1T0RC

Crystal structure of the toluene/o-xylene monooxygenase hydroxuylase from pseudomonas stutzeri-azide bound
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
84
structure length
84
Chain Sequence
ATFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase from Pseudomonas stutzeri OX1: INSIGHT INTO THE SUBSTRATE SPECIFICITY, SUBSTRATE CHANNELING, AND ACTIVE SITE TUNING OF MULTICOMPONENT MONOOXYGENASES.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Oxidoreductase
molecule keywords toluene, o-xylene monooxygenase oxygenase subunit
total genus 23
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 1t0rC00
3RNCC 3Q2AC 4P1BC 3RN9C 3GE8C 3DHGC 3DHHC 3RNGC 3Q3NC 3RNEC 1T0QC 3RNBC 3N1ZC 3DHIC 3N20C 3N1YC 2INCC 3GE3C 1T0SC 3Q3OC 2INDC 3Q14C 4P1CC 3N1XC 3RMKC 2RDBC 3I5JC 3RNFC 1T0RC 3RNAC 3RI7C 3Q3MC 3I63C
chains in the Genus database with same CATH superfamily
3PV1A 2DZIA 2XK5B 2DYMA 1XLQA 2LUMA 3ZNID 2G45B 1WZ0A 3TIXA 4M8NA 4BKTA 2QHOA 1E90A 2LMCA 4WWPA 1WJ4A 3BYTB 2X38A 3QIJA 3SFEB 2X8XX 1GPXA 2Y5PA 2DHZA 1MG4A 2K3UA 2LGXA 2KHWB 1UD7A 3DHGC 4KVGB 4IM3A 3VR9B 3CSFA 1PDXA 1VLBA 3P4PB 1I4PA 1L2NA 1Z2MA 2BYFA 5FR6A 1YJ1A 1ZOYB 1VCBA 3P1MA 2KDFB 3DBLI 3C19A 2HDEA 2INPE 2PVOD 1E7PB 4PYZA 1KJTA 3VVWB 3ZDMC 2QJLA 4KKJA 1OGWA 2I1JA 3TEYA 4KDLB 3RNBC 1EF1A 3LDZE 2M56B 4ZHPA 4AJYB 4EZLA 4MJSB 4HWIB 3V62A 3Q3MC 1CJEA 4FULA 2KK8A 3AE3B 4HXDA 3H7PA 4ICUA 4M8MA 4DWFA 1KLGD 1U4AA 2KQSA 4P7IA 2JYEA 5MPOA 1TT5B 2JF5A 1RWSA 1XCQL 4KSLC 2PMVA 1S3SG 1N62A 1SE9A 4OVZA 2ZJDA 2MBEA 2ZPYA 3Q8AA 1Q5WB 2LI5A 3CMMB 2KVRA 3DBHB 2XK5A 4LNFA 4E71A 5IO9A 2JWZA 4ACFA 2CKHB 2ZZPB 2QMTA 2FCQA 3ML9A 3A33B 2D3AA 3V60A 1FM0D 1R7SA 1KF6B 3VUXA 2BWFA 1SSNA 2N4FA 3PHXB 3FAHA 2ZW1A 5EDSA 3WAOA 2EKIA 5I4DA 1FRRA 3OWEB 3CWIA 4B95A 1OEYJ 2CU1A 4YSXB 4I6NB 5LXIB 3A9JB 1V81A 4OZCA 3DHIC 2IBIB 2LEKA 2ASQA 4GDLA 1S1QB 2L3ZA 1N5WA 2DYBA 2G1EA 4AP4C 2MBQA 3RNCC 1C4CA 1YOVB 3PZ8A 3MJWA 3Q3JA 3UIOB 1L4ZB 4BOSC 1C3TA 3Q3NC 3AEFB 1FO4A 2V4LA 3H7SA 4K81A 1B9RA 1FFUA 4A90A 2VH2A 3PREA 3HUIA 4KZ0A 4ZHOA 3TCAA 1VJKA 1C76A 1OQQA 1E9MA 4ANUA 4D2KA 5TR5A 3QK0A 5AZHA 4XGAB 4WAFA 2L32A 1V1OA 4MACA 3ZXRA 5AEKB 5D7GA 1WR6E 3AE1B 3E56A 2WXFA 5DPTA 2AL3A 2KWCA 2O2VA 1GC6A 3QARA 2GBKA 2N9KA 3APDA 1WGKA 3WALA 4YXDB 2MLBA 1V86A 3RPFC 1L7YA 2LXAA 3PLUA 3ZLZA 4OHJA 2VRRB 3VTUA 1C77A 5HI1A 1A5RA 3FKYA 1YD8U 1V2YA 3UF8A 5JZEB 4N9F4 4FLHA 4GMVA 4MJSA 2GBNA 1I42A 4JLCA 1FCCC 4K3BA 1AWDA 4E74A 2AWTA 3EHVA 1MG8A 3IFWB 1MJDA 4XE0A 3I9V1 4QAYA 5EE0A 1JWMD 1ROEA 2IYDB 1HEZE 3QX1A 1P7FA 4WWMA 4C00A 3EUB2 1SIJA 2LGIA 3ZVVA 1KOTA 3HM3A 1VZ7A 1R4NI 2PVGC 3KH0A 1JCKB 2ZCCA 4W9LA 1QILA 1MPEA 1OQYA 1QZEA 3UI3A 2KAJA 4KGTA 4W9IA 4BBNF 2C7MB 4P1CC 4ZYNA 4KSKC 2KQ4X 1DOIA 4LLGM 1UELA 4GDKB 1WXVA 2IO3B 4C7ZA 2ACZB 1ZDXA 1Q10A 1ZW7A 2JXXA 4FJVB 1JALA 2AL6A 2YLMA 1TKEA 5BYQA 4TQ1A 3RMKC 4TUUA 2MEKA 4EKUA 4KIKA 3RCZA 4PK1A 2ZCBA 3DDCB 4YSZB 3RNGC 1NVID 5H92C 4M01A 4L1BA 1I4GA 1C4PA 1FMAD 2KVZA 3APCA 3JYUA 2MA9B 2IPKD 1SE4A 4P6VF 1T3QA 4X57B 1IUEA 3L4PA 3ZXVA 3TEWA 3T3OA 2ZW0A 4EOYA 1FNVA 4NJCA 1F77A 2G4DB 1ZKHA 3PGEA 2N7DA 4P16A 5AZGA 2LGYA 2KTRB 2KWDA 1FEHA 3P42A 3AV8A 1BT0A 1LFDA 3QJZA 4F1SA 3MC9A 2WDQB 1ZUD2 1ZP0B 4ZDVA 4R3DA 3RN9C 4TQ0A 4IWPA 1F9JA 2L05A 3O65B 1FCLA 1I4HA 3OJ4B 2W3RA 2M4NA 3DQVA 1SGHA 2WYQA 3BK2A 3H6NA 4XYCA 4A20A 1UNSA 1F52A 3DVGX 4WH4A 2M19A 1L0XB 4DXAB 1WSPA 3DBHI 1Y8RC 1ET6A 3U52E 1FNUA 1YN5A 1E6EB 1DGJA 2BQQA 4FHKA 5D2MB 3Q6BA 2M1MA 4MT5A 1AN8A 2OHFA 2KACA 3ZW3A 2INDC 5L83A 4DXFA 3ZJVA 5AZFA 1MHXA 1L0YB 4ZRIA 4MGZE 3AU5A 2L83A 4IM2A 3NZ3A 3AN1A 2W54A 4NY0A 5AUKA 3QHTA 2W3SA 2EELA 1HA5A 2G3QB 2J0MA 4W9KA 3W5VB 1UGJA 5C3JB 4F7ZA 