1T0SC

Structure of the toluene/o-xylene monooxygenase hydroxylase with 4-bromophenol bound
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase from Pseudomonas stutzeri OX1: INSIGHT INTO THE SUBSTRATE SPECIFICITY, SUBSTRATE CHANNELING, AND ACTIVE SITE TUNING OF MULTICOMPONENT MONOOXYGENASES.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Oxidoreductase
molecule keywords toluene, o-xylene monooxygenase oxygenase subunit
total genus 22
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 1t0sC00
3DHHC 3RNAC 3Q3MC 3RNFC 3DHGC 3Q2AC 3I5JC 3N1YC 3N1XC 2INDC 3RNCC 3RNGC 3GE8C 3RMKC 3Q3NC 3Q3OC 2RDBC 2INCC 1T0QC 4P1BC 1T0SC 3GE3C 1T0RC 3DHIC 3RNBC 3RI7C 3I63C 3RN9C 3Q14C 4P1CC 3N20C 3N1ZC 3RNEC
chains in the Genus database with same CATH superfamily
4RGTA 5IP4D 2KQ7A 5DPTA 2KLGA 3NY5A 4A90A 1WYGA 2FCSA 2IYDB 3DBRB 2WXRA 4KKJA 1E8WA 3D32A 3IT4B 1BXTA 1R7SA 1QOFA 4FHJA 5AZFA 4K1RB 4A3PA 2WNMA 2YEPB 4F8CB 5E6OA 4OVVA 5TSSA 2JT4B 2W54A 3QX1A 2OHFA 3IXSA 4DDID 3EA6A 1MI0A 1E8YA 2DNFA 2LGDA 1MJDA 1SJED 4GOCA 4C4VB 4ARIA 1JALA 1SB3C 4HDQA 2O6VD 2KN5A 3AEDB 4II2B 4RM9A 1I4QA 4RCOA 3IAM1 3HM6X 3SFEB 3ZKJC 3I3TB 2N7EA 1L4ZB 1JWAD 3O65B 4BOZB 3AI5A 4IC7B 3CF6E 2PMVA 1I4RA 2INDC 2LGIA 4NNJB 1RM6C 4YSYB 1ET6A 3ECIA 1K8RB 3L16A 1HTOA 3N3KB 4WJOA 3PLUA 3B9JA 1I42A 3NHEB 2M0XA 2BTEA 1QKZA 1FD6A 5JHBA 3QIJA 1AYFA 1N62A 2J0KA 4RFBA 3WANA 1WGHA 2K6QA 2PLPA 2Q5WD 3NG0A 2KACA 4DBGA 1V49A 2BT6A 3KWLA 1VLBA 2JSVX 3QWZB 3GE3C 2JPHA 3PRMB 2TSSA 2K22A 3RFZB 4M8NA 4FLHA 1GJZA 4ZDVA 1TKEA 3K9PB 2O6VA 4ASWC 3DVNU 2M1MA 2KFKA 2RPQA 1H4RA 4XE0A 2OJRA 3UQBA 4FJZA 2L0FA 2N1VA 2KDFB 2RDHA 1JWUD 4L23A 4KIKA 4XDCA 2IO0B 1TY0A 3TL5A 2LHEA 3ONSA 2C7NB 2YLMA 2X8XX 3TJPA 3PT2B 1FNUA 3Q3MC 3W5UB 1I4PA 3ZNHB 3GB1A 3T8MA 3GS2A 3I5JC 1KM7A 3UGBB 2Y5CA 4MH8A 1TZ1A 1WXVA 5D3DA 1DOXA 3ZXRA 3ETRA 5LXIB 4KSLC 3SEBA 2WXHA 1WGDA 1JCKB 4NY0A 4M02A 1GAQB 2PE6B 2KZRA 1XLQA 1A70A 2LASA 1SE9A 5BMHA 3AULA 1N63A 3AH7A 4ZHPA 1FM0D 3KUDB 3DVGY 2QSDA 4WWNA 1LGRA 3N9YC 5HFYA 1VCBA 3OJ3A 1VZ7A 2KTFA 4PS3A 1SJHD 1FEHA 1KH0A 5AZGA 4KDIC 4HEA1 4FADA 2RDBC 1TS5A 2AL3A 2WWZA 1I7HA 