1T0RC

Crystal structure of the toluene/o-xylene monooxygenase hydroxuylase from pseudomonas stutzeri-azide bound
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
84
structure length
84
Chain Sequence
b'ATFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords toluene, o-xylene monooxygenase oxygenase subunit
publication title Crystal Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase from Pseudomonas stutzeri OX1: INSIGHT INTO THE SUBSTRATE SPECIFICITY, SUBSTRATE CHANNELING, AND ACTIVE SITE TUNING OF MULTICOMPONENT MONOOXYGENASES.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Oxidoreductase
total genus 23
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 1t0rC00
1T0RC 3RNCC 2INDC 3DHGC 3RMKC 3I63C 3Q14C 3RNBC 3Q3NC 3I5JC 4P1BC 3RI7C 3RNFC 1T0SC 3RNEC 4P1CC 3RNGC 3RN9C 3Q2AC 1T0QC 3Q3MC 3GE8C 3RNAC 3N1XC 3DHHC 2RDBC 3N1YC 3N1ZC 3N20C 2INCC 3DHIC 3GE3C 3Q3OC
chains in the Genus database with same CATH superfamily
4FJVB 2BW2A 2G4DB 1WYGA 1TS5A 3A33B 5BMHA 2V9HA 3KYCD 4BFRA 5FR6A 2MEKA 2KJHB 1OGWA 2DZJA 4RMAA 3MFGA 1HTQA 3UINB 2WXLA 1IGDA 1P1AA 5KHQA 1RFKA 1G6JA 1TS2A 1TKGA 3S2AA 5H92C 2PE6B 1J19A 1K50A 2W3SA 1UZXB 4WJQA 2K6DB 2MCNB 1JWUD 1E0ZA 1I35A 1P7FA 2KTRA 1I4RA 3CIRB 3OG5A 3QCAA 4XE0A 4W9CA 2K6QA 2WXMA 3RUIB 1AN8A 2QEJC 2BKRB 1VD2A 2MRPA 3LXFA 4XGAB 3V05A 1IUEA 1OQQA 3PLUA 4ACFA 2PMVA 4US9A 1JMLA 4CO7A 2RDGA 2ZW1A 3RT3B 1NDDA 1OTRB 3AEGB 4C4VB 3RD2A 2PE9A 2WXNA 2KO3A 5EE1A 5D2MB 2VZKD 1GJZA 5FKAC 5IA7A 1GB1A 1C4PA 2RDHA 2W82A 3PPAA 1SBBB 2I38A 2HTME 3JYUA 4GMVA 3B0AA 4UDUC 3I3TB 2L0FA 2VZKB 5D94A 2NBVB 4WJPA 4ZYSA 1OQRA 4JE3B 2YVCA 3HHMA 3MC8A 1QQRA 4HDQA 1WRIA 2HJ8A 2W54A 1WMHB 3I63C 3RNBC 2ZCBA 3AI5A 2EKIA 4G0NB 2UYZB 3ZDMC 2PVOD 4EZJA 2V4LA 4D2KA 1FRRA 3WAPA 5DPTA 2FE8A 4GU2A 4L2YA 1NYRA 2AL6A 4B0MA 4GDKB 2M0XA 3EA6A 4FADA 1FD6A 3LJ3A 2IO3B 4ZRIA 3KUDB 1ROEA 1LO5D 5J18A 2GBRA 2JRHA 4IDIA 5D7GA 2ASQA 4LNOA 3AE7B 1PQSA 3I9V1 1XEEA 2D07B 3VAWA 1KLVA 4ANVA 1J8CA 4F1SA 3L4PA 5G2NA 1UUPA 2D3CA 1RRBA 2QC8A 1WJ6A 2GRIA 3Q69A 3NJTA 4WQMA 3KYDD 4GOCA 1TJEA 1UGJA 3TEYA 1CK1A 1WXAA 3VR9B 3R2TA 1T0QC 4A9AA 3QWZB 1IGCA 2PTLA 2YEPB 2W9NA 1I4PA 4DXGA 4ASWC 3TUOA 2OHFA 4K3BA 4XDCA 1V49A 4M0WA 5BYSA 4HEA1 4B95A 2DENB 1VZ6A 2JZ3B 4M01A 1I7HA 2ZCCA 3IBEA 3APDA 2ZEQA 3AB5A 5CHVC 2GBMA 2NTSA 1YN3A 1E8WA 4IUMB 1L4ZB 1WRDB 5D6JB 5CTRC 4KGRA 3ZIMA 3B9JA 3NHEB 2WX1A 3R2IA 3ETRA 3SU8X 3DBHI 3EHVA 1YNTE 4KV2A 1OEYA 1JRPA 3RFZB 3DBLI 4C00A 1RLFA 2JWZA 2KAJA 2BYEA 2CU1A 2KDEB 2K39A 3QQ8B 1JWSD 1GAQB 3BIID 3H7PB 2G1EA 4XZ4A 3GP7A 2LHEA 2WLBA 3AMZA 2WXIA 1V81A 1RYJA 2Z8LA 2E3TA 1TYGB 1MPEA 1H4RA 3NVVA 3RNGC 1N60A 2VH1A 4NQKE 1V5TA 4N59A 4MM3B 1Z5SB 3N1YC 3J9CA 2KFKB 2RGFA 1X1MA 1UF0A 4HPPA 1Q10A 2FCSA 3T8MA 4A3PA 4B6WA 1ACCA 2XK5B 4PK1A 1QLBB 2RPVA 4W9HA 3WAMA 3AN1A 3AECB 2R2OA 2J0JA 3DWGC 3FKYA 2M4NA 2XBBC 2IY1B 3KVFB 2MBBB 1U4AA 4N58A 1TS4A 1D6EC 3C19A 1RWSA 1WF9A 4MELA 3A1QA 2N9XA 3UQAA 2KWCA 3MHSD 1JWAD 1E9MA 4K3CA 5DPWA 1V1PA 3OJ3A 3A9KB 4BZAA 4WIPA 3N1XC 4DHZB 2BS2B 2MLBA 4YTPB 2KMMA 4IG7B 4MJSB 3Q8BA 4DXAB 2Z0DB 3SR6A 2KX3A 3P4QB 4M8NA 1S1QB 4WWNA 2V3NA 3WAOA 1WE6A 1FMAD 3QX1A 4ZRJA 3Q2AC 1DGJA 3JSVB 1XF5L 2LGYA 3AEEB 3NZUA 1XCQL 3ZNGC 4EOYA 5CHWA 1QT9A 2J42A 3Q8AA 1MG8A 4DHJD 3H6NA 4BKTA 3UIPB 2AQ2B 3M63B 2DAJA 4IWPA 3ZW3A 3QIJA 3TIXA 3ECIA 3DDCB 1R7SA 4AUQC 3GOEA 3VQIA 4KIKA 4DHJB 4PS7A 2C5LC 5LNK1 1P3QU 2IJ0A 4OW0A 2AX5A 3ONSA 2KQ7A 4TKNA 2RD0A 2KZRA 3OLMD 3R66C 3WALA 1SXTA 4A55A 4I6NB 3GZNI 3UIOB 2FUG1 2JQRB 3I5JC 4MGIE 5BMGA 4C4VA 4USAA 4BKSD 2HJ1A 4US8A 4MGYE 3RNAC 2WDTB 2B3AA 3DBRB 3DVGY 4JX1C 2CHZA 2FCQA 1I4HA 1V97A 2WDQB 3RMKC 1F2RC 2LMCA 2BBCA 3BK2A 1P98A 3P4PB 