4RF1A 2QILA 1Q1OA 1SJHD 4K7SA 1D4BA 2JVCA 1SIFA 3ALBA 1QOBA 2BB6A 1FD6A 4FBJB 5G5HA 4JE3B 2MJEA 2KC2A 3KUZA 3AEDB 3PRMB 2WDRB 5IA7A 4W9FA 1NI2A 4JQWC 2KOXA 3M62B 2KMCA 3P4SB 2K25A 1ZE3D 1JRPA 1TKYA 1SB3C 1UF0A 3WCQA 1D5MC 4ANVA 3P4RB 4KZCA 4HPPA 5HG2A 4TV3A 4GGQA 4YSYB 1XLNA 4WJQA 3SU8X 1D5XC 1L5PA 2KFJA 1R4MI 1J7AA 4GU2A 2JZPA 3ZO5B 3Q8BA 4EEWA 3A9KB 4TKNA 2KLCA 2INCC 3Q3OC 3ZDTA 3KQ4A 5J2RA 1P1AA 1WXQA 1YIWA 2N9LA 3R8BA 3TSSA 4ZRJA 2IGHA 3DPDA 1QLBB 3PZ7A 2HJ8A 3NVVA 1MHHE 2M0XA 3ML8A 2QCZA 2RDGA 2FBWB 3KVFB 1WR1A 1L4DB 3QCAA 4CYEA 1QQRA 1VRAB 3AECB 2EMSA 3OLMD 2G4SA 3V6CB 1C78A 3VHTC 4A3OA 4EUTA 1EU3A 1HTOA 2WXMA 1E8YA 3NZSA 4G3XB 4HJKA 1TTNA 3ENEA 4TMAB 2AQ1B 3BZDB 2LVPA 5FR3A 3IG3A 1XXGA 2Y5BB 3NOBA 3PRPB 2SEBD 4O1NA 2A4ZA 2BS4B 2Z0EB 3ZNGC 4KKIA 2J52A 3N3KB 2NMQA 3RZFA 2IO1B 1WH3A 3VFKA 2O6VD 3SDLC 3TL5A 2ZVNA 3MC0B 4B0MA 1GC7A 2WXKA 1V6EA 2MP2B 1EM7A 4IM0A 3I5JC 3AI5A 1GB4A 2JX5A 4FHJA 2VZKB 2GBRA 3ETRA 2WU2B 2RD0A 2RDHA 4REZA 4WWOA 3TMPB 2KWVB 1C79A 3V61A 3RNEC 4YTNB 1T0QC 1N63A 1YX6B 3Q14C 1GAQB 2LJ5A 2MBOA 1N60A 2V9HA 5IKCM 1ZGUB 4L2YA 4LJPB 3JSVA 4B9KA 1WM2A 3AE2B 1QKZA 4BKGA 5J18A 3HHMA 5FKAC 1CZPA 1FPYA 2WXNA 3L54A 3IBEA 2RGFA 3KYDD 4RMAA 5CX3A 2DX5B 2AX5A 2MJ3A 1VZ6A 2J7QB 4N58A 3RI7C 4M00A 3NVYA 3A1QB 2WXGA 2KN5A 1SF0A 2KO3A 1GG3A 1JWBD 3B2GA 2KDEB 1V5TA 3SR6A 3R7QA 4AQ7A 3AE6B 1L6UA 1V8CA 2OJRA 3ZNZB 5T8IA 2HJ1A 1L6VA 3H9DA 5E6OA 2NBWB 1VZ8A 1GNUA 2LXCA 3FC4A 2GB1A 4H2AA 1ENFA 3U8ZA 2IGDA 4JWSC 3UGBB 5EE1A 1UH6A 3IT4B 4NQLB 4IW0A 1WXMA 2LVOA 2IY1B 1ZXIA 2IO2B 1A70A 3AE8B 1CK1A 4RNAA 3PTFC 3MC8A 1JROA 4MM3B 1D6EC 3OAWA 4Q2JA 2W82A 4EZKA 3PT2B 2D5GA 3IXSA 3VR8B 2K22A 3WIMA 2E6XA 4XZ4A 1T0SC 3OJ3A 5JXVA 3N1XC 3ZUNA 4YL8A 3NS1A 3T3NA 5CTRC 5BMHA 4FJZA 2IGGA 4JGHB 3AXCA 2YEPF 1LGRA 3Q8CA 1V9JA 1WXSA 3ZIMA 3HRDD 1HQRD 2K8BA 1WFYA 4WAAA 3DBLB 3Q3FA 1WE7A 5CHVC 4YTMB 3R2TA 2WDTB 3GB1A 2BPSA 1E10A 2FIFA 2V3NA 1KTKA 4G11A 4GOCA 3RT3B 4A55A 1F1HA 3R66C 3VAWA 3IVFA 1LXDA 5E6NA 3M3JA 2K1FA 5HHDG 4NAMA 1RYJA 3DBRB 3GE3C 4HCPB 4K3CA 5IN7A 1LO5D 1FXAA 2DLBA 3T8MA 2JYTA 2FAZA 1Y56A 2BYEA 1IYFA 2BS2B 2KN4A 2KXJA 3FILB 1SXTA 2W55A 2PIAA 4J6IA 2BYTA 3AEAB 2CU3A 1C4AA 3EA6A 3PLVA 3MJ5A 2C9WB 4RGNA 2MX2A 2QEJC 1QOAA 3EFUA 5DPSA 2MH7A 5L95C 4DHJB 3PSEB 4AUQC 3W9CB 3O13A 4NNJB 1RLFA 5LNK1 1EO6A 1STEA 1XQQA 1SE3A 4JWUC 1WYGA 1I4XA 1R4MB 4C4VA 3NY5A 2KFKB 2NVUI 3B9JA 2DZMA 2WHIA 1WGYA 4AWJA 3S2AA 2N9XA 1HXYD 2WXLA 1PUTA 1PYWD 3ZNHB 3PO0A 2WXOA 1BXTA 2IDYA 4CO7A 1YN4A 4DHJD 2M17A 4PYUA 4B6WA 2WP9B 2WXIA 1AYFA 4HVBA 1WJ6A 4WJOA 2DWQA 5KHQA 2REXA 1HTQA 3PHWB 1P7EA 3KWLA 2J42A 1UWMA 2HD5B 2L52A 4ANWA 1WJNA 4II2B 3U7ZA 3MTNB 2NTTA 2NCNA 4LK0M 1TYGB 3Q8FA 1ESFA 2I38A 1TIFA 2EMTA 2PE9A 4GSWA 4HKZE 1UZXB 1V80A 1JWSD 4JL9A 1E0ZA 2W9NA 4IDIA 1J0GA 2CHZA 1DYQA 1ZDVA 3PRZA 3U4EG 4M0WB 4CQNA 4ANXA 4BBNC 4XDCA 1YQ4B 3CIRB 4USAA 3VUWA 3HIZA 3R7RA 2K39A 3URYA 4BVUC 2DNFA 4HEA1 1WRDB 4DDID 2TSSA 3H7PB 1T5XD 1VR9A 4E3CA 4MSQB 3PS6A 1OFFA 2L00B 3RFZB 4WJNA 3V3XA 2KNBA 1F2RI 2L8JA 1HZ6A 2FE8A 1GB1A 3UIPB 5G55A 1RM6C 2GRIA 3WAPA 3HVDA 2LHDA 1BMLC 2L0FA 5JHAA 2MWSB 2WXQA 4OW0A 1P9DU 3QC8B 3U7DA 4KGSA 2MHJA 5E6PA 1M94A 3EGRA 2K8HA 5G2NA 3ABVB 3KUDB 3L16A 2HTME 1NYRA 2BKFA 5CHFA 4ZOHC 2JZZA 2RPQA 1WF9A 3DVGY 4XDDA 5LXHA 3L17A 3ZGZA 3Q69A 4N59A 3A9JA 4MGKE 2CS4A 3TUOA 2N1VA 1P98A 1J7BA 4DK5A 4AS1A 2KX0A 3LYYA 2R2OA 1JW9D 1IGDA 2WQYB 3K9PB 3NS8A 1WI0A 4WJPA 1P3QU 4KIKB 1WIAA 2QSDA 1PGXA 3KWVA 2NR2A 4LNIA 3VH4B 4LTUA 3GZNI 2QIEB 3GP7A 3R2IA 2NTSA 1ISNA 4W9HA 2RDBC 2GMIC 4G50A 1TGZB 1WXAA 4MGIE 2D10A 1YNTE 2PJHA 1B1ZA 3NG0A 4LNNA 2AYOB 2KANA 1PQSA 4HCNB 4L23A 2J0KA 4BAXA 3B1LX 1UUPA 3VRAB 3BY4B 1KLUD 