1F77A 1D5XC 2ZPNA 4URKA 2JXTA 4RGNA 1F9JA 1WXQA 1UGJA 3OLMD 2PIAA 2KWDA 2QIEB 5J18A 1C3TA 4B0MA 2L76A 2EKEC 1ZDXA 4HKZE 1WSPA 3LXFA 1ZPSA 4DWFA 1WWTA 2K0PA 2KAJA 2NMQA 4O1NA 5BYQA 3ZNID 4W9GA 2LWPA 1AW7A 4BKSD 2LMCA 3PZ7A 2ZVNA 2ZW0A 1P7EA 3VRAB 2E6XA 4B0EA 1E7PB 2KX0A 2MP2B 4WJNA 2JZ3B 1WZ0A 1XCTL 4FBJB 1CMXB 4J3OD 4IW0A 4TUUA 3PS6A 4BFRA 2WDTB 3W1SC 3T3OA 3MC8A 3X23A 1UGMA 1V5OA 4K3BA 2PEAA 1Z2MA 4HDOA 1UBIA 3CSFA 3T9LA 5L83A 1FIQA 1OGWA 2KTRB 1V86A 4MSMB 1YOVB 3KH0A 2KJRA 2WXKA 3SU8X 1TYGB 1WFYA 2NBUA 5LLIA 2MBQA 1F1HA 3A9JA 3P4PB 4GU2A 4KX6B 1EUVB 2KJHB 2N9LA 4AJWA 3R7QA 3JYUA 1TS2A 3Q3NC 4KVGB 1B1ZA 3DVNV 1KLVA 4PS7A 1GPXA 2MSED 4X57B 4L1BA 1L0XB 2MEKA 1CQVA 1HZ5A 2INPE 2V4IB 4HJGE 2C7HA 2KANA 4AOFA 4FA6A 3AE5B 1D4BA 2AX5A 4OZCA 4RGMA 4MEMA 3DBLI 1EWYC 4OHJA 3VR8B 3APCA 4USAA 1DOIA 2D11A 2MBEA 4IUMB 4HPPA 1WJ6A 4WWOA 3UI3A 1EO6A 2IZVB 1YN3A 1VDVA 2O2VB 2K3UA 3H7SA 5IA7A 3KWVA 2M17A 3UIPB 4L2YA 2LRUA 3RZWC 3K9OB 3BWUD 2J0JA 2CHXA 4GLSC 2INNE 2MBOA 1ACCA 4EE2A 4JE3B 3PVLA 4HLEA 1P3QU 2Z59B 1T3QA 2GBRA 1YN4A 1S1QB 2XEWA 1GOZA 3W1YA 1C78A 3M62B 1F0ZA 1DYQA 5FR3A 1PYWD 4WQMA 4LNKA 2JU6X 4BVUC 3AM9A 2I38A 3B0AA 3ZJUA 2IPKD 1HTQA 1UZXB 1SSNA 2M8SA 1OEYJ 2VZKD 3ALBA 1PQSA 4MELA 4NZLB 1ZDVA 3QARA 4N59A 4YTPB 1UF0A 1QLBB 4UDUC 2G45B 5EE1A 4ZRIA 2JXXA 2NR2A 1MFWA 2LZ6A 1WXMA 2OJWA 2Y3AA 1JWBD 3ZJVA 5H8YE 2L1AA 2IY0B 4NJ6A 2MQJA 2KT7A 3NZUA 1P9DU 2ZEQA 2LGXA 4HCNB 3L4PA 1ZGUB 1SF0A 4YWGG 2RGFA 3PLVA 5IAAC 4M0WB 1WF9A 4HK2A 3ZDTA 3OG5A 4DDGD 1P0RA 3I63C 2ACZB 4KZ0A 1C4CA 2BPSA 3W2DA 4XWWA 3W1SA 2MJDA 3OWEB 1ESFA 2IY1B 3S2AA 2KDMA 1BUIC 4BBNC 3RUIB 5MPOA 1ZW7A 1N5WA 3U52E 2L0TA 1WY8A 3BVZA 4RGOS 3IVFA 1I4HA 2VH1A 4BBNF 2RD0A 1TS4A 4A8XC 1B9RA 2L32A 1QOGA 1SXTA 2L00B 2QJLA 3H8HA 4FHKA 1ZKHA 3IHPC 1NI3A 3FAHA 3EC8A 2K25A 1RFAA 2I2YA 4DQOC 2LVQA 1V6EA 4KIKB 3AE9B 3DVGX 2WXLA 4REZA 3DOWA 2AQ3B 5BMIA 5LXHA 2JX5A 1EU3A 2KDBA 2H88B 1FPYA 5I4DA 3N32A 4P16A 1WX7A 1JMLA 2FNJB 1YMHE 3RD2A 1QF6A 4W9CA 4LNFA 3L10B 3R66C 4ZRPA 3VH4B 4II3B 4LNNA 2MP2A 2JYTA 3NVVA 1K52A 1Q0WB 3ML9A 3B08A 2JWUA 4M01A 1EM7A 2XBBC 2FE8A 3HVZA 3H7PA 4G50A 2A4ZA 2FBWB 