFKA 4R6UA 8CGTA 2CD0A 2DJUA 4M7JL 5H2BB 5BCAA 1DBMH 5CCKH 3WJLC 5FM8A 3O3EB 4P48A 3RY4A 4KKLD 2HFFB 1G9NC 2NY7H 4NWTL 2H26B 4YGAB 1J0HA 3L1OL 4Y89A 1HYSD 1G84A 4OUOA 1H3WM 3U79A 4K23L 4JHWH 5HI3D 3OKMA 2Y7QB 5ISZB 3KPSE 2VR4A 4W81A 2BSTA 5E6ID 4F58H 3BZEA 4HQQL 3SDCA 5DJ0A 4XPBL 5FYKU 2PUQT 3B4NA 5JLZB 1T1YA 1FFPB 1EAPA 2ESVE 3LS5H 4RFNB 3PQYE 5CP7B 2ATKB 4U6VH 1C1EL 5DMKA 3I6GA 4XTRD 5HGHA 5I66A 4GRLC 3SQOH 1MJ7H 1IE5A 2XWTB 3I3DA 5CBAB 2OI9B 3GUTA 3PHOA 2ZSVA 3PXHA 2D9QB 1BBJB 5D1QD 5TDOA 1RUQH 3VFNA 2VJXA 1ZGLM 4DKEL 4MB3A 3L3KA 4H26B 4KV5E 1AFVL 1K6QL 2DM7A 4LCWE 2JJVA 5D1XC 4PRNA 5FYKH 1MAJA 3GM8A 3G9VA 1PD6A 1DVFC 1EEYA 1ZSDA 1ZVSA 4I4WB 4NKOA 1Q9OB 4FFYH 5C0DA 3UJIL 4FQJH 5GS1A 4PLOB 1A1OA 5CLTA 3QNXA 4OZFA 4LASL 4TUOB 2OR9L 1A5FL 4OLVL 5FGRA 2GFBB 3BQUB 1PZ5A 1TQCC 4N0FA 1EFQA 1BFVH 4ZUSB 3T0EC 1KYOJ 1RIVH 4X98A 5C09D 3MV7D 3L3JA 2FEDC 4XMLH 1OQXA 2LU4A 3B9KA 4FQ1L 5DRNB 1QRNB 3QUXC 3QXAA 2CO7B 2MJWA 5DUBA 2I07A 1S5HA 4S1QL 1HXMA 2GITB 4RFOL 5HHMD 3FCTB 1CLYL 4O02L 5I16B 3ZO0A 1CN4A 3VRJB 5C07D 4P49A 5SV3A 3HG1A 2Z4QB 4FQIH 3IDNB 3VMOA 3KPTA 4LLWB 2Z93A 5I1KH 3UAJC 2I5YL 1IAIM 4NQCD 4NC0B 2VDNH 4PFEA 4I3RH 3MBXH 4ZD3L 3WNLA 1NFKA 4D3CL 1Q8MA 4GUPB 2NY0D 4KY1H 3ZE2F 4IRSD 2HT3C 4F7TB 4Y5YA 2NY3D 1I3RB 1UKQA 3WNMA 4P2YA 3EYFA 4R0LB 4WEBH 1DQLH 5DGQA 1QACA 1MCIA 5BQ7B 5JPMA 1QFUL 5E9DE 5MEOB 3NACH 1A1NB 1LNUA 2YRZA 5GZND 4OUUA 5F7MC 5C0BE 2GCYB 2PO6A 5SWQA 3BP4B 2CRIA 3HZKA 4YBQC 4PJ8C 3ARFA 3MREB 1YNKH 1VGKA 1DDHA 4K3DH 1U92A 3HC3L 3VRIA 3FJTA 1UB6A 5I1GH 2H3NB 4X6FB 3UYRH 2I60L 3WNKA 2YN5A 3T2OA 4PRDA 4R3SA 3I9GH 4JFDD 5ACLA 4IMKA 4UUJA 1T2QH 4LOUD 4L29B 1HWGB 3KAAA 4HGKC 1VKXB 3L3GA 1CDBA 3TT1L 1UB5B 3TZVC 3GBNH 2ZOKA 5IIEB 4WDIB 2JB5L 2DQJL 1CFVH 3MNZA 2ED8A 3ARUA 4OQTH 3FTGA 2G9HB 4EOWH 4YFLF 3TIEA 1I7TB 2XV6B 1WFUA 2FECL 1FSKB 