3ABVB 1EU3A 2BWFA 2W3RA 4AJYB 4KKJA 1SF0A 2JZPA 2BWES 2NTTA 1RM6C 1IP9A 4ZOHC 2MJ3A 3MJWA 1OFFA 3VRBB 4RF1A 1FCCC 1FXTB 1JWMD 1N63A 1KM7A 2V4IB 2WWZA 2V0GA 5AZHA 2K25A 3BVZA 3AM9A 1EWYC 2J4XA 2MP2A 1L4DB 1BXTA 2JSVX 2C7NB 1F52A 2EKEC 2BVCA 2GOWA 2ZVNA 1T0RC 1WR1A 2QILA 1B1ZA 1SE2A 3SD5A 1VDVA 4A6QA 3RPFC 3W2DA 2PJHA 2AL3A 1C77A 5J17A 1YQ3B 1AWDA 5D3IB 1Q1OA 4L1BA 2EMSA 2GBJA 2L00B 2L76A 4GN1A 1YQBA 2K8HA 3NVZA 1SJHD 1TY0A 2LGXA 2JWUA 1DOXA 4M00A 4LNFA 4IWQA 2DYBA 5IOIA 3MC0B 1PGBA 4NJCA 4B0EA 2MA9B 5HKHA 1KJTA 2IGGA 3NVYA 4JLCA 1QOBA 2WYQA 3GE3C 1UH6A 2LVPA 1I4XA 3PV1A 3FILB 1V6EA 2J0KA 2KD0A 2N9PC 4I6PA 2O6VD 4NJ6A 3IAS1 1WJNA 1DYQA 3C8YA 4MH8A 3PSEB 1L0YB 4LJPB 3N30A 1IBXA 3OWEB 1YX6B 2I1JA 4EKUA 3APFA 2IBIB 3L17A 1NI2A 3H7PA 4ICUA 4RM9A 5E6NA 3TBLD 1BMLC 1XO3A 4HKZE 2IYDB 3H8HA 4AP4C 1V1OA 5JZEB 2HDEA 4E74A 4YT0B 2GB1A 1YN5A 4JWSC 3NG0A 2KN4A 3ENEA 2KFKA 1TS3A 4YSZB 2D2QA 2ON8A 3ZQ4A 2XK5A 2YEPF 1NENB 5JHAA 3OJ4B 3W1SC 3AU4A 2J7QB 4ARIA 2K3UA 1R4NB 1CJEA 3PLVA 3B2GA 2IGHA 5DCNA 1L0XB 2KTFA 1F1HA 3ZJTA 3JW0X 2NVUI 3PS6A 2BYFA 3WCQA 1K52A 5DPRA 2KFJA 1KF6B 2W55A 4WAAA 3GE8C 3AXCA 1YJIA 3A9JB 2LEKA 1KLUD 1E10A 4H2AA 1N5WA 1NBFC 3W1SA 2LRWA 2J53A 1WXMA 3H1UA 1PGAA 1ET9A 1YJJA 1F2RI 2WU5B 1NYQA 1ISNA 1ZW7A 1T0SC 4MJSA 2BQQA 3QHTA 1TKEA 4KVGB 1MJDA 4FA6A 3AE9B 2CJOA 3P4RB 3R8BA 4HXDA 4FXCA 3BK1A 3Q8FA 2NPTB 1SGHA 1N6ZA 4WH4A 4AQ7A 2MX2A 5HHDG 3N32A 2L83A 4P1BC 2BPSA 2VRRB 1LGRA 3IXSA 3T3OA 4GB9A 4NY0A 2V1YA 3AE5B 4HJKA 4HK2A 2CU3A 4YL8A 2MW5A 1WR6E 5AUIA 4KDIC 2M1MA 1WE7A 1YIWA 2L05A 5E6OA 1I42A 2WU2B 3LDZE 2PW9A 4ANXA 1C1YB 1TY2A 4ZRQA 4WWPA 3ZNZB 2WXRA 3U7ZA 5T8IA 4N9F4 2VH2A 4KZ0A 4KDLB 1E8YA 3ZXRA 1JCKB 3U7DA 3E56A 5BO4B 4EZLA 4TMAB 1TT5B 1Y8RC 3BVMA 3VTVA 4B9KA 3PZDA 4XX5A 5G5GA 2M8SA 3N3KB 1E7VA 4KX6B 2WXPA 1VZ8A 5C3JB 3SHQA 2OOBB 4BKSA 2FIDA 1V5OA 1FCLA 1WM2A 1P9DU 1VZ7A 3KLSX 4KGSA 1AW7A 2IO2B 2PKOA 5E6JA 1ZDVA 3PRZA 4J3OD 3RI7C 2IO0B 4P1CC 4NZLB 2KANA 3CSTA 1Z2MA 3I57A 3RULA 3HM6X 1L7YA 4TSSA 1V2YA 2C9WB 3OAWA 1WY8A 3NZ3A 4CQNA 1L5PA 2BT6A 4W9KA 1KOTA 1D5MC 2PLPA 1QOGA 2OJWA 1VCBA 1Y56A 4CYEA 3V3XA 1AYFA 5AUKA 4G3XB 4KKIA 1VRAB 1FFVA 4IM2A 5IP4D 3KWVA 4FLHA 2MSED 4FJYA 1GOZA 1FIQA 5TSSA 2IGDA 1WJUA 2HE7A 3NVWA 1MI0A 1AARA 5CX3A 3ZJUA 3LYYA 2FCNA 4PS3A 2Y5PA 3BZDB 2KACA 2N0SB 4F8CB 4W9GA 2CR5A 2KX0A 2ZZPB 2B76B 4G11A 5G55A 1GB4A 4KGTA 4WJNA 2LJIA 2FAZA 4LTUA 4XYCA 4W9EA 3W5VB 1WZ3A 3AULA 5DPSA 4BVUC 4ZDVA 2KOXA 2NCNA 2O2VA 5AZGA 3QA8A 4MGZE 2INNE 1P0RA 3KW5B 4EZKA 1GC6A 3FILA 1VJKA 2YLMA 3K9OB 4YSYB 4K1RB 1JRUA 3SDLC 1N5XA 4BOZB 4WAFA 1SE4A 1MHHE 4HLEA 3EFCA 1GG3A 3X0WA 2AEHA 2ZVOA 5JHBA 1QOAA 1WIAA 2K1FA 2KJ6A 1E90A 3L10B 2EELA 4EE2A 3NRZA 3P2BA 3IG3A 3B2FA 4MT5A 2LJ5A 3MC9A 4BBNF 1EUVB 1WJ4A 2HTHA 2DZMA 3DBSA 4HPMB 3HM3A 2N4FA 4A20A 5IO9A 1FNVA 1D4BA 3HRDD 4LK0M 2C7MB 4E71A 1PGXA 4ICVA 1T6BX 3W1YA 4OVZA 1F9JA 2BS4B 3ZNHB 4P7IA 4TUUA 3P42A 5GXGB 1TIFA 3UQBA 3DBHB 2INCC 3T3NA 3DOWA 4O1NA 2OEDA 4FN2A 3WIMA 3IFWB 2IY0B 3ZVVA 2JY6A 3HIZA 2UWQA 2QIEB 1PUTA 3DBLB 2JYTA 2KT7A 2C7HA 2DZKA 3IT4B 1E5WA 2PEAA 2K22A 5LXIB 3DCGA 4ITKA 1IPGA 2G4SA 3DVGX 5JXVA 4ANUA 1TZOA 2GBNA 1LM8B 2KDIA 1I4QA 2LGIA 4WJOA 1NEKB 4GDLB 2UU7A 2FUHB 1BUIC 5BYRA 5HI1A 3AEAB 1H8CA 4R3DA 1UWXA 1ZE3D 2M19A 4AS1A 1F77A 2KHWB 3C0RB 1D3ZA 2WS3B 3DWMA 5FK9C 4OZAA 2BGFA 3L13A 4C7ZA 3WANA 3AEFB 3U2SC 1ZXIA 2KNBA 3PHXB 2RSUA 3URYA 2LGDA 3FAHA 4IM3A 1XD3B 1GPXA 4PYZA 2N7EA 2WGSA 4P6VF 4FHJA 2BKFA 3Q3NC 2JYEA 2K8CA 1E7UA 2IPKD 1CQVA 2AQ1B 1WYWB 1EU4A 1WMHA 4HVBA 2XNAC 4GSWA 4IKGA 1S3SG 2H88B 2A4ZA 2NS5A 3Q14C 5G5HA 2K9XA 2GLSA 2ZW0A 4GIVA 4DBGA 3Q8CA 4S0RA 4JPSA 2C60A 4GDKA 1SEBD 3AEBB 4DQOC 3V6CB 4IWOA 4XWTA 4II3B 