1SIJA 3MHSD 2JWZA 1KTKA 1NVID 1AN8A 3ZTDA 1IBXB 1WYWB 3A9KA 1D3ZA 1WH3A 2QHOA 2PTLA 2JVCA 3RN9C 1SEBD 1I4XA 4YT0B 3R7RA 2K39A 1ZXIA 4K81A 3Q8BA 3Q8CA 5BYRA 2NCNA 4YL8A 1L0YB 3P63A 3QQ8B 3J9CA 2QDFA 4K7SA 3AE3B 5JZEB 2MBBB 1XO3A 4N9F4 3AE6B 4P1CC 3H9DA 3PV1A 2KX3A 1OEYA 1SIFA 2MH7A 2J7QB 4WWPA 1H8CA 3TEZA 3WA0A 3NVZA 3PRPB 1QT9A 2MLBA 1UH6A 1R4NB 3BYTB 2K9XA 2D07B 2Y5PA 1WM3A 2BYFA 3DHGC 2FIFA 2OEDA 3RULA 4W9LA 2WDVB 2EELA 3FILA 1KJTA 1WMHA 2UYZB 5DCNA 1CJEA 3JW0X 1ROEA 1RYJA 3AU4A 1V97A 4P1BC 1XXGA 2BS3B 2WXGA 4ZRJA 2MA9B 3NJTA 2KTRA 5EE3A 1V80A 4YTNB 3V3XA 3L08A 2CHWA 3V61A 1E9MA 2XNAC 1YX6B 2KFJA 5EE0A 3A9JB 4S0RA 3PGEA 2DHZA 4DHZB 4G0NB 3FILB 3ZQ4A 4HVBA 3EGRA 1E5WA 1ZP0B 3RNBC 4MJSB 1EF5A 3DWMA 1XQQA 4ZHOA 4TQ1A 1E8XA 1LQBA 3KVFB 1WE7A 3TEWA 5D2MB 1WGKA 2GMIC 1XT9B 2WXMA 5E6JA 1SGHA 1FRRA 2L05A 5L95C 1WGYA 4EEWA 5E6PA 2DAJA 5GMVA 2BWES 4ARCA 4ANWA 4AJYB 3VDZA 5CTRC 1EF1A 4BKGA 2B3AA 3VUWA 2H89B 3ZTCA 3P1MA 2ZCBA 2WU2B 4E3CA 3PZ8A 1YQBA 1KLUD 4AUQC 4IM0A 1T0QC 3DBHI 3PZDA 2LD9A 2K5PA 1JRPA 4R3DA 2IBIB 2AWTA 3VH3B 3URYA 3EFCA 1J7AA 2GRIA 3V60A 3PO0A 3KLSX 4BOSC 2WXOA 4YSXB 4US9A 1Q1OA 3C19A 3KUZA 4M0WA 3RMKC 3BINA 3VHTC 3R2TA 2J42A 3KW5B 2G4DB 1E8ZA 3EHVA 2ICIA 3AEEB 4S17A 2BGFA 3OAWA 3L13A 2DX5B 4TKNA 2LXAA 3BY4B 4LNIA 1TZOA 2WXNA 5C23A 5D94A 2WXJA 2G4SA 3PREA 4WWMA 2DZJA 3T3NA 2FAZA 1XLNA 1TBEA 1T0SC 2DBYA 2GI9A 3TEYA 4RM8A 4IM3A 5D7GA 2PW9A 3KYCD 3N20C 4BAXA 4CYEA 4TSSA 3HUIA 3DDCB 2RMMA 2N9KA 2W55A 5T8IA 5H92C 2FCMA 1L2NA 2HD5B 4WQOB 3SDLC 3VQIA 3PHXB 2WDQB 1YJ1A 2MW5A 3EUB2 2KMAA 4OVZA 1V1OA 2SAKA 4EOYA 2KXJA 4IWPA 2XK5A 2N0SB 4BKTA 2LHDA 2NVUI 2LVPA 3Q8FA 2BB5A 2JQRB 1FNVA 3H6NA 4W9KA 4NAMA 4KSKC 1SE4A 2PJHA 1WRIA 1ENFA 2O6VB 3TCAA 4HROA 3LDZE 2KMMA 2BS2B 1JWMD 4XGAB 2M0AA 2RPVA 2GBJA 1R4MB 1LFDA 1HZ6A 2LGSA 2W3RA 5AEKB 1HEZE 1FRDA 2W9NA 2MBHA 1S3SG 3LB8C 2KD0A 1PFDA 2DYBA 4I6LB 3DBLB 4KV2A 1WJNA 3I9V1 4NPNA 1YN5A 2HTHA 4B95A 3QHTA 4CHKA 4GMVA 4DHZE 3N1XC 1C9FA 2CU1A 4FJYA 2NTTA 2D3BA 1N60A 2LUEA 3UQAA 2KOXA 4IM2A 4US8A 1V1PB 1VRAB 2LUMA 2ZNVB 3AEAB 1OTRB 3AXCA 4W9FA 2KFKB 2VRRB 4FN2A 4XDDA 2BYVE 3Q69A 4ZRKA 1OQRA 