2KTFA 4HKQA 4RFBA 2KJRA 3SFDB 1TS4A 1KRHA 3K9OB 1RRBA 4BKSA 1AARA 1H4RA 2NPTA 1K50A 3N32A 5D94A 1WGHA 3DHHC 4WIPA 4W9CA 3ZTCA 2CHWA 1WWTA 4DBGA 2Z0DB 2WXHA 4HROA 4PS3A 3AH7A 1KLVA 3A9KA 1YMHE 3IAS1 4A6QA 3TEXA 5FK9C 2KYWA 2MBHA 1EU4A 1DOXA 4ZRQA 4FN2A 4RF0A 2K0PA 3ZYYX 2L0TA 4KX6B 5JH5C 3BVGA 1MFWA 3AMZA 2V3SA 5IOIA 2PTLA 4YT0B 1NDDA 5H8YE 1C1YB 1WY8A 1XT9B 2NBVB 3DVNU 4RGOS 1XO3A 2Y3AA 3DWGC 3VTVA 2KLGA 2ZNVB 2O6VB 4HJGE 2JRHA 3BVMA 3QQ8B 1TS3A 5IP4D 1HE8A 3L10B 4MM3A 1P0RA 4IC7B 2K8CA 3AU4A 4NJ6A 2MBBB 4BZAA 2KKCA 2KD0A 4GDKA 1PFDA 2Y5CA 2FCSA 2MJDA 2FCMA 3AM9A 3RYTA 2XN9C 2K5PA 4ICVA 3HK0A 1SEBD 3BK1A 5C23A 2N9PC 3NVWA 4RGMA 3AE9B 2WS3B 1FXTB 1N61A 3QAQA 1GUAB 1PGAA 5KHOA 4EZJA 3SD5A 1WX8A 3DWMA 1FNWA 4YWGG 2L1AA 2LZ6A 1CMXB 3ECIA 4RGTA 1F2RC 2L7RA 3M63B 4OZBA 2KMAA 1SE2A 1XLOA 3P63A 1MVKA 4F8CB 1D5ZC 2BTEA 1FFVA 5BMGA 4NZLB 4IUMB 2Z59B 2JUOA 2J0JA 2M0AA 3WA0A 5DCNA 3U30A 3BVZA 4PT5A 2LGDA 3JVZX 5GMVA 2WX1A 1XD3B 2YVCA 3BWUD 2BGFA 2IJ0A 2GI9A 4KGRA 3ZQ4A 3A4RA 1AW7A 3C8YA 4NQKE 1NENB 3KLSX 1TZOA 4ARIA 4PS7A 2IY0B 4TSSA 4LNKA 2N1WA 2DZJA 1J7CA 1FXIA 3DVNV 3DBSA 2HTHA 4C80A 2JXTA 1JRUA 2BT6A 2ICIA 4JX1C 1Z5SB 2ONQA 4CHKA 2XEWA 3L13A 5D6JB 4IKGA 3V6EB 2Z8LA 2LVQA 1RAXA 3UQAA 4I6PA 2E3TA 5EE9A 4LCDE 4C4VB 2K6DB 2DAJA 2BYVE 3CSTA 4OVUA 4AJWA 4W9EA 4DDGD 3AE4B 4FXCA 4NPNA 1IBXA 2KX3A 3RNFC 1EWYC 3MHSD 1R4NB 3ZRCA 3W1SA 2MP2A 4BOZB 5LLIA 3Q2AC 3AULA 2DYOA 1WX9A 4K1RB 1TS2A 5CHWA 2LASA 2JZ3B 1LM8B 1DOYA 2QC8A 4KDIC 3NJTA 2UYZB 1QOGA 2BVCA 3H8HA 3E9SA 2JT4B 4HPLB 2D2QA 3VDZA 2C7NB 3I57A 3SEBA 3R3MA 3P4QB 4C7YA 4DHZB 2H88B 2BKRB 3NHEB 1CQVA 2J53A 2B3AA 3P2BA 4XC2A 5HKHA 3VH3B 4ZYSA 5C2TB 2BS3B 2C60A 1T6BX 4RM9A 3PPAA 2LGSA 3PZDA 1I4RA 1N5XA 2MW5A 4WQMA 3TJPA 3NUHB 1JWAD 1Q0WB 2DAFA 2V3PA 2D11A 2LUEA 2H89B 1V5OA 4W9GA 2WLBA 2BF8B 4IG7B 2OJWA 1TZ1A 3A1QA 4RM8A 4K7UA 5C1ZA 3RUIB 3N1ZC 3D32A 1E8XA 1TBEA 1ZXHA 1E5WA 2XBBC 4ZRPA 2ZNVC 2UU7A 2OOBB 3C0RB 3AEGB 3ZTDA 2INNE 2KT7A 3VUYA 2NS5A 2WNMA 5DPRA 2JPHA 4RH6A 1TY2A 4GIVA 2VH1A 3NZUA 5DPWA 4HDQA 3GZNB 1D3ZA 4GB9A 3EECA 1V1PA 3RD2A 1GOZA 1KM7A 4GN1A 3B2FA 5HFYA 3GS2A 1SJED 2FCNA 1IP9A 3DCGA 2IZVB 2KC1A 4GXBA 4S17A 4W9JA 3AEEB 2CHXA 1K53A 1XCTL 4IOIE 2KDMA 2PEAA 2RR9A 1HZ5A 3EC8A 4I6LB 3ZKJC 4ITKA 2DBYA 3AE5B 5JHBA 5BYSA 2IO0B 3KYCD 4MSMB 4JIOU 1ET9A 1PGBA 2GOWA 2N7JA 3UQBA 2MCNB 3DBRI 1FIQA 1QOFA 4HDOA 1WGDA 2LJIA 2YEPB 4KV2A 2KJHB 3N20C 5BMIA 4K7WA 4MELA 1TY0A 4JPSA 2PPHA 4MDKE 3AEBB 4OVVA 4S0RA 2JWUA 2KWUB 4HPMB 2WXJA 3RULA 4LJOB 1JWUD 4BFRA 2G9HD 2ON8A 1RFAA 4US8A 3M95A 3HVZA 4LDTD 2FNJB 1EUVB 1UGMA 2C5LC 2GBMA 2PW9A 3EFCA 3WAMA 1IGCA 4US9A 1WGRA 2A5UA 2WXRA 3VXWA 2NPTB 3KUCB 1J8CA 4M0WA 2KJ6A 4ARCA 1VDVA 1OEYA 2R2QA 4J3OD 4IWOA 3W1SC 3N30A 3N9YC 1YJJA 1RFKA 2JU6X 1UBQA 2JSVX 2LFIA 4B0EA 2JQRB 2OEDA 4GLSC 4IWQA 1V1PB 1C9FA 2EKEC 2FUG1 2AQ2B 4EFOA 2N7EA 4OZAA 3VRBB 2UWQA 4II3B 1KH0A 2VZKD 4YTPB 1KFYB 2AEHA 1ACCA 3AE7B 2PE6B 3OG5A 4G0NB 3ZRFA 2GBJA 3BYYB 4MGYE 1IPGA 3L0WB 2D3GA 1I4QA 3MP9A 1QF6A 5BYRA 2WXPA 1TJEA 3SHQA 2V4IB 4A3PA 1M4VA 3GE8C 4GDLB 3J9CA 3W2DA 1WE6A 2D3BA 1LQBA 3VQIA 3JW0X 1J19A 1V97A 1NBFC 2V1YA 2XNAC 4FA6A 1EF5A 2FUHB 2CR5A 4WWNA 4ZRKA 3IAM1 5TSSA 4HLEA 2O6VA 2ZPNA 4PS8A 2O2VB 3U2SC 4MEMA 3NRZA 1WZ3A 1UBIA 3LB8C 3VTWA 1WM3A 3DOWA 1F0ZA 3I3TB 2LD9A 2B76B 2KMMA 2MRPA 2LRWA 1NEKB 4NJ7A 5GXGB 2WX0A 1N6ZA 2CJOA 1SBBB 2ZEQA 4BKSD 1H8CA 2SAKA 3LXFA 1XEEA 4WQOB 1K51A 2C7HA 2KQ7A 4FJYA 4HK2A 3JSVB 3HM6X 1MI0A 2KZRA 3ONSA 3A4SC 3X0WA 4UDUC 4A8XC 2CJNA 1E7VA 2AQ3B 1E8ZA 2I1KA 1WMHB 5D3IB 1NI3A 2DZKA 3QA8A 4AOFA 2R61A 4N6EB 2K9XA 4P1BC 4DXGA 1WRIA 3X23A 3APFA 2N9EB 1BUIC 2FIDA 1G6JA 2WU5B 3QWZB 5J17A 2HE7A 4M02A 1K8RB 4NAWA 