4Q2JA 1C4CA 5L83A 3Q3OC 1WXQA 2R61A 1J7BA 3AU5A 1CMXB 2ACZB 4YWGG 1NI3A 4RH6A 2Z59B 4M0WB 2MBOA 2OJRA 2LASA 3VDZA 3M95A 1P7EA 4JL9A 3QK0A 1LQBA 3PTFC 3RZFA 2J52A 1C79A 1GC7A 2QCZA 2LRUA 2Z0EB 2D3BA 4URKA 2REXA 1TGZB 2AYOB 4A3OA 2KC1A 2N1VA 5C23A 1SJED 1V86A 2JXXA 5E6PA 4P16A 1FNWA 1FFUA 1YOVB 3AE2B 3O65B 2K8BA 4KSLC 2N7DA 1N61A 2FBWB 3UGBB 4HROA 3VXWA 3KWLA 4JIOU 3DHIC 4OVVA 3LB8C 2BB5A 3IVFA 1SSNA 3FC4A 1T0YA 3QJZA 2QHOA 3NY5A 4ANWA 3NUHB 4EEWA 1FRDA 2WXOA 1KTKA 5FR3A 4HPLB 3R7RA 4HWIB 2WXFA 1FPYA 3VR8B 3NS1A 2O6VB 2N9KA 2M56B 3BYYB 1WZ0A 1HTOA 3AV8A 2GMIC 3EUB2 1YMHE 3AEDB 3ZO5B 2BTEA 3VVWB 2TSSA 1STEA 2LZ6A 4RGOS 4LJOB 3BVGA 3SFDB 1HQRD 3IHPC 2H89B 1KH0A 4XDDA 2L1AA 4AWJA 2WXJA 2RPQA 4MM3A 4C80A 3N9YC 3ZLZA 2KDBA 2KLGA 3A1QB 1GNUA 3QAQA 3VH4B 4AOFA 1KLGD 1J7AA 4RNAA 4BAXA 3EGRA 1UNSA 4OVUA 2FIFA 3PVLA 3VFKA 3B08A 2KK8A 1E8ZA 2WXQA 4MSQB 1R4MB 1M4VA 1TTNA 1ZOYB 2KQ4X 3RYTA 3RCZA 3ZXVA 2DWQA 1ZPSA 3NZSA 4NQLB 1A70A 1QZEA 4LCDE 4PT5A 1LXDA 3KUZA 1WGYA 1A5RA 4OZBA 4YTMB 2LVQA 2MH7A 4K7WA 3A9KA 3Q8EA 1JQ4A 1HXYD 1E6EB 1VLBA 2ICIA 1N62A 2D5GA 3HUIA 2I1KA 2INPE 4RGNA 3CWIA 4K7SA 4NAWB 2PPHA 4HJGE 2MWSB 1MHXA 2ZPYA 2IZVB 4KIKB 1EO6A 2V3SA 3ZUNA 3JSVA 4FBJB 2A5UA 2GBKA 2KMCA 2KWDA 4I6LB 4WWOA 3IAM1 2JPHA 3RNFC 3CSFA 5HFYA 3APCA 3V62A 4ZRPA 3IT6B 4C7YA 4JWUC 3WA0A 2AQ3B 4GDLA 5LLIA 3U30A 3PHWB 1WFYA 1WXVA 2KYWA 1RFAA 1YN4A 4RGTA 2JU6X 1HZ5A 2WP9B 1ZP0B 3W9CB 3M3JA 3KH0A 3TJPA 5C1ZA 5JH5C 4AJWA 4HCPB 4LNKA 3RZWC 1WGGA 4MEMA 2KMAA 4OZCA 4DXFA 1BT0A 4BOSC 2G3QB 4DWFA 1NVID 3O13A 4KSKC 1ENFA 2SEBD 5CHFA 1FM0D 1L6VA 3M62B 4F7ZA 5J2RA 2I2YA 4IC7B 2LI5A 2QSDA 4MACA 1F0ZA 3PREA 3UI3A 5AZFA 3PT2B 2MQJA 2IDYA 2ZJDA 2JF5A 4K81A 2WX0A 1XT9B 5H8YE 4BBNC 3Q6BA 4TQ1A 2MP2B 3SEBA 1GUAB 2DNFA 3KUCB 3DVNV 3ZTDA 3DPDA 4CHKA 1SIJA 1KFYB 1OEYJ 3ALBA 1XLNA 3NS8A 1XXGA 2DBYA 2LUEA 3PRPB 2D10A 3BY4B 2LVOA 1PYWD 4KZCA 1D5XC 2IO1B 3ZRFA 3BWUD 3PZ7A 1LFDA 3MHZA 3MP9A 2KQSA 3B1LX 4W9JA 2ZNVC 1KRHA 4C56C 1WX7A 2K0PA 1SIFA 3AE1B 1HE8A 1YD8U 4RF0A 3DVNU 2PIAA 4MGKE 1WH3A 1C78A 4N6EB 5EE9A 1JWBD 4YTNB 4MDKE 2INDC 3R7QA 1WM3A 2WNMA 4HCNB 1QKZA 1DOIA 5GMVA 4TQ0A 2HD5B 1T5XD 2L7RA 4MH0E 4RCOA 1Q0WB 3NOBA 1FXIA 5EE0A 2Y5BB 3ML9A 1PFDA 4IM0A 4FULA 3ZDTA 2G9HD 2CS4A 2DYMA 4FJZA 3E9SA 4GXBA 3V6EB 1ESFA 3AE8B 3R3MA 2CKHB 4QAYA 1IBXB 3Q3FA 3VUWA 1WGDA 1I4GA 2D3GA 3CMMB 4ZRKA 3CF6E 4LDTD 3TMPB 3HK0A 1IYFA 2LUMA 5TR5A 2XEWA 1CZPA 1WX8A 3GB1A 1C4AA 4HKQA 5I4DA 2JZZA 2CHWA 3VUXA 2JX5A 1QF6A 4LDTB 3HVZA 3BINA 3RNEC 2LD9A 1HEZE 1K53A 2O6VA 4W9FA 1TZ1A 2JT4B 4ZYNA 3L54A 2L8JA 4LNNA 2Y5CA 3A4RA 3QARA 3P1MA 2RMMA 1T3QA 3PRMB 5HG2A 4W9LA 1L2NA 4FHKA 1EF5A 1SE9A 3ZTCA 2X8XX 4RGMA 2DZIA 1WSPA 2JUOA 3PGEA 2RR9A 4PYUA 2MBHA 3QC8B 2E6XA 2K5PA 4TV3A 3DBRI 1JROA 3UF8A 4HRSA 1RAXA 1OQYA 3RNCC 1MG4A 2M0AA 2MBQA 3W5UB 1WI0A 4E3CA 2X38A 4EUTA 4NPNA 2KTRB 1E7PB 4J6IA 2R2QA 1K8RB 2KLCA 4K7UA 1ZDXA 2WQYB 3ML8A 4ARCA 2M17A 2KC2A 2LGSA 2JXTA 5EDSA 3JVZX 2N9LA 2LXCA 1XLPA 1L6UA 2KJRA 2JVCA 3A9JA 3GS2A 2KWVB 2Q5WD 3ZKJC 2KDFB 2WHIA 5BYQA 3V61A 2GI9A 4OHJA 1E8XA 2NMQA 4JQWC 2ZPNA 3TEWA 3AE4B 4HDOA 5IN7A 1ET6A 3VUYA 2FCMA 1EM7A 3L08A 5C2TB 1WGKA 2D11A 3N20C 3VH3B 1B9RA 4DDID 2EMTA 4BKGA 2MJEA 1M94A 5D3DA 4A8XC 1K51A 4NAWA 4REZA 4L23A 1XCTL 1QOFA 1TKYA 3EFUA 2NPTA 3VTWA 1WX9A 3TCAA 1C76A 1HZ6A 3DHHC 4WWMA 4IW0A 4M8MA 3D32A 1HA5A 4NAMA 3PZ8A 1UELA 1XLQA 4DHZE 2NBWB 4W9DA 1UBQA 1UBIA 3ZRCA 3U8ZA 5EE3A 1MVKA 2WXHA 3ZJVA 2BYTA 2BB6A 4NNJB 3Q3MC 2DYOA 2PVGC 3AE6B 3PO0A 1FO4A 3H7SA 2BF8B 2WDVB 4W9IA 2MBEA 2XN9C 1J0GA 4EFOA 3EC8A 2DAFA 4YXDB 1FEHA 3P4SB 3ZGZA 2L32A 1ZKHA 4M02A 2QMTA 4NJ7A 3SFEB 4IOIE 1XLOA 2CJNA 3TEZA 3K9PB 3V60A 3RN9C 4XC2A 4WURA 1UGMA 