2IGGA 1K51A 2C7MB 2D5GA 2GLSA 2WX0A 3P42A 1K53A 1TS3A 1KLGD 1PUTA 2V4LA 4WAAA 2KKCA 2ZCCA 3P4QB 3PSEB 3Q3JA 4LTUA 4QAYA 2J0MA 2KQSA 2WDRB 2JYEA 4DHJB 2ON8A 3HM3A 3MJ5A 3VRBB 3O13A 4W9HA 3U4EG 3MP9A 3VAWA 2N7DA 3PHWB 4WAFA 1WX8A 1TKGA 1TT5B 1AARA 1N61A 4ANUA 3M63B 1YD8U 4WURA 4MH0E 4DXGA 1C1YB 2V0GA 3WALA 2N1WA 4LCDE 4TQ0A 1Q5WB 4XZ4A 5HHDG 1NEKB 4LJPB 4G3XB 1JW9D 1UWXA 3EFUA 2W82A 5BMGA 4MT5A 4FULA 4N6EB 3MFGA 4RNAA 2KVRA 1MVKA 1L6UA 2IGHA 2GBNA 3VUXA 3L54A 4HKQA 1C4AA 1LO5D 4OZAA 3CSTA 2J4XA 3ZNZB 1FO4A 1FFVA 2R2QA 1GG3A 3A1QB 3GZNI 1TTNA 2GBKA 2EMTA 2PPHA 1YQ4B 5CHFA 5C1ZA 4JWSC 1NYQA 2KO3A 3EECA 1FNWA 1WR1A 4OW0A 4JX1C 5DPSA 4MACA 4MM3B 4NAWB 1IUEA 4B9KA 3DWGC 3AECB 1KRHA 2NBWB 3DCGA 1PGBA 3AV8A 1ZXHA 1MG8A 3AEFB 4K3CA 2DZIA 1T6BX 1QOBA 1V5TA 1X1MA 3UF8A 4EZJA 3NVWA 2DAFA 1WXSA 3RNAC 4Q2JA 2KJ6A 4NJCA 4GDLA 1P7FA 2Y5BB 3DBRI 1XLPA 2UU7A 3MTNB 2LGYA 2C60A 3HHMA 4RF0A 3VTVA 1ZOYB 1FXAA 1XCQL 4ZYSA 3TUOA 1GC6A 3R3MA 1KOTA 1V8CA 3BVMA 1D5ZC 3FC4A 1E0ZA 4JGHB 1HE8A 5JH5C 3WIMA 2M4NA 1BT0A 2D3CA 3Q6BA 1YJIA 1WMHB 4G11A 2IO3B 3RT3B 2KLCA 3NOBA 1C4PA 2GOWA 2E3TA 2KK8A 3SD5A 3DQVA 2WXIA 2WS3B 2RR9A 3HRDD 3NVYA 4OVUA 4PT5A 1WGGA 2K8HA 3PRZA 4TV3A 5BO4B 3BVGA 3A1QA 5JHAA 1C76A 3NS1A 4ACFA 2NBVB 2NTSA 1QILA 1CK1A 5E6NA 5IN7A 1MHXA 2WXPA 4TMAB 1HXYD 2WP9B 2QMTA 4ZYNA 4EZKA 2V1YA 3V05A 2UWQA 1IGCA 1RLFA 1WGRA 2HDEA 3WAPA 1L6VA 2C5LC 3RYTA 2BYEA 1N5XA 1T5XD 2DLBA 2OOBB 3P2BA 1XF5L 2LEKA 1QOAA 3HK0A 1PDXA 1WJUA 4GDLB 3LYYA 1GUAB 1R4NI 2KC2A 4MGKE 1F2RC 2PE9A 4WJPA 3L17A 1E10A 4DXAB 1GB4A 3W9CB 1YJJA 3GP7A 1WXAA 2WXFA 3I57A 4D2KA 5KHOA 3Q3OC 2KHWB 2KYWA 4H2AA 3RCZA 4F7ZA 4GGQA 2D3AA 2KNBA 3VTUA 1RAXA 1SE2A 4W9EA 3RNEC 1KF6B 3AMZA 1NBFC 3ZVVA 3E56A 2JF5A 5IOIA 1LXDA 3UINB 1IYFA 5AUIA 1WR6E 3GOEA 1DGJA 2K8BA 1FFUA 2RDGA 4KGTA 4NQLB 1NI2A 3WAOA 2REXA 2HJ8A 1E90A 4K7WA 5J2RA 4A9AA 4BKSA 4DHJD 2FUG1 2WXQA 3RNCC 1J19A 4GIVA 3A33B 1C77A 4YXDB 4JIOU 2DWQA 2MJ3A 2WHIA 3H7PB 4HPMB 3ZDMC 1M4VA 4KGRA 2GBMA 3TSSA 3V62A 2NS5A 2M19A 4W9IA 4A6QA 2JUOA 4JL9A 1ZE3D 4DXFA 2LXCA 4AP4C 4GSWA 5FKAC 4N58A 3SR6A 1J8CA 1F52A 3W5VB 4IOIE 2BKFA 4YSZB 3WCQA 2FCNA 