1OTRB 2KDBA 3IT6B 3TBLD 2PLPA 2D07B 1OQRA 3H1UA 3CF6E 3FILA 3T9LA 2J4XA 1E7UA 1WGGA 1VD2A 3BIID 3UINB 3L08A 4WURA 3B0AA 2BW2A 4A9AA 3TEZA 3AB5A 1YQBA 2V0GA 2RSUA 1I35A 2GLSA 1XLPA 2ZVOA 5D3DA 4C56C 1GJZA 3KW5B 2QDFA 4DHZE 1NYQA 2K6QA 2JRIB 4RCOA 4LDTB 2KFKA 3LJ3A 3V05A 2LRUA 4W9DA 1L0VB 1JMLA 1EWCA 2PKOA 4MH8A 1WYWB 1UWXA 5EE3A 1YX5B 2D3CA 1IBXB 4DQOC 1E8WA 4LNOA 3IHPC 4XWTA 2WDVB 3ZJTA 1T0YA 2MQJA 4EE2A 3ZJUA 2BB5A 3N1YC 4ASWC 2I2YA 1WMHA 3MHZA 1K52A 1QT9A 1FRDA 2LHEA 3RNAC 3Q8EA 2KDIA 3RZWC 3W1YA 2KTRA 2L76A 1TKGA 1YQ3B 2N0SB 2LWPA 2RPVA 2BBCA 2Q5WD 2JY6A 2WGSA 3GOEA 3PVLA 2M8SA 3B08A 4FADA 5G5GA 4XX5A 3MFGA 2BWES 1XF5L 4NAWB 1YJIA 1T0RC 2RMMA 3NVZA 2WWZA 4HRSA 5E6JA 5IAAC 2MSED 1I7HA 3W5UB 1V49A 1JQ4A 1YN3A 2NBUA 1X1MA 1ZPSA 5AUIA 4URKA 4XWWA 4MH0E 5BO4B 2DENB 3BINA 1TS5A 1WJUA 1WX7A 3I63C 3WANA
chains in the Genus database with same CATH topology
3RNCC 3Q2AC 4P1BC 3RN9C 3GE8C 3DHGC 3DHHC 3RNGC 3Q3NC 3RNEC 1T0QC 3RNBC 3N1ZC 3DHIC 3N20C 3N1YC 2INCC 3GE3C 1T0SC 3Q3OC 2INDC 3Q14C 4P1CC 3N1XC 3RMKC 2RDBC 3I5JC 3RNFC 1T0RC 3RNAC 3RI7C 3Q3MC 3I63C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RNC C;  3Q2A C;  4P1B C;  3RN9 C;  3GE8 C;  3DHG C;  3DHH C;  3RNG C;  3Q3N C;  3RNE C;  1T0Q C;  3RNB C;  3N1Z C;  3DHI C;  3N20 C;  3N1Y C;  2INC C;  3GE3 C;  1T0S C;  3Q3O C;  2IND C;  3Q14 C;  4P1C C;  3N1X C;  3RMK C;  2RDB C;  3I5J C;  3RNF C;  1T0R C;  3RNA C;  3RI7 C;  3Q3M C;  3I63 C; 
#chains in the Genus database with same CATH topology
 3PV1 A;  2DZI A;  2XK5 B;  2DYM A;  1XLQ A;  2LUM A;  3ZNI D;  2G45 B;  1WZ0 A;  3TIX A;  4M8N A;  4BKT A;  2QHO A;  1E90 A;  2LMC A;  4WWP A;  1WJ4 A;  3BYT B;  2X38 A;  3QIJ A;  3SFE B;  2X8X X;  1GPX A;  2Y5P A;  2DHZ A;  1MG4 A;  2K3U A;  2LGX A;  2KHW B;  1UD7 A;  3DHG C;  4KVG B;  4IM3 A;  3VR9 B;  3CSF A;  1PDX A;  1VLB A;  3P4P B;  1I4P A;  1L2N A;  1Z2M A;  2BYF A;  5FR6 A;  1YJ1 A;  1ZOY B;  1VCB A;  3P1M A;  2KDF B;  3DBL I;  3C19 A;  2HDE A;  2INP E;  2PVO D;  1E7P B;  4PYZ A;  1KJT A;  3VVW B;  3ZDM C;  2QJL A;  4KKJ A;  1OGW A;  2I1J A;  3TEY A;  4KDL B;  3RNB C;  1EF1 A;  3LDZ E;  2M56 B;  4ZHP A;  4AJY B;  4EZL A;  4MJS B;  4HWI B;  3V62 A;  3Q3M C;  1CJE A;  4FUL A;  2KK8 A;  3AE3 B;  4HXD A;  3H7P A;  4ICU A;  4M8M A;  4DWF A;  1KLG D;  1U4A A;  2KQS A;  4P7I A;  2JYE A;  5MPO A;  1TT5 B;  2JF5 A;  1RWS A;  1XCQ L;  4KSL C;  2PMV A;  1S3S G;  1N62 A;  1SE9 A;  4OVZ A;  2ZJD A;  2MBE A;  2ZPY A;  3Q8A A;  1Q5W B;  2LI5 A;  3CMM B;  2KVR A;  3DBH B;  2XK5 A;  4LNF A;  4E71 A;  5IO9 A;  2JWZ A;  4ACF A;  2CKH B;  2ZZP B;  2QMT A;  2FCQ A;  3ML9 A;  3A33 B;  2D3A A;  3V60 A;  1FM0 D;  1R7S A;  1KF6 B;  3VUX A;  2BWF A;  1SSN A;  2N4F A;  3PHX B;  3FAH A;  2ZW1 A;  5EDS A;  3WAO A;  2EKI A;  5I4D A;  1FRR A;  3OWE B;  3CWI A;  4B95 A;  1OEY J;  2CU1 A;  4YSX B;  4I6N B;  5LXI B;  3A9J B;  1V81 A;  4OZC A;  3DHI C;  2IBI B;  2LEK A;  2ASQ A;  4GDL A;  1S1Q B;  2L3Z A;  1N5W A;  2DYB A;  2G1E A;  4AP4 C;  2MBQ A;  3RNC C;  1C4C A;  1YOV B;  3PZ8 A;  3MJW A;  3Q3J A;  3UIO B;  1L4Z B;  4BOS C;  1C3T A;  3Q3N C;  3AEF B;  1FO4 A;  2V4L A;  3H7S A;  4K81 A;  1B9R A;  1FFU A;  4A90 A;  2VH2 A;  3PRE A;  3HUI A;  4KZ0 A;  4ZHO A;  3TCA A;  1VJK A;  1C76 A;  1OQQ A;  1E9M A;  4ANU A;  4D2K A;  5TR5 A;  3QK0 A;  5AZH A;  4XGA B;  4WAF A;  2L32 A;  1V1O A;  4MAC A;  3ZXR A;  5AEK B;  5D7G A;  1WR6 E;  3AE1 B;  3E56 A;  2WXF A;  5DPT A;  2AL3 A;  2KWC A;  2O2V A;  1GC6 A;  3QAR A;  2GBK A;  2N9K A;  3APD A;  1WGK A;  3WAL A;  4YXD B;  2MLB A;  1V86 A;  3RPF C;  1L7Y A;  2LXA A;  3PLU A;  3ZLZ A;  4OHJ A;  2VRR B;  3VTU A;  1C77 