2RFXA 3G5VA 4LIQH 5CZVH 4ODVL 3SY0B 4H0GA 1ZHKB 5EZLB 5T3ZL 3FONB 1SQ2N 3BKCL 4M8QA 5EPMA 4Z7OF 2GQHA 2VZSA 5JIHA 1F4XH 3CLFH 3KJ6L 4FQQA 5SX4I 5JTWA 5JNYA 1KCRL 3IU3A 1QSVA 3QULA 2KQMA 1T1ZB 1Y18B 3QPQC 1JF5A 3HB3C 4KUZL 2WINA 2B4CH 4M7ZC 3FN0H 1WGOA 3NZHH 3DGGA 5IP4A 5FEBA 2BNRB 1PQZA 2Z35B 2B0SH 2EZ0D 4OZHB 1BECA 3S37H 5H8DA 2NYYD 7CGTA 1WC7A 1CCZA 3OB8A 5GRJH 4KTEL 1QG3A 3C87A 1D5IH 1S7QA 3V4VH 4HBCL 3INUH 4MXVE 4OGZA 3MRNA 3O9WD 5IHUL 5CINL 3QBTB 3GJFK 1NBYB 4XPAH 5FV2A 4LCUA 4U1JB 4YHIB 1D5MA 4F37K 3TBVB 1A6WL 1WCBA 3KHQA 1TQBC 2Y5EA 3BOVA 5C0IB 2NTFB 4PREA 2K7PA 3H9HB 5C08A 4FP8L 1BBDL 3FQWA 3TBYA 4GH7B 2JCCF 1HCFX 2BNUA 5DMGD 4ZFOB 5JUEL 2FD6H 3ESUF 4YXKL 4ZO9A 1D9KA 5LCVL 35C8L 1DSFL 1E6JH 4FQXB 5F1SA 4UNTA 4UT7L 3JV6A 3V5DB 1N5YL 4DZBA 4P2RA 5BS0D 2HH0H 2NX5E 2OSLB 4WV1C 2ADJB 3RDTD 2AEIT 1G7MA 5H37H 5IJKA 2WK2A 3F58L 1P7HL 4KROB 2UZIH 4ZS6C 1UZ8A 1UJ3C 2BY1A 3P4MA 1RZJL 3V6OA 4NZDA 5ALCL 4HG4K 4EI6B 2A6JB 3O11A 3GO1L 3H42H 2ZCKL 5JZ7D 5HHPA 4PJEF 4UOJA 2Y1VA 1BZQK 4N8VB 4FQLL 4R0LC 4CW1B 1VPOH 1BQLH 5DFVD 3MRHA 2HVKB 3KLAB 3SO3B 1JK8B 1NC4B 3BYTA 5DSCA 2BNQB 4PG2A 1T03H 2QL1A 4XXDB 3SDXA 4LSPL 4ETQB 3JV0A 3I2CH 1BJ1J 2CLRA 1OGTB 3O2WH 2VDLH 3IDIA 1ZHLB 3KVQA 2WP3T 1JPFB 5H94A 3ARGA 2ZCHL 1EA9C 5TPWL 1UM5L 1QKZH 1U8KA 4P3DB 3HRPA 3MUGA 1MPAL 1JHTB 4PGBB 1PKOA 1J18A 4DQOH 1NLDH 3WSQH 2DQDH 4NFBA 3O45A 4JFQB 2ORBH 5FGCE 4HWZB 4K71C 4IJ3C 5EA0H 4NT6B 4MD5A 3VU2A 1U95A 2UUDH 1IEBB 5DD3L 2F54B 1LE5A 5KVMC 4J3XA 1T1XB 3KLHC 1LE9A 5GGSA 3HKFA 1NBZB 5GGQL 1AKJD 3QQNA 4NQUA 5FHBL 1RUKH 1EHNA 5C0ND 5CHNB 2P24A 4AK1A 1KJMB 2FYYB 4X4YB 1XIWC 3JVGC 3PWLA 1NAMB 4OQ1A 4JY4B 4ENEC 4LQ1A 3DJ9A 1L7IL 2IAMC 4Z0XB 1NEZA 1EHXA 1ORSA 3I75A 5FXCH 4I9WE 5BXFB 3DV4A 3LRSA 1N8ZA 1E4JA 5E94A 4EXPX 4FFEX 4AM0A 5HGGS 4M7LH 4YHPA 4ZSOE 3K2MC 1GGIL 4X7FC 4JRYB 