3IG3A 4LDTD 2LJIA 1GNUA 2MCNB 2WU5B 1EWCA 1WE6A 2SEBD 4P7IA 1ET9A 2AYOB 3AE8B 1ZUD2 4RF1A 1V9JA 3ENEA 4FJVB 5LNK1 4IG7B 2BS4B 4XWTA 5C3JB 2V3SA 4JPSA 2N4FA 5CHWA 4RH6A 2KDEB 3R2IA 3VFKA 2KWUB 3Q2AC 1NDDA 5G5GA 2MHJA 3ML8A 5D3IB 4C56C 5AZHA 1ISNA 1YNTE 5DPRA 1P1AA 2BQQA 1RRBA 2KQ4X 3QCAA 3FKYA 4LJOB 2KDIA 1WJ4A 2IDYA 4M00A 2QEJC 3KUCB 4W9JA 3ZNGC 3AB5A 4PS8A 2IO2B 3PTFC 4A55A 3ZLZA 5FK9C 2ONQA 2KVZA 3QA8A 5JXVA 1FXTB 5J17A 2ZPYA 3U30A 2QILA 2QCZA 2D10A 4CO7A 2RSUA 3Q14C 2B76B 2I1JA 3AE4B 3MC9A 2ZNVC 4ANXA 1MPEA 3QAQA 3DBSA 1E7UA 1UUPA 1HQRD 2A5UA 2LFIA 2K8CA 2K1FA 3NS8A 5D6JB 2NPTB 2XN9C 5BYSA 1N6ZA 2QC8A 3NRZA 2LRWA 3L0WB 2I1KA 2DENB 2AL6A 3ZIMA 4LK0M 4IWOA 4YTMB 4JLCA 3X0WA 4C4VA 2D3GA 1A5RA 1T0RC 3ZRCA 1G6JA 2CJOA 3B2GA 2WQYB 2GB1A 4ICUA 3A4RA 1PGXA 3JVZX 2MRPA 1OQQA 4PK1A 1FXIA 1L5PA 3N1YC 3GE8C 2IGDA 2N7JA 2C9WB 5CX3A 1VZ6A 4LLGM 1EU4A 2IJ0A 1TGZB 4FXCA 3VTWA 2N9EB 4GDKA 2JRHA 4LNOA 5EE9A 3U7DA 3IAS1 1GB1A 3ZUNA 3IBEA 1C79A 4KKIA 3V6CB 3RNFC 2CKHB 2FUHB 2KMCA 3M95A 4IDIA 3AEBB 4HJKA 3ZO5B 4IWQA 3MHZA 4MJSA 4XX5A 3MJWA 3AE1B 3IT6B 3BYYB 2V3NA 2MJEA 4GN1A 1CZPA 4MGYE 1UNSA 3U2SC 2LVOA 3AEGB 4RMAA 1VZ8A 2PVOD 3KQ4A 1YX5B 4MM3A 2M56B 3ZRFA 3TIXA 3JSVA 1UELA 4GXBA 1WM2A 3MC0B 2KN4A 1HA5A 2LI5A 2JZZA 1Y8RC 2XK5B 3NZ3A 5IKCM 2HTME 2DYOA 1JQ4A 4KZCA 1P98A 2IO1B 5G2NA 4ANVA 2YEPF 1BMLC 2EKIA 2R2OA 4HWIB 5EDSA 3UIOB 3IFWB 1VR9A 2FCQA 4EUTA 1L7YA 3SHQA 1FMAD 3JSVB 3AN1A 2PKOA 4IKGA 3N1ZC 2CS4A 4WJQA 2Z8LA 1SBBB 2BW2A 3M3JA 1Y56A 4B6WA 2W3SA 1IP9A 2YVCA 1Q10A 1YQ3B 2J53A 3OJ4B 1IPGA 3E9SA 3WAMA 1VJKA 1E7VA 2WX1A 3QK0A 2KC1A 5G55A 4E71A 2JZPA 2G1EA 3ZJTA 2ZJDA 4F1SA 1E6EB 2Z0EB 4P6VF 1UBQA 2L83A 1TY2A 2D2QA 2AQ2B 1FCLA 2WLBA 4AWJA 2HJ1A 3AU5A 3BZDB 4AQ7A 4BZAA 4AS1A 5C2TB 3C0RB 1XD3B 3BK2A 3QJZA 1NENB 3DHHC 3KYDD 2AEHA 3TEXA 2N9PC 4EKUA 3ZW3A 4WH4A 4DK5A 4LDTB 4OZBA 1JRUA 2MX2A 2EMSA 5HKHA 2N9XA 3NUHB 4MDKE 5TR5A 2BBCA 3B1LX 1UWMA 4NJ7A 3LJ3A 2HE7A 5G5HA 2L8JA 4HCPB 4WIPA 2ZW1A 3ZXVA 2ZZPB 1FCCC 1J7CA 2CR5A 5KHQA 3RZFA 3ZYYX 4XC2A 3P4SB 3VUYA 2BKRB 4C80A 4CQNA 3ABVB 4ZOHC 3HIZA 4C7ZA 1STEA 5FR6A 3A4SC 3QC8B 3H1UA 4KGSA 4I6NB 1XEEA 