A;  5HI1 A;  1A5R A;  3FKY A;  1YD8 U;  1V2Y A;  3UF8 A;  5JZE B;  4N9F 4;  4FLH A;  4GMV A;  4MJS A;  2GBN A;  1I42 A;  4JLC A;  1FCC C;  4K3B A;  1AWD A;  4E74 A;  2AWT A;  3EHV A;  1MG8 A;  3IFW B;  1MJD A;  4XE0 A;  3I9V 1;  4QAY A;  5EE0 A;  1JWM D;  1ROE A;  2IYD B;  1HEZ E;  3QX1 A;  1P7F A;  4WWM A;  4C00 A;  3EUB 2;  1SIJ A;  2LGI A;  3ZVV A;  1KOT A;  3HM3 A;  1VZ7 A;  1R4N I;  2PVG C;  3KH0 A;  1JCK B;  2ZCC A;  4W9L A;  1QIL A;  1MPE A;  1OQY A;  1QZE A;  3UI3 A;  2KAJ A;  4KGT A;  4W9I A;  4BBN F;  2C7M B;  4P1C C;  4ZYN A;  4KSK C;  2KQ4 X;  1DOI A;  4LLG M;  1UEL A;  4GDK B;  1WXV A;  2IO3 B;  4C7Z A;  2ACZ B;  1ZDX A;  1Q10 A;  1ZW7 A;  2JXX A;  4FJV B;  1JAL A;  2AL6 A;  2YLM A;  1TKE A;  5BYQ A;  4TQ1 A;  3RMK C;  4TUU A;  2MEK A;  4EKU A;  4KIK A;  3RCZ A;  4PK1 A;  2ZCB A;  3DDC B;  4YSZ B;  3RNG C;  1NVI D;  5H92 C;  4M01 A;  4L1B A;  1I4G A;  1C4P A;  1FMA D;  2KVZ A;  3APC A;  3JYU A;  2MA9 B;  2IPK D;  1SE4 A;  4P6V F;  1T3Q A;  4X57 B;  1IUE A;  3L4P A;  3ZXV A;  3TEW A;  3T3O A;  2ZW0 A;  4EOY A;  1FNV A;  4NJC A;  1F77 A;  2G4D B;  1ZKH A;  3PGE A;  2N7D A;  4P16 A;  5AZG A;  2LGY A;  2KTR B;  2KWD A;  1FEH A;  3P42 A;  3AV8 A;  1BT0 A;  1LFD A;  3QJZ A;  4F1S A;  3MC9 A;  2WDQ B;  1ZUD 2;  1ZP0 B;  4ZDV A;  4R3D A;  3RN9 C;  4TQ0 A;  4IWP A;  1F9J A;  2L05 A;  3O65 B;  1FCL A;  1I4H A;  3OJ4 B;  2W3R A;  2M4N A;  3DQV A;  1SGH A;  2WYQ A;  3BK2 A;  3H6N A;  4XYC A;  4A20 A;  1UNS A;  1F52 A;  3DVG X;  4WH4 A;  2M19 A;  1L0X B;  4DXA B;  1WSP A;  3DBH I;  1Y8R C;  1ET6 A;  3U52 E;  1FNU A;  1YN5 A;  1E6E B;  1DGJ A;  2BQQ A;  4FHK A;  5D2M B;  3Q6B A;  2M1M A;  4MT5 A;  1AN8 A;  2OHF A;  2KAC A;  3ZW3 A;  2IND C;  5L83 A;  4DXF A;  3ZJV A;  5AZF A;  1MHX A;  1L0Y B;  4ZRI A;  4MGZ E;  3AU5 A;  2L83 A;  4IM2 A;  3NZ3 A;  3AN1 A;  2W54 A;  4NY0 A;  5AUK A;  3QHT A;  2W3S A;  2EEL A;  1HA5 A;  2G3Q B;  2J0M A;  4W9K A;  3W5V B;  1UGJ A;  5C3J B;  4F7Z A;  4RF1 A;  2QIL A;  1Q1O A;  1SJH D;  4K7S A;  1D4B A;  2JVC A;  1SIF A;  3ALB A;  1QOB A;  2BB6 A;  1FD6 A;  4FBJ B;  5G5H A;  4JE3 B;  2MJE A;  2KC2 A;  3KUZ A;  3AED B;  3PRM B;  2WDR B;  5IA7 A;  4W9F A;  1NI2 A;  4JQW C;  2KOX A;  3M62 B;  2KMC A;  3P4S B;  2K25 A;  1ZE3 D;  1JRP A;  1TKY A;  1SB3 C;  1UF0 A;  3WCQ A;  1D5M C;  4ANV A;  3P4R B;  4KZC A;  4HPP A;  5HG2 A;  4TV3 A;  4GGQ A;  4YSY B;  1XLN A;  4WJQ A;  3SU8 X;  1D5X C;  1L5P A;  2KFJ A;  1R4M I;  1J7A A;  4GU2 A;  2JZP A;  3ZO5 B;  3Q8B A;  4EEW A;  3A9K B;  4TKN A;  2KLC A;  2INC C;  3Q3O C;  3ZDT A;  3KQ4 A;  5J2R A;  1P1A A;  1WXQ A;  1YIW A;  2N9L A;  3R8B A;  3TSS A;  4ZRJ A;  2IGH A;  3DPD A;  1QLB B;  3PZ7 A;  2HJ8 A;  3NVV A;  1MHH E;  2M0X A;  3ML8 A;  2QCZ A;  2RDG A;  2FBW B;  3KVF B;  1WR1 A;  1L4D B;  3QCA A;  4CYE A;  1QQR A;  1VRA B;  3AEC B;  2EMS A;  3OLM D;  2G4S A;  3V6C B;  1C78 A;  3VHT C;  4A3O A;  4EUT A;  1EU3 A;  1HTO A;  2WXM A;  1E8Y A;  3NZS A;  4G3X B;  4HJK A;  1TTN A;  3ENE A;  4TMA B;  2AQ1 B;  3BZD B;  2LVP A;  5FR3 A;  3IG3 A;  1XXG A;  2Y5B B;  3NOB A;  3PRP B;  2SEB D;  4O1N A;  2A4Z A;  2BS4 B;  2Z0E B;  3ZNG C;  4KKI A;  2J52 A;  3N3K B;  2NMQ A;  3RZF A;  2IO1 B;  1WH3 A;  3VFK A;  2O6V D;  3SDL C;  3TL5 A;  2ZVN A;  3MC0 B;  4B0M A;  1GC7 A;  2WXK A;  1V6E A;  2MP2 B;  1EM7 A;  4IM0 A;  3I5J C;  3AI5 A;  1GB4 A;  2JX5 A;  4FHJ A;  2VZK B;  2GBR A;  3ETR A;  2WU2 B;  2RD0 A;  2RDH A;  4REZ A;  4WWO A;  3TMP B;  2KWV B;  1C79 A;  3V61 A;  3RNE C;  4YTN B;  1T0Q C;  1N63 A;  1YX6 B;  3Q14 C;  1GAQ B;  2LJ5 A;  2MBO A;  1N60 A;  2V9H A;  5IKC M;  1ZGU B;  4L2Y A;  4LJP B;  3JSV A;  4B9K A;  