1RURH 2XRAH 3H7BB 5DJ8B 1FO0A 1DE4B 4ELKA 1ULVA 2GK2A 1C16A 3AB0C 3JZ7A 2VLJB 3D6GA 3P9LB 1P2CA 1BFOA 5IR1B 1BREA 4WO4A 1JRHL 4XCCH 1YNTA 4P4KC 5DQDL 4M7LT 3TN0C 1KB5H 1ZT7A 5DK2A 3VRLF 5F72S 2EC9U 5F9WB 4M61B 1V7NH 1XGQA 1JVKA 1HEZA 1XGYH 4XC1H 3RVUC 4OLYH 3GSNH 1NUDA 1D5ZA 1MCOL 3QZWG 3U0PA 3OKMB 1R3IH 2BSTB 3BZEB 3VCLA 4HCRH 1T3FB 3SDCB 3GMOA 5DJ0B 2VLRA 3VFWA 3MOAL 3JWOC 1EAPB 4ZFFA 1G1CA 5L8JB 4M5ZH 5DMKB 3I6GB 5HGHB 5CSBA 4X6CF 1N3NB 2Q76B 5HSFA 4X7SH 4W6WB 2KPNA 4FMFA 5CP3A 4OCSH 5ENWA 2WUBH 4F8QA 3O41A 3PHOB 2ZSVB 4LMQI 5TDOB 3VFNB 2HLAB 3L3KB 4PJGF 5T3ZD 1HHGA 1EEYB 1ZVSB 2CDEB 5HDQH 4NKOB 1K4CA 3SBWA 3UBXI 2Q8BL 5TFSH 3WLBB 2KBGA 5C0DB 4JZJC 1FIEA 5IVOA 3B2VL 5DTFA 1WV7T 5LWYH 3DBXA 3RAJL 3QNXB 4JR9L 2VZ3A 4O51A 1PY9A 1A7NL 3G5XA 4N0FB 2LTQC 1J9CT 4Y4HC 1J8HA 2VZOA 4WW1A 1CZ8H 3KYKH 1YJDC 4NNXA 1N2RA 2P5WB 2RBLA 1INDL 1FZMA 4PD4K 2YR3A 3B9KB 1CLCA 3QXAB 1B2WL 3IFLH 4ZUUA 4JM2D 5DUBB 1YPZA 2I07B 1S5HB 1HXMB 5IVXA 4E0RA 4XVJH 1PLGL 3MRBA 4QXGL 5DT1H 2QEJA 3TNNA 4TSBL 4N90E 4MSWA 2YEZA 3OR6B 3HG1B 5T3XE 3VD4A 3RWJA 2ZUSA 5E2VH 4KZDL 3P0YL 4GSDH 1E4XH 2W9EL 4K94L 1IARB 2G2RA 2AJVL 5ELIA 4HEME 3GMPA 5HVHC 4L5FH 4G6ML 3O6FA 2D4FA 2XACC 4BELD 4Y5YB 3CC5A 4JHZA 1Z9SA 4YC2C 5D2NC 3U30B 4FZEH 4LVNC 3EYFB 4OD1H 2F5AH 4NSKB 2MSPA 1NCWL 5JPMB 5EH1A 5J1TC 4ZAKD 5C0CA 4NO5B 5ANMB 1LNUB 3MMEA 3JWDH 4OUUB 2A83A 3O2DL 1R5WB 1EO8L 2PO6B 5SWQB 4N0CC 3VI4E 5C2BH 4YHOH 1KN2L 1A1MB 3ARFB 5ICXA 5DVLA 3T0BA 1I9IH 1VFUA 3QWOA 5D1XA 1DDHB 1U92B 5DA0B 3VRIB 4QRPE 4LQFL 1UB6B 4O58H 3DROA 5FYJE 2HLFC 4M1DH 4PRDB 4U1GB 2N56A 3ESVF 1MIMH 1S7SA 1P84K 4UUJB 4XNXH 5HDLA 4DGYL 3GHBL 3BZDA 4YEFA 3MJGX 4PJ7F 2COQA 1KLGA 3DWTA 3UC0H 3VXSA 1P9MA 4Y2DD 2ZOKB 3IDGA 5C0GA 4M48H 5B4MC 3T0EA 5FO8A 4WW2C 3RTQD 2E5EA 2OQJB 4YHKL 1TJIL 3MNZB 3FTGB 5DRXA 1KIUA 5D7SL 4P9HL 