3Q8EA 5HG2A 5IO9A 3VR9B 4MGZE 1SE3A 1OQYA 3HVDA 4HXDA 2JY6A 1DOYA 3TMPB 2VZKB 5HI1A 4MSQB 2V3PA 1XLOA 3APFA 2DYMA 1M94A 1TJEA 3SFDB 1NYRA 1TIFA 1V81A 4C00A 1L0VB 1WX9A 1JWSD 4PYZA 2V9HA 2X38A 3AE7B 3AE2B 2J52A 2BWFA 2L3ZA 3N30A 1GC7A 1QZEA 1IBXA 4J6IA 4M8MA 1VD2A 3A9KB 4E74A 3DBHB 1V1PA 1UD7A 2ASQA 4K7UA 2G3QB 2ZVOA 3CMMB 1V2YA 1JROA 2L7RA 1I35A 2NPTA 3DHIC 1LM8B 1F2RI 1PGAA 5DPWA 3V6EB 1MHHE 3DPDA 3BK1A 2L52A 1WIAA 2MWSB 5CHVC 2AQ1B 1Z5SB 2K6DB 1RWSA 1IGDA 3Q8AA 2O2VA 2JRIB 1WI0A 2BB6A 4HPLB 2CU3A 4NAWA 1I4GA 3VVWB 1J0GA 4EFOA 1T0YA 1D5MC 1WRDB 2WYQA 1K50A 2BF8B 1L4DB 1OFFA 4W9DA 1WZ3A 2PVGC 2VH2A 3U8ZA 1D6EC 5AUKA 2INCC 1J7BA 3RPFC 2LJ5A 1TKYA 4JQWC 3VXWA 4ICVA 4PYUA 4JWUC 2DZKA 3TBLD 3C8YA 1QQRA 3U7ZA 3B2FA 1RFKA 1U4AA 2BYTA 4HRSA 4NQKE 3RNGC 3PPAA 2Z0DB 5GXGB 1YIWA 4A3OA 2CHZA 2KWCA 4C7YA 3APDA 3RI7C 2FIDA 3GZNB 1AWDA 3BIID 2WGSA 4I6PA 4A20A 4MGIE 3R8BA 2DZMA 2KWVB 4XYCA 1KFYB 4ITKA 3ZGZA 3Q3FA 2BVCA 3CIRB 3CWIA 4GB9A 4ZRQA 4EZLA 2G9HD 3P4RB 3NZSA 2R61A 1R4MI 4KDLB 1MG4A 2CJNA 4GDKB
chains in the Genus database with same CATH topology
3DHHC 3RNAC 3Q3MC 3RNFC 3DHGC 3Q2AC 3I5JC 3N1YC 3N1XC 2INDC 3RNCC 3RNGC 3GE8C 3RMKC 3Q3NC 3Q3OC 2RDBC 2INCC 1T0QC 4P1BC 1T0SC 3GE3C 1T0RC 3DHIC 3RNBC 3RI7C 3I63C 3RN9C 3Q14C 4P1CC 3N20C 3N1ZC 3RNEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DHH C;  3RNA C;  3Q3M C;  3RNF C;  3DHG C;  3Q2A C;  3I5J C;  3N1Y C;  3N1X C;  2IND C;  3RNC C;  3RNG C;  3GE8 C;  3RMK C;  3Q3N C;  3Q3O C;  2RDB C;  2INC C;  1T0Q C;  4P1B C;  1T0S C;  3GE3 C;  1T0R C;  3DHI C;  3RNB C;  3RI7 C;  3I63 C;  3RN9 C;  3Q14 C;  4P1C C;  3N20 C;  3N1Z C;  3RNE C; 
#chains in the Genus database with same CATH topology
 4RGT A;  5IP4 D;  2KQ7 A;  5DPT A;  2KLG A;  3NY5 A;  4A90 A;  1WYG A;  2FCS A;  2IYD B;  3DBR B;  2WXR A;  4KKJ A;  1E8W A;  3D32 A;  3IT4 B;  1BXT A;  1R7S A;  1QOF A;  4FHJ A;  5AZF A;  4K1R B;  4A3P A;  2WNM A;  2YEP B;  4F8C B;  5E6O A;  4OVV A;  5TSS A;  2JT4 B;  2W54 A;  3QX1 A;  2OHF A;  3IXS A;  4DDI D;  3EA6 A;  1MI0 A;  1E8Y A;  2DNF A;  2LGD A;  1MJD A;  1SJE D;  4GOC A;  4C4V B;  4ARI