1WM2 A;  3AE2 B;  1QKZ A;  4BKG A;  5J18 A;  3HHM A;  5FKA C;  1CZP A;  1FPY A;  2WXN A;  3L54 A;  3IBE A;  2RGF A;  3KYD D;  4RMA A;  5CX3 A;  2DX5 B;  2AX5 A;  2MJ3 A;  1VZ6 A;  2J7Q B;  4N58 A;  3RI7 C;  4M00 A;  3NVY A;  3A1Q B;  2WXG A;  2KN5 A;  1SF0 A;  2KO3 A;  1GG3 A;  1JWB D;  3B2G A;  2KDE B;  1V5T A;  3SR6 A;  3R7Q A;  4AQ7 A;  3AE6 B;  1L6U A;  1V8C A;  2OJR A;  3ZNZ B;  5T8I A;  2HJ1 A;  1L6V A;  3H9D A;  5E6O A;  2NBW B;  1VZ8 A;  1GNU A;  2LXC A;  3FC4 A;  2GB1 A;  4H2A A;  1ENF A;  3U8Z A;  2IGD A;  4JWS C;  3UGB B;  5EE1 A;  1UH6 A;  3IT4 B;  4NQL B;  4IW0 A;  1WXM A;  2LVO A;  2IY1 B;  1ZXI A;  2IO2 B;  1A70 A;  3AE8 B;  1CK1 A;  4RNA A;  3PTF C;  3MC8 A;  1JRO A;  4MM3 B;  1D6E C;  3OAW A;  4Q2J A;  2W82 A;  4EZK A;  3PT2 B;  2D5G A;  3IXS A;  3VR8 B;  2K22 A;  3WIM A;  2E6X A;  4XZ4 A;  1T0S C;  3OJ3 A;  5JXV A;  3N1X C;  3ZUN A;  4YL8 A;  3NS1 A;  3T3N A;  5CTR C;  5BMH A;  4FJZ A;  2IGG A;  4JGH B;  3AXC A;  2YEP F;  1LGR A;  3Q8C A;  1V9J A;  1WXS A;  3ZIM A;  3HRD D;  1HQR D;  2K8B A;  1WFY A;  4WAA A;  3DBL B;  3Q3F A;  1WE7 A;  5CHV C;  4YTM B;  3R2T A;  2WDT B;  3GB1 A;  2BPS A;  1E10 A;  2FIF A;  2V3N A;  1KTK A;  4G11 A;  4GOC A;  3RT3 B;  4A55 A;  1F1H A;  3R66 C;  3VAW A;  3IVF A;  1LXD A;  5E6N A;  3M3J A;  2K1F A;  5HHD G;  4NAM A;  1RYJ A;  3DBR B;  3GE3 C;  4HCP B;  4K3C A;  5IN7 A;  1LO5 D;  1FXA A;  2DLB A;  3T8M A;  2JYT A;  2FAZ A;  1Y56 A;  2BYE A;  1IYF A;  2BS2 B;  2KN4 A;  2KXJ A;  3FIL B;  1SXT A;  2W55 A;  2PIA A;  4J6I A;  2BYT A;  3AEA B;  2CU3 A;  1C4A A;  3EA6 A;  3PLV A;  3MJ5 A;  2C9W B;  4RGN A;  2MX2 A;  2QEJ C;  1QOA A;  3EFU A;  5DPS A;  2MH7 A;  5L95 C;  4DHJ B;  3PSE B;  4AUQ C;  3W9C B;  3O13 A;  4NNJ B;  1RLF A;  5LNK 1;  1EO6 A;  1STE A;  1XQQ A;  1SE3 A;  4JWU C;  1WYG A;  1I4X A;  1R4M B;  4C4V A;  3NY5 A;  2KFK B;  2NVU I;  3B9J A;  2DZM A;  2WHI A;  1WGY A;  4AWJ A;  3S2A A;  2N9X A;  1HXY D;  2WXL A;  1PUT A;  1PYW D;  3ZNH B;  3PO0 A;  2WXO A;  1BXT A;  2IDY A;  4CO7 A;  1YN4 A;  4DHJ D;  2M17 A;  4PYU A;  4B6W A;  2WP9 B;  2WXI A;  1AYF A;  4HVB A;  1WJ6 A;  4WJO A;  2DWQ A;  5KHQ A;  2REX A;  1HTQ A;  3PHW B;  1P7E A;  3KWL A;  2J42 A;  1UWM A;  2HD5 B;  2L52 A;  4ANW A;  1WJN A;  4II2 B;  3U7Z A;  3MTN B;  2NTT A;  2NCN A;  4LK0 M;  1TYG B;  3Q8F A;  1ESF A;  2I38 A;  1TIF A;  2EMT A;  2PE9 A;  4GSW A;  4HKZ E;  1UZX B;  1V80 A;  1JWS D;  4JL9 A;  1E0Z A;  2W9N A;  4IDI A;  1J0G A;  2CHZ A;  1DYQ A;  1ZDV A;  3PRZ A;  3U4E G;  4M0W B;  4CQN A;  4ANX A;  4BBN C;  4XDC A;  1YQ4 B;  3CIR B;  4USA A;  3VUW A;  3HIZ A;  3R7R A;  2K39 A;  3URY A;  4BVU C;  2DNF A;  4HEA 1;  1WRD B;  4DDI D;  2TSS A;  3H7P B;  1T5X D;  1VR9 A;  4E3C A;  4MSQ B;  3PS6 A;  1OFF A;  2L00 B;  3RFZ B;  4WJN A;  3V3X A;  2KNB A;  1F2R I;  2L8J A;  1HZ6 A;  2FE8 A;  1GB1 A;  3UIP B;  5G55 A;  1RM6 C;  2GRI A;  3WAP A;  3HVD A;  2LHD A;  1BML C;  2L0F A;  5JHA A;  2MWS B;  2WXQ A;  4OW0 A;  1P9D U;  3QC8 B;  3U7D A;  4KGS A;  2MHJ A;  5E6P A;  1M94 A;  3EGR A;  2K8H A;  5G2N A;  3ABV B;  3KUD B;  3L16 A;  2HTM E;  1NYR A;  2BKF A;  5CHF A;  4ZOH C;  2JZZ A;  2RPQ A;  1WF9 A;  3DVG Y;  4XDD A;  5LXH A;  3L17 A;  3ZGZ A;  3Q69 A;  4N59 A;  3A9J A;  4MGK E;  2CS4 A;  3TUO A;  2N1V A;  1P98 A;  1J7B A;  4DK5 A;  4AS1 A;  2KX0 A;  3LYY A;  2R2O A;  1JW9 D;  1IGD A;  2WQY B;  3K9P B;  3NS8 A;  1WI0 A;  4WJP A;  1P3Q U;  4KIK B;  1WIA A;  2QSD A;  1PGX A;  3KWV A;  2NR2 A;  4LNI A;  3VH4 B;  4LTU A;  3GZN I;  2QIE B;  3GP7 A;  3R2I A;  2NTS A;  1ISN A;  4W9H A;  2RDB C;  2GMI C;  4G50 A;  1TGZ B;  1WXA A;  4MGI E;  2D10 A;  1YNT E;  