3KQ4A 1VR9A 3BYTB 3AE3B 4A90A 2N7JA 1WGHA 1L0VB 2LHDA 2MJDA 3A4SC 2D3AA 1ZUD2 4ZHOA 2WDRB 4LNIA 2Y3AA 4MSMB 1XQQA 1YX5B 4GLSC 1EF1A 2DX5B 1PDXA 3T9LA 4WQOB 2LWPA 1FXAA 1JW9D 4PS8A 3GZNB 4YSXB 4RM8A 3DQVA 2DHZA 1QILA 3L0WB 2FNJB 1FNUA 2JRIB 4RFBA 5MPOA 2WXGA 2DLBA 3VTUA 1EWCA 2RDBC 2L52A 2L3ZA 1V9JA 2BS3B 1ZGUB 5L95C 2QDFA 3U4EG 1R4NI 4GGQA 1UD7A 2MHJA 2ZNVB 4DK5A 3MTNB 1R4MI 3L16A 3Q3JA 1WGRA 4LLGM 5IAAC 3AH7A 1TBEA 1JALA 1YJ1A 2N9EB 1WXSA 2KKCA 2CHXA 2AWTA 4S17A 3VRAB 2O2VB 2LXAA 2LFIA 4G50A 2SAKA 2KVZA 4JGHB 1C9FA 3U52E 3ZYYX 2BYVE 1SB3C 3DHGC 1YQ4B 2WXKA 3TL5A 3X23A 1D5ZC 5IKCM 3ZNID 3HVDA 3VHTC 5BMIA 5KHOA 3TEXA 2KVRA 3EECA 3P63A 2KWUB 2ONQA 3N1ZC 4ZHPA 1SE3A 1V80A 2V3PA 4X57B 1C3TA 5AEKB 4II2B 2KDMA 3MJ5A 2QJLA 3H9DA 2L0TA 2KN5A 2NR2A 2G45B 1MFWA 2KXJA 3TSSA 1UWMA 2N1WA 2J0MA 1WWTA 1V8CA 5LXHA 1ZXHA 1Q5WB 4DDGD 1V1PB 4XWWA 2NBUA 1J7CA 1DOYA
chains in the Genus database with same CATH topology
1T0RC 3RNCC 2INDC 3DHGC 3RMKC 3I63C 3Q14C 3RNBC 3Q3NC 3I5JC 4P1BC 3RI7C 3RNFC 1T0SC 3RNEC 4P1CC 3RNGC 3RN9C 3Q2AC 1T0QC 3Q3MC 3GE8C 3RNAC 3N1XC 3DHHC 2RDBC 3N1YC 3N1ZC 3N20C 2INCC 3DHIC 3GE3C 3Q3OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0R C;  3RNC C;  2IND C;  3DHG C;  3RMK C;  3I63 C;  3Q14 C;  3RNB C;  3Q3N C;  3I5J C;  4P1B C;  3RI7 C;  3RNF C;  1T0S C;  3RNE C;  4P1C C;  3RNG C;  3RN9 C;  3Q2A C;  1T0Q C;  3Q3M C;  3GE8 C;  3RNA C;  3N1X C;  3DHH C;  2RDB C;  3N1Y C;  3N1Z C;  3N20 C;  2INC C;  3DHI C;  3GE3 C;  3Q3O C; 
#chains in the Genus database with same CATH topology
 4FJV B;  2BW2 A;  2G4D B;  1WYG A;  1TS5 A;  3A33 B;  5BMH A;  2V9H A;  3KYC D;  4BFR A;  5FR6 A;  2MEK A;  2KJH B;  1OGW A;  2DZJ A;  4RMA A;  3MFG A;  1HTQ A;  3UIN B;  2WXL A;  1IGD A;  1P1A A;  5KHQ A;  1RFK A;  1G6J A;  1TS2 A;  1TKG A;  3S2A A;  5H92 C;  2PE6 B;  1J19 A;  1K50 A;  2W3S A;  1UZX B;  4WJQ A;  2K6D B;  2MCN B;  1JWU D;  1E0Z A;  1I35 A;  1P7F A;  2KTR A;  1I4R A;  3CIR B;  3OG5 A;  3QCA A;  4XE0 A;  4W9C A;  2K6Q A;  2WXM A;  3RUI B;  1AN8 A;  2QEJ C;  2BKR B;  1VD2 A;  2MRP A;  3LXF A;  4XGA B;  3V05 A;  1IUE A;  1OQQ A;  3PLU A;  4ACF A;  2PMV A;  4US9 A;  1JML A;  4CO7 A;  2RDG A;  2ZW1 A;  3RT3 B;  1NDD A;  1OTR B;  3AEG B;  4C4V B;  3RD2 A;  2PE9 A;  2WXN A;  2KO3 A;  5EE1 A;  5D2M B;  2VZK D;  1GJZ A;  5FKA C;  5IA7 A;  1GB1 A;  1C4P A;  2RDH A;  2W82 A;  3PPA A;  1SBB B;  2I38 A;  2HTM E;  3JYU A;  4GMV A;  3B0A A;  4UDU C;  3I3T B;  2L0F A;  2VZK B;  5D94 A;  2NBV B;  4WJP A;  4ZYS A;  1OQR A;  4JE3 B;  2YVC A;  3HHM A;  3MC8 A;  1QQR A;  4HDQ A;  1WRI A;  2HJ8 A;  2W54 A;  1WMH B;  3I63 C;  3RNB C;  2ZCB A;  3AI5 A;  2EKI A;  4G0N B;  2UYZ B;  3ZDM C;  2PVO D;  4EZJ A;  2V4L A;  4D2K A;  1FRR A;  3WAP A;  5DPT A;  2FE8 A;  4GU2 A;  4L2Y A;  1NYR A;  2AL6 A;  4B0M A;  4GDK B;  2M0X A;  3EA6 A;  4FAD A;  1FD6 A;  3LJ3 A;  2IO3 B;  4ZRI A;  3KUD B;  1ROE A;  1LO5 D;  5J18 A;  2GBR A;  2JRH A;  4IDI A;  5D7G A;  2ASQ A;  4LNO A;  3AE7 B;  1PQS A;  3I9V 1;  1XEE A;  2D07 B;  3VAW A;  1KLV A;  4ANV A;  1J8C A;  4F1S A;  3L4P A;  5G2N A;  1UUP A;  2D3C A;  1RRB A;  2QC8 A;  1WJ6 A;  2GRI A;  3Q69 A;  3NJT A;  4WQM A;  3KYD D;  4GOC A;  1TJE A;  1UGJ A;  3TEY A;  1CK1 A;  1WXA A;  3VR9 B;  3R2T A;  1T0Q C;  4A9A A;  3QWZ B;  1IGC A;  2PTL A;  2YEP B;  2W9N A;  1I4P A;  4DXG A;  4ASW C;  3TUO A;  2OHF A;  4K3B A;  4XDC A;  1V49 A;  4M0W A;  5BYS A;  4HEA 1;  4B95 A;  2DEN B;  1VZ6 A;  2JZ3 B;  4M01 A;  1I7H A;  2ZCC A;  3IBE A;  3APD A;  2ZEQ A;  3AB5 A;  5CHV C;  2GBM A;  2NTS A;  1YN3 A;  1E8W A;  4IUM B;  1L4Z B;  1WRD B;  5D6J B;  5CTR C;  4KGR A;  3ZIM A;  3B9J A;  3NHE