3EFDH 3TIEB 2OK0H 2UYLA 3GB7A 3ISWA 1YC8A 4F8TA 5L2JA 3MCLL 3DMMD 1FP5A 4EUPA 1AP2B 4M8QB 1I1AA 3E0GA 3DYMA 4FQQB 2EO9A 1QYGH 4J1UA 4HIXH 5JNYB 3C60D 1AD9A 5F9JA 2EEDA 1LD9A 3QULB 4IRJA 1FFRA 1GPOH 2WINB 1RZKC 3DGGB 4XX1E 4UNVA 2RAMA 2BOCA 2D0HA 1BVLB 2A6IA 5FDWA 4P99A 3SE4C 3W0WA 5KVGH 2WZPD 1KCUL 3TJHD 1ADQH 5E8DH 2CKNA 2DBLL 1WC7B 3ZL4H 1S7QB 3EO1A 4NUJA 1G6RH 5EN2A 4KJWD 3MRNB 4R26L 1NCCH 2XKNA 4KRMB 4LCUB 1EERB 3SDAD 4TUKH 4DW2L 4NCDA 3QPXL 2XZCL 1WCBB 3SQBA 5KSUA 2DDQH 1B90A 5HD8C 5KZCB 1E4WH 3V6ZA 1QNZH 2XZAH 3TBYB 3E1F1 1EMTH 3PWVA 4DCQA 4Z7WA 1IGIL 2HJLA 2PTUA 1LDPL 4GBXD 3KPQA 5SX4H 4OCYL 4AZ8A 3D0VA 5FYKD 5BV7L 4JFOA 4DZBB 3P73A 4P2RB 1LWRA 5TE6L 4Z0BL 4ETYA 2BNRE 3QFJA 3QB7C 5EOCH 4G3YH 1BAFH 1UZ8B 3GMRA 2W1NA 3H6JA 3GNMH 4XCYA 4APQC 1KJ2A 2BDNH 3P4MB 1ZHNA 5EOQH 1I8KB 1T04A 3O11B 4F9LC 4KVNH 5KS9A 5A2KH 1PBYA 5HHPB 1BEYH 3MYJA 2F8OA 1DEDA 2Y25A 5DYOA 3CZJA 3WD5H 1TCMA 3MRHB 1IM9D 4IMLB 1NMAH 4NBYB 1ZANL 2HWZH 4HPYH 4QRQB 1QFPA 4YX2L 2RB8A 1CU4L 1DQDL 4OBSA 3FKUS 2WBJB 3RZCA 2R4RH 4JG0H 1AO7B 1IZJA 1FNEB 4LCCC 3IDIB 1GAFL 5FA3B 3T2NH 1S9XA 2AXFA 5H94B 4WTWA 2Z91A 3VFUA 5L0QC 1U8KB 1KGCD 4PTUA 3MUGB 4RQQA 1HE7A 4WNQA 2O26U 1TNMA 4X83A 4ERSH 3L95A 1JPGB 5J7CC 5M7QA 3HFML 4JO2H 4PJAE 4HFUH 4EI5D 4X6DA 4QYOA 3ZDYE 4E41E 1FH5H 3O45B 4LLMB 3CU7A 3BIBX 3OX8A 1E4KA 4S1DD 4NKMA 3BGFC 5J1SC 4MD5B 1U95B 5EFIA 1OAZL 4UT9H 5BVPH 5JA8B 1LE5B 4JGMA 4L3EE 1U8PA 1LE9B 3TYGH 1WVZA 2F53D 2IQAA 3BZFA 4XHQA 2UWEE 1SBSH 2P24B 5E2WL 3AM8C 1WIOA 1UJ3A 3E3QC 4J4PC 5JHLH 2HJFA 2O61A 4N5ED 1KELL 2NTSP 4ZPTA 4WUUA 3FFCA 4OLXL 4KV5F 3SPVA 1EJOL 4AQ1B 2E27H 3BWUC 1NEZB 1ORSB 3I75B 3MLZL 1WISA 2V17L 1ZA3B 2Y07H 3DV4B 4X7TA 3BDXA 3LRSB 1N8ZB 1RUML 5E6YA 4OLEA 5E94B 3HZMA 3WFHB 4L8SA 4XNQB 5GS2H 4AM0B 1A2YB 2FBJL 1TTFA 3MGAA 2D7TL 2UUDK 4MA1C 5MHSD 4BSJA 1CXIA 