A;  1JAL A;  1SB3 C;  4HDQ A;  2O6V D;  2KN5 A;  3AED B;  4II2 B;  4RM9 A;  1I4Q A;  4RCO A;  3IAM 1;  3HM6 X;  3SFE B;  3ZKJ C;  3I3T B;  2N7E A;  1L4Z B;  1JWA D;  3O65 B;  4BOZ B;  3AI5 A;  4IC7 B;  3CF6 E;  2PMV A;  1I4R A;  2IND C;  2LGI A;  4NNJ B;  1RM6 C;  4YSY B;  1ET6 A;  3ECI A;  1K8R B;  3L16 A;  1HTO A;  3N3K B;  4WJO A;  3PLU A;  3B9J A;  1I42 A;  3NHE B;  2M0X A;  2BTE A;  1QKZ A;  1FD6 A;  5JHB A;  3QIJ A;  1AYF A;  1N62 A;  2J0K A;  4RFB A;  3WAN A;  1WGH A;  2K6Q A;  2PLP A;  2Q5W D;  3NG0 A;  2KAC A;  4DBG A;  1V49 A;  2BT6 A;  3KWL A;  1VLB A;  2JSV X;  3QWZ B;  3GE3 C;  2JPH A;  3PRM B;  2TSS A;  2K22 A;  3RFZ B;  4M8N A;  4FLH A;  1GJZ A;  4ZDV A;  1TKE A;  3K9P B;  2O6V A;  4ASW C;  3DVN U;  2M1M A;  2KFK A;  2RPQ A;  1H4R A;  4XE0 A;  2OJR A;  3UQB A;  4FJZ A;  2L0F A;  2N1V A;  2KDF B;  2RDH A;  1JWU D;  4L23 A;  4KIK A;  4XDC A;  2IO0 B;  1TY0 A;  3TL5 A;  2LHE A;  3ONS A;  2C7N B;  2YLM A;  2X8X X;  3TJP A;  3PT2 B;  1FNU A;  3Q3M C;  3W5U B;  1I4P A;  3ZNH B;  3GB1 A;  3T8M A;  3GS2 A;  3I5J C;  1KM7 A;  3UGB B;  2Y5C A;  4MH8 A;  1TZ1 A;  1WXV A;  5D3D A;  1DOX A;  3ZXR A;  3ETR A;  5LXI B;  4KSL C;  3SEB A;  2WXH A;  1WGD A;  1JCK B;  4NY0 A;  4M02 A;  1GAQ B;  2PE6 B;  2KZR A;  1XLQ A;  1A70 A;  2LAS A;  1SE9 A;  5BMH A;  3AUL A;  1N63 A;  3AH7 A;  4ZHP A;  1FM0 D;  3KUD B;  3DVG Y;  2QSD A;  4WWN A;  1LGR A;  3N9Y C;  5HFY A;  1VCB A;  3OJ3 A;  1VZ7 A;  2KTF A;  4PS3 A;  1SJH D;  1FEH A;  1KH0 A;  5AZG A;  4KDI C;  4HEA 1;  4FAD A;  2RDB C;  1TS5 A;  2AL3 A;  2WWZ A;  1I7H A;  1F77 A;  1D5X C;  2ZPN A;  4URK A;  2JXT A;  4RGN A;  1F9J A;  1WXQ A;  1UGJ A;  3OLM D;  2PIA A;  2KWD A;  2QIE B;  5J18 A;  1C3T A;  4B0M A;  2L76 A;  2EKE C;  1ZDX A;  4HKZ E;  1WSP A;  3LXF A;  1ZPS A;  4DWF A;  1WWT A;  2K0P A;  2KAJ A;  2NMQ A;  4O1N A;  5BYQ A;  3ZNI D;  4W9G A;  2LWP A;  1AW7 A;  4BKS D;  2LMC A;  3PZ7 A;  2ZVN A;  2ZW0 A;  1P7E A;  3VRA B;  2E6X A;  4B0E A;  1E7P B;  2KX0 A;  2MP2 B;  4WJN A;  2JZ3 B;  1WZ0 A;  1XCT L;  4FBJ B;  1CMX B;  4J3O D;  4IW0 A;  4TUU A;  3PS6 A;  4BFR A;  2WDT B;  