B;  2WX1 A;  3R2I A;  3ETR A;  3SU8 X;  3DBH I;  3EHV A;  1YNT E;  4KV2 A;  1OEY A;  1JRP A;  3RFZ B;  3DBL I;  4C00 A;  1RLF A;  2JWZ A;  2KAJ A;  2BYE A;  2CU1 A;  2KDE B;  2K39 A;  3QQ8 B;  1JWS D;  1GAQ B;  3BII D;  3H7P B;  2G1E A;  4XZ4 A;  3GP7 A;  2LHE A;  2WLB A;  3AMZ A;  2WXI A;  1V81 A;  1RYJ A;  2Z8L A;  2E3T A;  1TYG B;  1MPE A;  1H4R A;  3NVV A;  3RNG C;  1N60 A;  2VH1 A;  4NQK E;  1V5T A;  4N59 A;  4MM3 B;  1Z5S B;  3N1Y C;  3J9C A;  2KFK B;  2RGF A;  1X1M A;  1UF0 A;  4HPP A;  1Q10 A;  2FCS A;  3T8M A;  4A3P A;  4B6W A;  1ACC A;  2XK5 B;  4PK1 A;  1QLB B;  2RPV A;  4W9H A;  3WAM A;  3AN1 A;  3AEC B;  2R2O A;  2J0J A;  3DWG C;  3FKY A;  2M4N A;  2XBB C;  2IY1 B;  3KVF B;  2MBB B;  1U4A A;  4N58 A;  1TS4 A;  1D6E C;  3C19 A;  1RWS A;  1WF9 A;  4MEL A;  3A1Q A;  2N9X A;  3UQA A;  2KWC A;  3MHS D;  1JWA D;  1E9M A;  4K3C A;  5DPW A;  1V1P A;  3OJ3 A;  3A9K B;  4BZA A;  4WIP A;  3N1X C;  4DHZ B;  2BS2 B;  2MLB A;  4YTP B;  2KMM A;  4IG7 B;  4MJS B;  3Q8B A;  4DXA B;  2Z0D B;  3SR6 A;  2KX3 A;  3P4Q B;  4M8N A;  1S1Q B;  4WWN A;  2V3N A;  3WAO A;  1WE6 A;  1FMA D;  3QX1 A;  4ZRJ A;  3Q2A C;  1DGJ A;  3JSV B;  1XF5 L;  2LGY A;  3AEE B;  3NZU A;  1XCQ L;  3ZNG C;  4EOY A;  5CHW A;  1QT9 A;  2J42 A;  3Q8A A;  1MG8 A;  4DHJ D;  3H6N A;  4BKT A;  3UIP B;  2AQ2 B;  3M63 B;  2DAJ A;  4IWP A;  3ZW3 A;  3QIJ A;  3TIX A;  3ECI A;  3DDC B;  1R7S A;  4AUQ C;  3GOE A;  3VQI A;  4KIK A;  4DHJ B;  4PS7 A;  2C5L C;  5LNK 1;  1P3Q U;  2IJ0 A;  4OW0 A;  2AX5 A;  3ONS A;  2KQ7 A;  4TKN A;  2RD0 A;  2KZR A;  3OLM D;  3R66 C;  3WAL A;  1SXT A;  4A55 A;  4I6N B;  3GZN I;  3UIO B;  2FUG 1;  2JQR B;  3I5J C;  4MGI E;  5BMG A;  4C4V A;  4USA A;  4BKS D;  2HJ1 A;  4US8 A;  4MGY E;  3RNA C;  2WDT B;  2B3A A;  3DBR B;  3DVG Y;  4JX1 C;  2CHZ A;  2FCQ A;  1I4H A;  1V97 A;  2WDQ B;  3RMK C;  1F2R C;  2LMC A;  2BBC A;  3BK2 A;  1P98 A;  3P4P B;  3ABV B;  1EU3 A;  2BWF A;  2W3R A;  4AJY B;  4KKJ A;  1SF0 A;  2JZP A;  2BWE S;  2NTT A;  1RM6 C;  1IP9 A;  4ZOH C;  2MJ3 A;  3MJW A;  1OFF A;  3VRB B;  4RF1 A;  1FCC C;  1FXT B;  1JWM D;  1N63 A;  1KM7 A;  2V4I B;  2WWZ A;  2V0G A;  5AZH A;  2K25 A;  3BVZ A;  3AM9 A;  1EWY C;  2J4X A;  2MP2 A;  1L4D B;  1BXT A;  2JSV X;  2C7N B;  1F52 A;  2EKE C;  2BVC A;  2GOW A;  2ZVN A;  1T0R C;  1WR1 A;  2QIL A;  1B1Z A;  1SE2 A;  3SD5 A;  1VDV A;  4A6Q A;  3RPF C;  3W2D A;  2PJH A;  2AL3 A;  1C77 A;  5J17 A;  1YQ3 B;  1AWD A;  5D3I B;  1Q1O A;  4L1B A;  2EMS A;  2GBJ A;  2L00 B;  2L76 A;  4GN1 A;  1YQB A;  2K8H A;  3NVZ A;  1SJH D;  1TY0 A;  2LGX A;  2JWU A;  1DOX A;  4M00 A;  4LNF A;  4IWQ A;  2DYB A;  5IOI A;  3MC0 B;  1PGB A;  4NJC A;  4B0E A;  2MA9 B;  5HKH A;  1KJT A;  2IGG A;  3NVY A;  4JLC A;  1QOB A;  2WYQ A;  3GE3 C;  1UH6 A;  2LVP A;  1I4X A;  3PV1 A;  3FIL B;  1V6E A;  2J0K A;  2KD0 A;  2N9P C;  4I6P A;  2O6V D;  4NJ6 A;  3IAS 1;  1WJN A;  1DYQ A;  3C8Y A;  4MH8 A;  3PSE B;  1L0Y B;  4LJP B;  3N30 A;  1IBX A;  3OWE B;  1YX6 B;  2I1J A;  4EKU A;  3APF A;  2IBI B;  3L17 A;  1NI2 A;  3H7P A;  4ICU A;  4RM9 A;  5E6N A;  3TBL D;  1BML C;  1XO3 A;  4HKZ E;  2IYD B;  3H8H A;  4AP4 C;  1V1O A;  5JZE B;  2HDE A;  4E74 A;  4YT0 B;  2GB1 A;  1YN5 A;  4JWS C;  3NG0 A;  2KN4 A;  3ENE A;  2KFK A;  1TS3 A;  4YSZ B;  2D2Q A;  2ON8 A;  3ZQ4 A;  2XK5 A;  2YEP F;  1NEN B;  5JHA A;  3OJ4 B;  3W1S C;  3AU4 A;  2J7Q B;  4ARI A;  2K3U A;  1R4N B;  1CJE A;  3PLV A;  3B2G A;  2IGH A;  5DCN A;  1L0X B;  2KTF A;  1F1H A;  3ZJT A;  3JW0 X;  2NVU I;  3PS6 A;  2BYF A;  3WCQ A;  1K52 A;  5DPR A;  2KFJ A;  1KF6 B;  2W55 A;  4WAA A;  3GE8 C;  3AXC A;  1YJI A;  3A9J B;  2LEK A;  1KLU D;  