2PJH A;  1B1Z A;  3NG0 A;  4LNN A;  2AYO B;  2KAN A;  1PQS A;  4HCN B;  4L23 A;  2J0K A;  4BAX A;  3B1L X;  1UUP A;  3VRA B;  3BY4 B;  1KLU D;  2KTF A;  4HKQ A;  4RFB A;  2KJR A;  3SFD B;  1TS4 A;  1KRH A;  3K9O B;  1RRB A;  4BKS A;  1AAR A;  1H4R A;  2NPT A;  1K50 A;  3N32 A;  5D94 A;  1WGH A;  3DHH C;  4WIP A;  4W9C A;  3ZTC A;  2CHW A;  1WWT A;  4DBG A;  2Z0D B;  2WXH A;  4HRO A;  4PS3 A;  3AH7 A;  1KLV A;  3A9K A;  1YMH E;  3IAS 1;  4A6Q A;  3TEX A;  5FK9 C;  2KYW A;  2MBH A;  1EU4 A;  1DOX A;  4ZRQ A;  4FN2 A;  4RF0 A;  2K0P A;  3ZYY X;  2L0T A;  4KX6 B;  5JH5 C;  3BVG A;  1MFW A;  3AMZ A;  2V3S A;  5IOI A;  2PTL A;  4YT0 B;  1NDD A;  5H8Y E;  1C1Y B;  1WY8 A;  1XT9 B;  2NBV B;  3DVN U;  4RGO S;  1XO3 A;  2Y3A A;  3DWG C;  3VTV A;  2KLG A;  2ZNV B;  2O6V B;  4HJG E;  2JRH A;  3BVM A;  3QQ8 B;  1TS3 A;  5IP4 D;  1HE8 A;  3L10 B;  4MM3 A;  1P0R A;  4IC7 B;  2K8C A;  3AU4 A;  4NJ6 A;  2MBB B;  4BZA A;  2KKC A;  2KD0 A;  4GDK A;  1PFD A;  2Y5C A;  2FCS A;  2MJD A;  2FCM A;  3AM9 A;  3RYT A;  2XN9 C;  2K5P A;  4ICV A;  3HK0 A;  1SEB D;  3BK1 A;  5C23 A;  2N9P C;  3NVW A;  4RGM A;  3AE9 B;  2WS3 B;  1FXT B;  1N61 A;  3QAQ A;  1GUA B;  1PGA A;  5KHO A;  4EZJ A;  3SD5 A;  1WX8 A;  3DWM A;  1FNW A;  4YWG G;  2L1A A;  2LZ6 A;  1CMX B;  3ECI A;  4RGT A;  1F2R C;  2L7R A;  3M63 B;  4OZB A;  2KMA A;  1SE2 A;  1XLO A;  3P63 A;  1MVK A;  4F8C B;  1D5Z C;  2BTE A;  1FFV A;  5BMG A;  4NZL B;  4IUM B;  2Z59 B;  2JUO A;  2J0J A;  2M0A A;  3WA0 A;  5DCN A;  3U30 A;  3BVZ A;  4PT5 A;  2LGD A;  3JVZ X;  5GMV A;  2WX1 A;  1XD3 B;  2YVC A;  3BWU D;  2BGF A;  2IJ0 A;  2GI9 A;  4KGR A;  3ZQ4 A;  3A4R A;  1AW7 A;  3C8Y A;  4NQK E;  1NEN B;  3KLS X;  1TZO A;  4ARI A;  4PS7 A;  2IY0 B;  4TSS A;  4LNK A;  2N1W A;  2DZJ A;  1J7C A;  1FXI A;  3DVN V;  3DBS A;  2HTH A;  4C80 A;  2JXT A;  1JRU A;  2BT6 A;  2ICI A;  4JX1 C;  1Z5S B;  2ONQ A;  4CHK A;  2XEW A;  3L13 A;  5D6J B;  4IKG A;  3V6E B;  2Z8L A;  2LVQ A;  1RAX A;  3UQA A;  4I6P A;  2E3T A;  5EE9 A;  4LCD E;  4C4V B;  2K6D B;  2DAJ A;  2BYV E;  3CST A;  4OVU A;  4AJW A;  4W9E A;  4DDG D;  3AE4 B;  4FXC A;  4NPN A;  1IBX A;  2KX3 A;  3RNF C;  1EWY C;  3MHS D;  1R4N B;  3ZRC A;  3W1S A;  2MP2 A;  4BOZ B;  5LLI A;  3Q2A C;  3AUL A;  2DYO A;  1WX9 A;  4K1R B;  1TS2 A;  5CHW A;  2LAS A;  2JZ3 B;  1LM8 B;  1DOY A;  2QC8 A;  4KDI C;  3NJT A;  2UYZ B;  1QOG A;  2BVC A;  3H8H A;  3E9S A;  2JT4 B;  4HPL B;  2D2Q A;  3VDZ A;  2C7N B;  3I57 A;  3SEB A;  3R3M A;  3P4Q B;  4C7Y A;  4DHZ B;  2H88 B;  2BKR B;  3NHE B;  1CQV A;  2J53 A;  2B3A A;  3P2B A;  4XC2 A;  5HKH A;  3VH3 B;  4ZYS A;  5C2T B;  2BS3 B;  2C60 A;  1T6B X;  4RM9 A;  3PPA A;  2LGS A;  3PZD A;  1I4R A;  1N5X A;  2MW5 A;  4WQM A;  3TJP A;  3NUH B;  1JWA D;  1Q0W B;  2DAF A;  2V3P A;  2D11 A;  2LUE A;  2H89 B;  1V5O A;  4W9G A;  2WLB A;  2BF8 B;  4IG7 B;  2OJW A;  1TZ1 A;  3A1Q A;  4RM8 A;  4K7U A;  5C1Z A;  3RUI B;  3N1Z C;  3D32 A;  1E8X A;  1TBE A;  1ZXH A;  1E5W A;  2XBB C;  4ZRP A;  2ZNV C;  2UU7 A;  2OOB B;  3C0R B;  3AEG B;  3ZTD A;  2INN E;  2KT7 A;  3VUY A;  2NS5 A;  2WNM A;  5DPR A;  2JPH A;  4RH6 A;  1TY2 A;  4GIV A;  2VH1 A;  3NZU A;  5DPW A;  4HDQ A;  3GZN B;  1D3Z A;  4GB9 A;  3EEC A;  1V1P A;  3RD2 A;  1GOZ A;  1KM7 A;  4GN1 A;  3B2F A;  5HFY A;  3GS2 A;  1SJE D;  2FCN A;  1IP9 A;  3DCG A;  2IZV B;  2KC1 A;  4GXB A;  4S17 A;  4W9J A;  3AEE B;  2CHX A;  1K53 A;  1XCT L;  4IOI E;  2KDM A;  2PEA A;  2RR9 A;  1HZ5 A;  3EC8 A;  4I6L B;  3ZKJ C;  4ITK A;  2DBY A;  3AE5 B;  5JHB A;  5BYS A;  2IO0 B;  3KYC D;  4MSM B;  4JIO U;  1ET9 A;  1PGB A;  2GOW A;  2N7J A;  3UQB A;  2MCN B;  3DBR