4Y4KA 1FO0B 5IBUB 4ELKB 1C16B 5ECJE 1HIML 4QCIA 1BFOB 1MF2H 3OBAA 4P23C 5I30H 4NO3A 5D8JH 4JFYA 5J1AA 1YY8B 4R4BA 5IW6B 4G8GD 1ZT7B 5DK2B 5FUCE 2JJSC 2X1OA 2I25N 4MNQD 5HYQA 5DJZB 2ZCLL 1F5WA 2MCPH 2DM2A 4XRCA 1QVOA 4XC3H 1I3VA 2B2XH 3PXJA 1M6OA 2GAZA 1FV1A 1I8MB 1JTOA 5D2NE 4ZTOH 5F8QC 4P9MH 3VXQA 3KJ4B 2WLYA 4E5XA 1NBVL 1D5ZB 3U0PB 1MLCA 5B3JE 3SDXF 5D1ZD 3VCLB 4RRPA 3VXMA 3EDKA 3VWJB 3GMOB 3BJLA 3VFWB 4YXLL 2EDRA 4I77H 5D96B 3PP4L 2X7LA 3MLVH 1DJSA 3WXWH 4ZFFB 1IGYA 4KXZH 4WI4A 1RHHA 1N0LA 5GJTL 5EWIL 4HJGA 4CMHC 2ZKHL 2APWA 1GC1L 2FRGP 4MS8D 3JBG7 4W70A 2F15A 2L7JA 5ENWB 2XYCA 2J6EL 4HX1A 1XIWA 5CMAA 1K3ZA 2X89D 2PXYD 1CD8A 1E28A 3UROR 5HGAA 1HSAB 2VLJE 5F97E 3PIQA 1LO3L 3AS3A 1SY6A 3Q5TA 1Z6JT 1HHGB 3MNVA 4X5WA 1K4CB 5L7XL 3EJYC 4YHNA 2GTWB 4KUCF 1KLFA 4PTTA 1KOAA 5IB4A 3EOTL 1O5DT 4PLKC 3U0WL 4DGVL 3U4BH 1HI6A 2VDPH 4HS8H 3G6DH 4O51B 5E70A 3BSZH 2ADGA 4OCLC 3HHRB 3G5XB 5T5NF 1VEPA 1AI1H 1J8HB 3QEQB 2YS4A 4KRNA 4WW1B 1KCSL 4XT1C 4NNXB 1MVFA 1N2RB 4LEXL 4RWYL 4LPTA 1QD0A 4XP1L 1T89A 5TF1L 1FZMB 4KKAD 4WVRA 3F7YA 1KPRB 3ARXA 1LP9A 1YPZB 5T1KB 4E0RB 1A7QL 5IVXB 3UTTE 3MRBB 1CGSL 1R3KA 1F4WL 1OL0A 3NA9L 5E6IA 4PJXE 3TNNB 4MSWB 5JHDD 2VNCA 4GXVH 3RWJB 2IH3B 4ZUVA 3BPOC 4LPWA 4G6FD 2G2RB 3RPKA 1YQVL 3BESR 2VLMD 1P7QB 4PPTA 1A6ZA 4ZAKC 1KN4H 1QBMH 3GMPB 3WYRA 3E6HA 1YYLH 3WFCH 2QQNH 3O6FB 4GJTB 4WCYL 2ZJSH 5D1QA 3SE3C 3TCLA 3CC5B 1RZJC 4FFZL 2VLLA 4PJBA 3UTSA 4LBEB 4HIHA 2AJSH 3QH3A 4TOYL 5C0CB 4PJDE 3MMEB 7FABL 1ZT1A 1BLNA 2Q3AA 1FFOB 4TNWF 2HRPL 5ICXB 3QWOB 4MXVF 2P5WE 1FYHB 1T7VA 1INEH 3GMLB 1WJ3A 1UWGL 2OR7A 5C09A 4JZJA 3MV7A 1LVEA 3KPOA 5DJ2A 3QDJE 1S7SB 3RL1A 5FB8A 5HYIA 1LO0L 3CXHJ 4I8DA 4WWKB 5HHMA 4LDEB 2NY2B 4E42A 2KQNA 3VXSB 5C0GB 5C07A 3O4OB 3AREC 1ERNA 5FO8B 2F8XC 2ZUTA 2GJZA 2DQTH 3KGRA 5GGVH 3RUGA 3NFSL 4NKIH 3RA7H 5J12C 2VH5H 