1E10 A;  4H2A A;  1N5W A;  1NBF C;  3W1S A;  2LRW A;  2J53 A;  1WXM A;  3H1U A;  1PGA A;  1ET9 A;  1YJJ A;  1F2R I;  2WU5 B;  1NYQ A;  1ISN A;  1ZW7 A;  1T0S C;  4MJS A;  2BQQ A;  3QHT A;  1TKE A;  4KVG B;  1MJD A;  4FA6 A;  3AE9 B;  2CJO A;  3P4R B;  3R8B A;  4HXD A;  4FXC A;  3BK1 A;  3Q8F A;  2NPT B;  1SGH A;  1N6Z A;  4WH4 A;  4AQ7 A;  2MX2 A;  5HHD G;  3N32 A;  2L83 A;  4P1B C;  2BPS A;  2VRR B;  1LGR A;  3IXS A;  3T3O A;  4GB9 A;  4NY0 A;  2V1Y A;  3AE5 B;  4HJK A;  4HK2 A;  2CU3 A;  4YL8 A;  2MW5 A;  1WR6 E;  5AUI A;  4KDI C;  2M1M A;  1WE7 A;  1YIW A;  2L05 A;  5E6O A;  1I42 A;  2WU2 B;  3LDZ E;  2PW9 A;  4ANX A;  1C1Y B;  1TY2 A;  4ZRQ A;  4WWP A;  3ZNZ B;  2WXR A;  3U7Z A;  5T8I A;  4N9F 4;  2VH2 A;  4KZ0 A;  4KDL B;  1E8Y A;  3ZXR A;  1JCK B;  3U7D A;  3E56 A;  5BO4 B;  4EZL A;  4TMA B;  1TT5 B;  1Y8R C;  3BVM A;  3VTV A;  4B9K A;  3PZD A;  4XX5 A;  5G5G A;  2M8S A;  3N3K B;  1E7V A;  4KX6 B;  2WXP A;  1VZ8 A;  5C3J B;  3SHQ A;  2OOB B;  4BKS A;  2FID A;  1V5O A;  1FCL A;  1WM2 A;  1P9D U;  1VZ7 A;  3KLS X;  4KGS A;  1AW7 A;  2IO2 B;  2PKO A;  5E6J A;  1ZDV A;  3PRZ A;  4J3O D;  3RI7 C;  2IO0 B;  4P1C C;  4NZL B;  2KAN A;  3CST A;  1Z2M A;  3I57 A;  3RUL A;  3HM6 X;  1L7Y A;  4TSS A;  1V2Y A;  2C9W B;  3OAW A;  1WY8 A;  3NZ3 A;  4CQN A;  1L5P A;  2BT6 A;  4W9K A;  1KOT A;  1D5M C;  2PLP A;  1QOG A;  2OJW A;  1VCB A;  1Y56 A;  4CYE A;  3V3X A;  1AYF A;  5AUK A;  4G3X B;  4KKI A;  1VRA B;  1FFV A;  4IM2 A;  5IP4 D;  3KWV A;  4FLH A;  2MSE D;  4FJY A;  1GOZ A;  1FIQ A;  5TSS A;  2IGD A;  1WJU A;  2HE7 A;  3NVW A;  1MI0 A;  1AAR A;  5CX3 A;  3ZJU A;  3LYY A;  2FCN A;  4PS3 A;  2Y5P A;  3BZD B;  2KAC A;  2N0S B;  4F8C B;  4W9G A;  2CR5 A;  2KX0 A;  2ZZP B;  2B76 B;  4G11 A;  5G55 A;  1GB4 A;  4KGT A;  4WJN A;  2LJI A;  2FAZ A;  4LTU A;  4XYC A;  4W9E A;  3W5V B;  1WZ3 A;  3AUL A;  5DPS A;  4BVU C;  4ZDV A;  2KOX A;  2NCN A;  2O2V A;  5AZG A;  3QA8 A;  4MGZ E;  2INN E;  1P0R A;  3KW5 B;  4EZK A;  1GC6 A;  3FIL A;  1VJK A;  2YLM A;  3K9O B;  4YSY B;  4K1R B;  1JRU A;  3SDL C;  1N5X A;  4BOZ B;  4WAF A;  1SE4 A;  1MHH E;  4HLE A;  3EFC A;  1GG3 A;  3X0W A;  2AEH A;  2ZVO A;  5JHB A;  1QOA A;  1WIA A;  2K1F A;  2KJ6 A;  1E90 A;  3L10 B;  2EEL A;  4EE2 A;  3NRZ A;  3P2B A;  3IG3 A;  3B2F A;  4MT5 A;  2LJ5 A;  3MC9 A;  4BBN F;  1EUV B;  1WJ4 A;  2HTH A;  2DZM A;  3DBS A;  4HPM B;  3HM3 A;  2N4F A;  4A20 A;  5IO9 A;  1FNV A;  1D4B A;  3HRD D;  4LK0 M;  2C7M B;  4E71 A;  1PGX A;  4ICV A;  1T6B X;  3W1Y A;  4OVZ A;  1F9J A;  2BS4 B;  3ZNH B;  4P7I A;  4TUU A;  3P42 A;  5GXG B;  1TIF A;  3UQB A;  3DBH B;  2INC C;  3T3N A;  3DOW A;  4O1N A;  2OED A;  4FN2 A;  3WIM A;  3IFW B;  2IY0 B;  3ZVV A;  2JY6 A;  3HIZ A;  2UWQ A;  2QIE B;  1PUT A;  3DBL B;  2JYT A;  2KT7 A;  2C7H A;  2DZK A;  3IT4 B;  1E5W A;  2PEA A;  2K22 A;  5LXI B;  3DCG A;  4ITK A;  1IPG A;  2G4S A;  3DVG X;  5JXV A;  4ANU A;  1TZO A;  2GBN A;  1LM8 B;  2KDI A;  1I4Q A;  2LGI A;  4WJO A;  1NEK B;  4GDL B;  2UU7 A;  2FUH B;  1BUI C;  5BYR A;  5HI1 A;  3AEA B;  1H8C A;  4R3D A;  1UWX A;  1ZE3 D;  2M19 A;  4AS1 A;  1F77 A;  2KHW B;  3C0R B;  1D3Z A;  2WS3 B;  3DWM A;  5FK9 C;  4OZA A;  2BGF A;  3L13 A;  4C7Z A;  3WAN A;  3AEF B;  3U2S C;  1ZXI A;  2KNB A;  3PHX B;  2RSU A;  3URY A;  2LGD A;  3FAH A;  4IM3 A;  1XD3 B;  1GPX A;  4PYZ A;  2N7E A;  2WGS A;  4P6V F;  4FHJ A;  2BKF A;  3Q3N C;  2JYE A;  2K8C A;  1E7U A;  2IPK D;  1CQV A;  2AQ1 B;  1WYW B;  1EU4 A;  1WMH A;  4HVB A;  2XNA C;  4GSW A;  4IKG A;  1S3S G;  2H88 B;  2A4Z A;  2NS5 A;  3Q14 C;  5G5H A;  2K9X A;  2GLS A;  2ZW0 A;  4GIV A;  4DBG A;  3Q8C A;  4S0R A;  