I;  1FIQ A;  1QOF A;  4HDO A;  1WGD A;  2LJI A;  2YEP B;  4KV2 A;  2KJH B;  3N20 C;  5BMI A;  4K7W A;  4MEL A;  1TY0 A;  4JPS A;  2PPH A;  4MDK E;  3AEB B;  4OVV A;  4S0R A;  2JWU A;  2KWU B;  4HPM B;  2WXJ A;  3RUL A;  4LJO B;  1JWU D;  4BFR A;  2G9H D;  2ON8 A;  1RFA A;  4US8 A;  3M95 A;  3HVZ A;  4LDT D;  2FNJ B;  1EUV B;  1UGM A;  2C5L C;  2GBM A;  2PW9 A;  3EFC A;  3WAM A;  1IGC A;  4US9 A;  1WGR A;  2A5U A;  2WXR A;  3VXW A;  2NPT B;  3KUC B;  1J8C A;  4M0W A;  2KJ6 A;  4ARC A;  1VDV A;  1OEY A;  2R2Q A;  4J3O D;  4IWO A;  3W1S C;  3N30 A;  3N9Y C;  1YJJ A;  1RFK A;  2JU6 X;  1UBQ A;  2JSV X;  2LFI A;  4B0E A;  2JQR B;  2OED A;  4GLS C;  4IWQ A;  1V1P B;  1C9F A;  2EKE C;  2FUG 1;  2AQ2 B;  4EFO A;  2N7E A;  4OZA A;  3VRB B;  2UWQ A;  4II3 B;  1KH0 A;  2VZK D;  4YTP B;  1KFY B;  2AEH A;  1ACC A;  3AE7 B;  2PE6 B;  3OG5 A;  4G0N B;  3ZRF A;  2GBJ A;  3BYY B;  4MGY E;  1IPG A;  3L0W B;  2D3G A;  1I4Q A;  3MP9 A;  1QF6 A;  5BYR A;  2WXP A;  1TJE A;  3SHQ A;  2V4I B;  4A3P A;  1M4V A;  3GE8 C;  4GDL B;  3J9C A;  3W2D A;  1WE6 A;  2D3B A;  1LQB A;  3VQI A;  3JW0 X;  1J19 A;  1V97 A;  1NBF C;  2V1Y A;  2XNA C;  4FA6 A;  1EF5 A;  2FUH B;  2CR5 A;  4WWN A;  4ZRK A;  3IAM 1;  5TSS A;  4HLE A;  2O6V A;  2ZPN A;  4PS8 A;  2O2V B;  3U2S C;  4MEM A;  3NRZ A;  1WZ3 A;  1UBI A;  3LB8 C;  3VTW A;  1WM3 A;  3DOW A;  1F0Z A;  3I3T B;  2LD9 A;  2B76 B;  2KMM A;  2MRP A;  2LRW A;  1NEK B;  4NJ7 A;  5GXG B;  2WX0 A;  1N6Z A;  2CJO A;  1SBB B;  2ZEQ A;  4BKS D;  1H8C A;  2SAK A;  3LXF A;  1XEE A;  4WQO B;  1K51 A;  2C7H A;  2KQ7 A;  4FJY A;  4HK2 A;  3JSV B;  3HM6 X;  1MI0 A;  2KZR A;  3ONS A;  3A4S C;  3X0W A;  4UDU C;  4A8X C;  2CJN A;  1E7V A;  2AQ3 B;  1E8Z A;  2I1K A;  1WMH B;  5D3I B;  1NI3 A;  2DZK A;  3QA8 A;  4AOF A;  2R61 A;  4N6E B;  2K9X A;  4P1B C;  4DXG A;  1WRI A;  3X23 A;  3APF A;  2N9E B;  1BUI C;  2FID A;  1G6J A;  2WU5 B;  3QWZ B;  5J17 A;  2HE7 A;  4M02 A;  1K8R B;  4NAW A;  1OTR B;  2KDB A;  3IT6 B;  3TBL D;  2PLP A;  2D07 B;  1OQR A;  3H1U A;  3CF6 E;  3FIL A;  3T9L A;  2J4X A;  1E7U A;  1WGG A;  1VD2 A;  3BII D;  3UIN B;  3L08 A;  4WUR A;  3B0A A;  2BW2 A;  4A9A A;  3TEZ A;  3AB5 A;  1YQB A;  2V0G A;  2RSU A;  1I35 A;  2GLS A;  1XLP A;  2ZVO A;  5D3D A;  4C56 C;  1GJZ A;  3KW5 B;  2QDF A;  4DHZ E;  1NYQ A;  2K6Q A;  2JRI B;  4RCO A;  4LDT B;  2KFK A;  3LJ3 A;  3V05 A;  2LRU A;  4W9D A;  1L0V B;  1JML A;  1EWC A;  2PKO A;  4MH8 A;  1WYW B;  1UWX A;  5EE3 A;  1YX5 B;  2D3C A;  1IBX B;  4DQO C;  1E8W A;  4LNO A;  3IHP C;  4XWT A;  2WDV B;  3ZJT A;  1T0Y A;  2MQJ A;  4EE2 A;  3ZJU A;  2BB5 A;  3N1Y C;  4ASW C;  2I2Y A;  1WMH A;  3MHZ A;  1K52 A;  1QT9 A;  1FRD A;  2LHE A;  3RNA C;  3Q8E A;  2KDI A;  3RZW C;  3W1Y A;  2KTR A;  2L76 A;  1TKG A;  1YQ3 B;  2N0S B;  2LWP A;  2RPV A;  2BBC A;  2Q5W D;  2JY6 A;  2WGS A;  3GOE A;  3PVL A;  2M8S A;  3B08 A;  4FAD A;  5G5G A;  4XX5 A;  3MFG A;  2BWE S;  1XF5 L;  4NAW B;  1YJI A;  1T0R C;  2RMM A;  3NVZ A;  2WWZ A;  4HRS A;  5E6J A;  5IAA C;  2MSE D;  1I7H A;  3W5U B;  1V49 A;  1JQ4 A;  1YN3 A;  2NBU A;  1X1M A;  1ZPS A;  5AUI A;  4URK A;  4XWW A;  4MH0 E;  5BO4 B;  2DEN B;  3BIN A;  1TS5 A;  1WJU A;  1WX7 A;  3I63 C;  3WAN A; 
#chains in the Genus database with same CATH homology
 3RNC C;  3Q2A C;  4P1B C;  3RN9 C;  3GE8 C;  3DHG C;  3DHH C;  3RNG C;  3Q3N C;  3RNE C;  1T0Q C;  3RNB C;  3N1Z C;  3DHI C;  3N20 C;  3N1Y C;  2INC C;  3GE3 C;  1T0S C;  3Q3O C;  2IND C;  3Q14 C;  4P1C C;  3N1X C;  3RMK C;  2RDB C;  3I5J C;  3RNF C;  1T0R C;  3RNA C;  3RI7 C;  3Q3M C;  3I63 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...