5DRXB 1XF5A 3QXDA 4NQCA 3THMH 4NZJA 1OP3K 1PSKH 3DSNA 2UYLB 4X6EB 3GB7B 2HT2D 2KDGA 3BKJL 3RVTC 4KRPD 5ITBL 4IRSA 5L2JB 2LV4A 3X3GL 1HK6A 4MNGE 5ANME 1DANU 4EUPB 3MZTA 1J1PH 4D94A 4DN4H 1I1AB 5ADOL 4YPGA 2D03H 4R9HA 1C5BH 4J1UB 5I1DA 3OZ9L 2F5BL 4KK6D 3BKMH 5F9JB 1VENA 3VMNA 1LD9B 2D3VA 4IRJB 3FT2A 4UV7L 1QFWH 5ESAA 5ICZA 1MCSA 1MUJA 3SEPA 1OAUL 3FB6B 1IC5H 4MA7L 3QUYD 5IW3A 2ICEA 2BOCB 2UZYB 3QISA 4KJWC 4POYA 2A6IB 5FDWB 2YA2A 1FFNA 1N64H 4PV9A 3W0WB 5J11C 5A2FA 5LGJA 2QSTA 3SE9L 4LSTL 4PLJC 3C2AH 2XQYK 4JFDA 1G0YR 2APXA 1H5BA 4D9QD 2ICWA 1T66D 3EO1B 4NUJB 4QTHA 4GMTH 5ID0A 1MFAH 3C6LC 2XKNB 2AEPH 4KTDH 1DANT 2QSCL 1ES0A 4BH8A 5KSUB 2DQGH 3V6ZB 3HC4L 1EZVX 2HKHL 2YKLL 4IOFD 2IFGA 5D71H 4K3GA 4HUUA 3PWVB 3P30L 4DCQB 3HZYA 4O2EA 1P4LA 1YEIH 2HJLB 4XI5C 5E4IA 3KPQB 5F7YC 4R2GB 3HPJA 2J5LB 4X4MA 4ORGB 3D0VB 1OW0A 4JFOB 3ARRA 2LE9A 3P73B 3CLEL 2EDTA 5GRWA 3QFJB 3LEVL 1KCVL 3GMRB 3SJVD 2BVPB 1KJ2B 1BQUA 3MJ9H 3CDCA 3ALPA 1T04B 4JGUA 4CL7A 1FAIL 5IB2A 1OAXL 4NQSA 2ADFH 4MA8H 1IFHL 3MYJB 2FZ3B 5C0EB 4K2UL 2EKSA 3SCMD 1KYOK 3FMGH 2DQEL 5I1IL 4POZD 1A4KA 1U36A 5K9JL 4RISL 4ZS7H 1UCBH 1IGMH 2H1PL 3O9WA 3G6AA 3X13A 2VLKD 3T1WA 4XHJC 3HR6A 1S7VA 3TM6A 3ROOA 4XXCC 5F44A 4U33A 1U2HA 3RZCB 5F70A 1TMCA 4JANA 3RKPA 4O9HH 3NTCL 3GI8L 5TQ2H 5HI4C 5EC2A 4EI5C 3VXTA 1S9XB 4QTIH 4YIQA 4HUVA 3ARYA 2AXFB 4LPCA 2Z91B 1OY3B 3P4NA 3VFUB 4DFHA 4OFIA 3RPIA 2ZOLB 4PTUB 3WUZA 5FUOL 4RQQB 4LDLB 4BFEA 1AHWC 3L7EA 4HUXA 3MRQB 2JELL 3L95B 2F19H 2DIJA 5BS0A 4X6DB 4QYOB 3ELAT 5I8EA 3PWNA 1NGYB 3RDTA 3OX8B 2L0DA 1I9JH 4HJ0C 3VWKD 4JDTH 1T5XB 2BP3A 2IGFL 2AV7A 4KJQC 2VSCA 2QQKL 5EFIB 3BDBA 4ALAH 1VERA 3D25A 2YPVL 5BV7B 4OFKA 1OOAA 2OL3H 2IQAB 3BZFB 4HC1H 4K94C 1A6AA 4W6YB 4JKWA 3HI5H 4EVNA 3S36L 4NHCH 5F6HI 4KKBD 1ACZA 2IALA 4KDTA 1X5GA 2HJFB 4DKFL 5F7NC 4P0DA 1GXEA 2O61B 