4JPS A;  2C60 A;  4GDK A;  1SEB D;  3AEB B;  4DQO C;  3V6C B;  4IWO A;  4XWT A;  4II3 B;  4Q2J A;  1C4C A;  5L83 A;  3Q3O C;  1WXQ A;  2R61 A;  1J7B A;  3AU5 A;  1CMX B;  2ACZ B;  4YWG G;  1NI3 A;  4RH6 A;  2Z59 B;  4M0W B;  2MBO A;  2OJR A;  2LAS A;  3VDZ A;  3M95 A;  1P7E A;  4JL9 A;  3QK0 A;  1LQB A;  3PTF C;  3RZF A;  2J52 A;  1C79 A;  1GC7 A;  2QCZ A;  2LRU A;  2Z0E B;  2D3B A;  4URK A;  2REX A;  1TGZ B;  2AYO B;  4A3O A;  2KC1 A;  2N1V A;  5C23 A;  1SJE D;  1V86 A;  2JXX A;  5E6P A;  4P16 A;  1FNW A;  1FFU A;  1YOV B;  3AE2 B;  3O65 B;  2K8B A;  4KSL C;  2N7D A;  1N61 A;  2FBW B;  3UGB B;  4HRO A;  3VXW A;  3KWL A;  4JIO U;  3DHI C;  4OVV A;  3LB8 C;  2BB5 A;  3IVF A;  1SSN A;  3FC4 A;  1T0Y A;  3QJZ A;  2QHO A;  3NY5 A;  4ANW A;  3NUH B;  4EEW A;  1FRD A;  2WXO A;  1KTK A;  5FR3 A;  4HPL B;  3R7R A;  4HWI B;  2WXF A;  1FPY A;  3VR8 B;  3NS1 A;  2O6V B;  2N9K A;  2M56 B;  3BYY B;  1WZ0 A;  1HTO A;  3AV8 A;  2GMI C;  3EUB 2;  1YMH E;  3AED B;  3ZO5 B;  2BTE A;  3VVW B;  2TSS A;  1STE A;  2LZ6 A;  4RGO S;  4LJO B;  3BVG A;  3SFD B;  1HQR D;  3IHP C;  2H89 B;  1KH0 A;  4XDD A;  2L1A A;  4AWJ A;  2WXJ A;  2RPQ A;  4MM3 A;  4C80 A;  3N9Y C;  3ZLZ A;  2KDB A;  2KLG A;  3A1Q B;  1GNU A;  3QAQ A;  3VH4 B;  4AOF A;  1KLG D;  1J7A A;  4RNA A;  4BAX A;  3EGR A;  1UNS A;  4OVU A;  2FIF A;  3PVL A;  3VFK A;  3B08 A;  2KK8 A;  1E8Z A;  2WXQ A;  4MSQ B;  1R4M B;  1M4V A;  1TTN A;  1ZOY B;  2KQ4 X;  3RYT A;  3RCZ A;  3ZXV A;  2DWQ A;  1ZPS A;  3NZS A;  4NQL B;  1A70 A;  1QZE A;  4LCD E;  4PT5 A;  1LXD A;  3KUZ A;  1WGY A;  1A5R A;  4OZB A;  4YTM B;  2LVQ A;  2MH7 A;  4K7W A;  3A9K A;  3Q8E A;  1JQ4 A;  1HXY D;  1E6E B;  1VLB A;  2ICI A;  1N62 A;  2D5G A;  3HUI A;  2I1K A;  2INP E;  4RGN A;  3CWI A;  4K7S A;  4NAW B;  2PPH A;  4HJG E;  2MWS B;  1MHX A;  2ZPY A;  2IZV B;  4KIK B;  1EO6 A;  2V3S A;  3ZUN A;  3JSV A;  4FBJ B;  2A5U A;  2GBK A;  2KMC A;  2KWD A;  4I6L B;  4WWO A;  3IAM 1;  2JPH A;  3RNF C;  3CSF A;  5HFY A;  3APC A;  3V62 A;  4ZRP A;  3IT6 B;  4C7Y A;  4JWU C;  3WA0 A;  2AQ3 B;  4GDL A;  5LLI A;  3U30 A;  3PHW B;  1WFY A;  1WXV A;  2KYW A;  1RFA A;  1YN4 A;  4RGT A;  2JU6 X;  1HZ5 A;  2WP9 B;  1ZP0 B;  3W9C B;  3M3J A;  3KH0 A;  3TJP A;  5C1Z A;  5JH5 C;  4AJW A;  4HCP B;  4LNK A;  3RZW C;  1WGG A;  4MEM A;  2KMA A;  4OZC A;  4DXF A;  1BT0 A;  4BOS C;  2G3Q B;  4DWF A;  1NVI D;  3O13 A;  4KSK C;  1ENF A;  2SEB D;  5CHF A;  1FM0 D;  1L6V A;  3M62 B;  4F7Z A;  5J2R A;  2I2Y A;  4IC7 B;  2LI5 A;  2QSD A;  4MAC A;  1F0Z A;  3PRE A;  3UI3 A;  5AZF A;  3PT2 B;  2MQJ A;  2IDY A;  2ZJD A;  2JF5 A;  4K81 A;  2WX0 A;  1XT9 B;  5H8Y E;  4BBN C;  3Q6B A;  4TQ1 A;  2MP2 B;  3SEB A;  1GUA B;  2DNF A;  3KUC B;  3DVN V;  3ZTD A;  3DPD A;  4CHK A;  1SIJ A;  1KFY B;  1OEY J;  3ALB A;  1XLN A;  3NS8 A;  1XXG A;  2DBY A;  2LUE A;  3PRP B;  2D10 A;  3BY4 B;  2LVO A;  1PYW D;  4KZC A;  1D5X C;  2IO1 B;  3ZRF A;  3BWU D;  3PZ7 A;  1LFD A;  3MHZ A;  3MP9 A;  2KQS A;  3B1L X;  4W9J A;  2ZNV C;  1KRH A;  4C56 C;  1WX7 A;  2K0P A;  1SIF A;  3AE1 B;  1HE8 A;  1YD8 U;  4RF0 A;  3DVN U;  2PIA A;  4MGK E;  1WH3 A;  1C78 A;  4N6E B;  5EE9 A;  1JWB D;  4YTN B;  4MDK E;  2IND C;  3R7Q A;  1WM3 A;  2WNM A;  4HCN B;  1QKZ A;  1DOI A;  5GMV A;  4TQ0 A;  2HD5 B;  1T5X D;  2L7R A;  4MH0 E;  4RCO A;  1Q0W B;  3NOB A;  1FXI A;  5EE0 A;  2Y5B B;  3ML9 A;  1PFD A;  4IM0 A;  4FUL A;  3ZDT A;  2G9H D;  2CS4 A;  2DYM A;  4FJZ A;  3E9S A;  4GXB A;  3V6E B;  1ESF A;  3AE8 B;  3R3M A;  2CKH B;  4QAY A;  1IBX B;  3Q3F A;  3VUW A;  1WGD A;  1I4G A;  2D3G A;  3CMM B;  4ZRK A;  3CF6 E;  4LDT D;  3TMP B;  3HK0 A;  1IYF A;  2LUM