3GMMB 4QXWA 2R2HB 3EYSL 3GJEA 4F33A 4F7PA 4J3VA 4Z7UA 2P46B 4ZPTB 1A3LH 4IDJL 4WUUB 3FFCB 2CKBH 1UWEL 1AO7E 4G7VL 2OMNA 3EO9L 4PYHA 4MVBD 1DQQA 4IHOB 1GCFA 4QHMA 4Z7WF 5TE7L 4X7TB 1H3TA 3HZMB 5CSGA 1FVEA 4U31A 2VXQH 1GHFL 3MLUH 1CXFA 1WBZA 2EE9A 1IGFH 1FNSH 3MO1A 5E8PA 1BGXH 4Y4KB 5IB5A 5DD5L 4JE4B 4QCIB 2OJZL 1ZGLP 5DZLA 3KPRE 4NO3B 4XWOD 3RGHA 4KQ4H 5J1AB 3QG7L 4R4BB 2BHZA 3VXPB 3L7FB 5HGBA 1FYTD 3OTTA 5HYQB 1JPTH 1EPFA 1TCRA 3K8KA 4M93C 1ETZA 5T5FH 4XRCB 3CAFA 1AGDA 1AKJA 3MV11 1M6OB 1NCBH 2GAZB 1FV1B 2Q7NA 3GI9L 5F7DB 3IXTA 5HYSA 2F58H 3VXQB 1AGEA 2UV3A 3SGEI 4KDWA 1TVBA 4P9HC 4G8FB 4ZQKA 3DYOA 1NCDH 3VXMB 2AJXL 4ZOBA 1GZPA 1IGYB 1RHHB 1HOCA 3LHPL 1OF2A 3PL6D 4GFTB 3AM8A 5B21A 3O6MH 3E3QA 4HX1B 4X8XA 4XBGA 1E28B 4NRZB 3V0WL 3VI4F 1U91A 5HGAB 2E6JA 2YUZA 3PIQB 4YPJA 1U8LB 1KXVC 2VN7A 5KW9L 2AK1L 2MPAL 3GJFA 3MNVB 1S78C 4X5WB 1ZHBA 2R29L 3BWAA 4YHNB 4Q9QH 4GAGH 1CBVL 1P4IH 2FIRT 2AVGA 5IB4B 3REWA 1RZGA 4TNVK 3B8YA 4Y4FD 4YQXL 2Q86A 3QFDA 1K85A 1MFCL 2EO1A 2VUYA 1HI6B 4HS6A 3HZVA 1MCQA 4LLUB 3JUYA 2ADGB 4HLZH 2LQRA 3N85H 3TYFA 1MCJA 5CUSL 5FECA 1UACH 2K1MA 4U6TA 5BO1L 2NW2A 5E8NA 2DLGA 3F7YB 5KAQF 3CK0L 1S7XA 1A3RH 4I2XA 4ZTPH 1QBLL 4Y5XC 5L8LB 4PB0L 1R3KB 3O6LL 4ODWA 5E6IB 1U2CA 2HN7A 4PG9A 4AEIL 1V3LA 2R9HD 2AEQL 4RBPH 4PY7B 4C54A 5JIPA 1P5VA 1S3KL 4ZUVB 1S7WB 2IBZX 3C8HA 1AJ7H 4TUJA 5BV7C 1CICD 5MEQA 1A6ZB 2Q7YA 3E6HB 1SBBA 3D85B 4JM4L 2P5EB 5IB3A 3FZUD 5CILH 5E4EB 5D1QB 2ID5A 4DEPC 2BSRA 3TCLB 5DQ9A 3MV8D 2VLLB 4PJBB 2MOVA 4LFHD 1NC2D 1KG0A 1FN4B 2R0LH 3QH3B 1IGCL 5LBSL 4LSQL 3EYUH 4XCFH 1BLNB 2A9MH 2M2DA 2E6PA 4RMRA 4JFXA 4F15B 5IQ7H 1DFBL 3QEQE 3V8CA 4D9LH 2IQ9L 4LARH 4YDKL 2W0KA 4UDUA 3QHFH 4RMWA 1PX4A 2ITCA 2V6HA 3UTZA 3V2AR 4M62L 5J13C 3IT8D 3V4UH 4PV8A 3PGCA 3MRGA 4HULB 1CQYA 5C09B 1Q72H 1DP0A 3MV7B 2WW8A 4AH2A 3HE6B 3KPOB 5EU7C 