A;  5TR5 A;  2XEW A;  1CZP A;  1WX8 A;  3GB1 A;  1C4A A;  4HKQ A;  5I4D A;  2JZZ A;  2CHW A;  3VUX A;  2JX5 A;  1QF6 A;  4LDT B;  3HVZ A;  3BIN A;  3RNE C;  2LD9 A;  1HEZ E;  1K53 A;  2O6V A;  4W9F A;  1TZ1 A;  2JT4 B;  4ZYN A;  3L54 A;  2L8J A;  4LNN A;  2Y5C A;  3A4R A;  3QAR A;  3P1M A;  2RMM A;  1T3Q A;  3PRM B;  5HG2 A;  4W9L A;  1L2N A;  4FHK A;  1EF5 A;  1SE9 A;  3ZTC A;  2X8X X;  4RGM A;  2DZI A;  1WSP A;  2JUO A;  3PGE A;  2RR9 A;  4PYU A;  2MBH A;  3QC8 B;  2E6X A;  2K5P A;  4TV3 A;  3DBR I;  1JRO A;  3UF8 A;  4HRS A;  1RAX A;  1OQY A;  3RNC C;  1MG4 A;  2M0A A;  2MBQ A;  3W5U B;  1WI0 A;  4E3C A;  2X38 A;  4EUT A;  4NPN A;  2KTR B;  1E7P B;  4J6I A;  2R2Q A;  1K8R B;  2KLC A;  4K7U A;  1ZDX A;  2WQY B;  3ML8 A;  4ARC A;  2M17 A;  2KC2 A;  2LGS A;  2JXT A;  5EDS A;  3JVZ X;  2N9L A;  2LXC A;  1XLP A;  1L6U A;  2KJR A;  2JVC A;  3A9J A;  3GS2 A;  2KWV B;  2Q5W D;  3ZKJ C;  2KDF B;  2WHI A;  5BYQ A;  3V61 A;  2GI9 A;  4OHJ A;  1E8X A;  2NMQ A;  4JQW C;  2ZPN A;  3TEW A;  3AE4 B;  4HDO A;  5IN7 A;  1ET6 A;  3VUY A;  2FCM A;  1EM7 A;  3L08 A;  5C2T B;  1WGK A;  2D11 A;  3N20 C;  3VH3 B;  1B9R A;  4DDI D;  2EMT A;  4BKG A;  2MJE A;  1M94 A;  5D3D A;  4A8X C;  1K51 A;  4NAW A;  4REZ A;  4L23 A;  1XCT L;  1QOF A;  1TKY A;  3EFU A;  2NPT A;  3VTW A;  1WX9 A;  3TCA A;  1C76 A;  1HZ6 A;  3DHH C;  4WWM A;  4IW0 A;  4M8M A;  3D32 A;  1HA5 A;  4NAM A;  3PZ8 A;  1UEL A;  1XLQ A;  4DHZ E;  2NBW B;  4W9D A;  1UBQ A;  1UBI A;  3ZRC A;  3U8Z A;  5EE3 A;  1MVK A;  2WXH A;  3ZJV A;  2BYT A;  2BB6 A;  4NNJ B;  3Q3M C;  2DYO A;  2PVG C;  3AE6 B;  3PO0 A;  1FO4 A;  3H7S A;  2BF8 B;  2WDV B;  4W9I A;  2MBE A;  2XN9 C;  1J0G A;  4EFO A;  3EC8 A;  2DAF A;  4YXD B;  1FEH A;  3P4S B;  3ZGZ A;  2L32 A;  1ZKH A;  4M02 A;  2QMT A;  4NJ7 A;  3SFE B;  4IOI E;  1XLO A;  2CJN A;  3TEZ A;  3K9P B;  3V60 A;  3RN9 C;  4XC2 A;  4WUR A;  1UGM A;  3KQ4 A;  1VR9 A;  3BYT B;  3AE3 B;  4A90 A;  2N7J A;  1WGH A;  1L0V B;  2LHD A;  2MJD A;  3A4S C;  2D3A A;  1ZUD 2;  4ZHO A;  2WDR B;  4LNI A;  2Y3A A;  4MSM B;  1XQQ A;  1YX5 B;  4GLS C;  1EF1 A;  2DX5 B;  1PDX A;  3T9L A;  4WQO B;  2LWP A;  1FXA A;  1JW9 D;  4PS8 A;  3GZN B;  4YSX B;  4RM8 A;  3DQV A;  2DHZ A;  1QIL A;  3L0W B;  2FNJ B;  1FNU A;  2JRI B;  4RFB A;  5MPO A;  2WXG A;  2DLB A;  3VTU A;  1EWC A;  2RDB C;  2L52 A;  2L3Z A;  1V9J A;  2BS3 B;  1ZGU B;  5L95 C;  2QDF A;  3U4E G;  1R4N I;  4GGQ A;  1UD7 A;  2MHJ A;  2ZNV B;  4DK5 A;  3MTN B;  1R4M I;  3L16 A;  3Q3J A;  1WGR A;  4LLG M;  5IAA C;  3AH7 A;  1TBE A;  1JAL A;  1YJ1 A;  2N9E B;  1WXS A;  2KKC A;  2CHX A;  2AWT A;  4S17 A;  3VRA B;  2O2V B;  2LXA A;  2LFI A;  4G50 A;  2SAK A;  2KVZ A;  4JGH B;  1C9F A;  3U52 E;  3ZYY X;  2BYV E;  1SB3 C;  3DHG C;  1YQ4 B;  2WXK A;  3TL5 A;  3X23 A;  1D5Z C;  5IKC M;  3ZNI D;  3HVD A;  3VHT C;  5BMI A;  5KHO A;  3TEX A;  2KVR A;  3EEC A;  3P63 A;  2KWU B;  2ONQ A;  3N1Z C;  4ZHP A;  1SE3 A;  1V80 A;  2V3P A;  4X57 B;  1C3T A;  5AEK B;  4II2 B;  2KDM A;  3MJ5 A;  2QJL A;  3H9D A;  2L0T A;  2KN5 A;  2NR2 A;  2G45 B;  1MFW A;  2KXJ A;  3TSS A;  1UWM A;  2N1W A;  2J0M A;  1WWT A;  1V8C A;  5LXH A;  1ZXH A;  1Q5W B;  4DDG D;  1V1P B;  4XWW A;  2NBU A;  1J7C A;  1DOY A; 
#chains in the Genus database with same CATH homology
 1T0R C;  3RNC C;  2IND C;  3DHG C;  3RMK C;  3I63 C;  3Q14 C;  3RNB C;  3Q3N C;  3I5J C;  4P1B C;  3RI7 C;  3RNF C;  1T0S C;  3RNE C;  4P1C C;  3RNG C;  3RN9 C;  3Q2A C;  1T0Q C;  3Q3M C;  3GE8 C;  3RNA C;  3N1X C;  3DHH C;  2RDB C;  3N1Y C;  3N1Z C;  3N20 C;  2INC C;  3DHI C;  3GE3 C;  3Q3O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...