3RL1B 5FB8B 4BQCA 3RHWF 4KU1A 4ELMA 3QO1A 2R1WA 1T7WA 2ZUXA 4JM2A 1MLBA 5HHMB 3ZTNL 3LQAL 3MV9D 4E42B 1RHFA 3DNKA 3BD5A 5C07B 4TTDC 1EGJH 3CSYA 1UWXH 2GJZB 4OF6A 3RUGB 3EOYG 1B4JL 3D39D 4NDMB 1XF5B 4NQCB 3TO4B 5HI5D 3W2DL 5KJRL 4LK4A 4OKDA 3U36B 4FABH 5GS2D 4KZEH 1CDIA 2NY0B 2XN9D 4IRSB 4GAJH 1MAMH 2NY3B 3FFDA 3NAAH 3BE1L 4YBLC 4YPGB 3WMSA 1A9BB 1AY1L 4ZAKA 5I1DB 3DI3B 2NR6D 4OI8A 1V8HA 4KI5E 2CUIA 1FC2D 3FT2B 3T65A 4RAUA 5ESAB 5ICZB 3CU1A 1MUJB 1NCNA 1BD2E 2FL5B 4N9GB 4YFDB 2LAGB 1SEQL 5GISL 4H8WL 4ONFH 1MFEH 1FFNB 2ZUUA 3OGOE 3OL2A 3HC0B 4OIBA 3SDYL 4KVCL 4M4RA 4ONGL 4JZOA 1F97A 5CJXC 2V5YA 3ARWA 2R2BB 5DC9B 3VA2C 5EUOE 1H5BB 2X10A 2ICWB 4QTHB 3S3PA 5ID0B 2BY2A 1FIGH 5DZOA 1A6TA 1OTSD 3K1KC 4Y2DA 4AMKL 2IC2A 3ZMRA 1ES0B 3RTQA 3ARBD 2R8SH 4MD4A 3KXFE 2W59A 4PJAF 1J7VR 5IG7B 3ZDYF 1JJUA 2VO5A 4XNUH 3TA3D 5CD5C 4JFZL 3ZE0E 4I0PC 3HZYB 4O2EB 1P4LB 3MLTA 3N1GC 1DUYA 3S36X 3HPJB 5D7IE 3DMMA 4U1LA 2BVYA 3MNWB 3WFBH 4PUBL 4CDGC 1UEYA 4CN6A 1A9EB 2J7LA 4KGLA 2A77L 5IJVB 5B38A 2UWEF 2A0LC 3C60A 5DGRA 1SM3H 2Q1EA 4YK4C 2FX7H 1KJVA 3KPNA 4J3UA 3BKYH 5FDYA 4JN1L 4RIRA 2VUOA 1BMGA 1CGYA 5T1MB 3LMJL 4NUGL 4J23A 5EU3A 3WIFA 5GGVY 1IBGH 3RX5A 1JMZA 2AXJA 4NQSB 1VFBA 1QHPA 3UDWC 4D0DA 3TJHA 2ZUQB 3FOLA 4X5LA 2EKSB 1JYXA 3OAYK 2DIAA 2IJ0C 4TSAL 3IFNL 1GC1C 1A4KB 3WN5C 3A6CL 1NH6A 4CU8A 4G7YL 1RJLA 2ITDA 3W9EA 5DMJB 2X1PA 3O9WB 3G6AB 4ZUWB 1S7VB 3MRDA 4UTBH 3ROOB 5GPRA 5BRZD 3SDAA 1WSST 4U4BA 2C1OA 5GHWH 2DLHA 3LN4B 3TJEH 1TMCB 4JANB 1A7OL 2WY3A 3VXTB 1YMHA 3I6LE 4YIQB 2P8MA 4HUVB 3HI6L 3VH8A 3PV6A 3P4NB 4I5BB 1KACB 1OGAB 3C6LA 1UH3A 4GBXA 3MLPA 1MRFH 4JFEB 3L7EB 4HUXB 3UP1A 4BKLA 1GGCH 5DD1H 4GRWB 4J6RH 3A6BH 1W0YT 4UMGA 5BS0B 3QA3A 5TQ0L 4PRBB 5I8EB 3MLYL 3REVA 3PWNB 3RDTB 2A1WL 43CAA 4KGJA 1FL5A 1U9KA 1R3LA 2AV7B 5GRUH 2YC1A 3TO4C 5AWNH 4EDWL 3MLWH 5ILTL