3W1S C;  3T3O A;  3MC8 A;  3X23 A;  1UGM A;  1V5O A;  4K3B A;  2PEA A;  1Z2M A;  4HDO A;  1UBI A;  3CSF A;  3T9L A;  5L83 A;  1FIQ A;  1OGW A;  2KTR B;  1V86 A;  4MSM B;  1YOV B;  3KH0 A;  2KJR A;  2WXK A;  3SU8 X;  1TYG B;  1WFY A;  2NBU A;  5LLI A;  2MBQ A;  1F1H A;  3A9J A;  3P4P B;  4GU2 A;  4KX6 B;  1EUV B;  2KJH B;  2N9L A;  4AJW A;  3R7Q A;  3JYU A;  1TS2 A;  3Q3N C;  4KVG B;  1B1Z A;  3DVN V;  1KLV A;  4PS7 A;  1GPX A;  2MSE D;  4X57 B;  4L1B A;  1L0X B;  2MEK A;  1CQV A;  1HZ5 A;  2INP E;  2V4I B;  4HJG E;  2C7H A;  2KAN A;  4AOF A;  4FA6 A;  3AE5 B;  1D4B A;  2AX5 A;  4OZC A;  4RGM A;  4MEM A;  3DBL I;  1EWY C;  4OHJ A;  3VR8 B;  3APC A;  4USA A;  1DOI A;  2D11 A;  2MBE A;  4IUM B;  4HPP A;  1WJ6 A;  4WWO A;  3UI3 A;  1EO6 A;  2IZV B;  1YN3 A;  1VDV A;  2O2V B;  2K3U A;  3H7S A;  5IA7 A;  3KWV A;  2M17 A;  3UIP B;  4L2Y A;  2LRU A;  3RZW C;  3K9O B;  3BWU D;  2J0J A;  2CHX A;  4GLS C;  2INN E;  2MBO A;  1ACC A;  4EE2 A;  4JE3 B;  3PVL A;  4HLE A;  1P3Q U;  2Z59 B;  1T3Q A;  2GBR A;  1YN4 A;  1S1Q B;  2XEW A;  1GOZ A;  3W1Y A;  1C78 A;  3M62 B;  1F0Z A;  1DYQ A;  5FR3 A;  1PYW D;  4WQM A;  4LNK A;  2JU6 X;  4BVU C;  3AM9 A;  2I38 A;  3B0A A;  3ZJU A;  2IPK D;  1HTQ A;  1UZX B;  1SSN A;  2M8S A;  1OEY J;  2VZK D;  3ALB A;  1PQS A;  4MEL A;  4NZL B;  1ZDV A;  3QAR A;  4N59 A;  4YTP B;  1UF0 A;  1QLB B;  4UDU C;  2G45 B;  5EE1 A;  4ZRI A;  2JXX A;  2NR2 A;  1MFW A;  2LZ6 A;  1WXM A;  2OJW A;  2Y3A A;  1JWB D;  3ZJV A;  5H8Y E;  2L1A A;  2IY0 B;  4NJ6 A;  2MQJ A;  2KT7 A;  3NZU A;  1P9D U;  2ZEQ A;  2LGX A;  4HCN B;  3L4P A;  1ZGU B;  1SF0 A;  4YWG G;  2RGF A;  3PLV A;  5IAA C;  4M0W B;  1WF9 A;  4HK2 A;  3ZDT A;  3OG5 A;  4DDG D;  1P0R A;  3I63 C;  2ACZ B;  4KZ0 A;  1C4C A;  2BPS A;  3W2D A;  4XWW A;  3W1S A;  2MJD A;  3OWE B;  1ESF A;  2IY1 B;  3S2A A;  2KDM A;  1BUI C;  4BBN C;  3RUI B;  5MPO A;  1ZW7 A;  1N5W A;  3U52 E;  2L0T A;  1WY8 A;  3BVZ A;  4RGO S;  3IVF A;  1I4H A;  2VH1 A;  4BBN F;  2RD0 A;  1TS4 A;  4A8X C;  1B9R A;  2L32 A;  1QOG A;  1SXT A;  2L00 B;  2QJL A;  3H8H A;  4FHK A;  1ZKH A;  3IHP C;  1NI3 A;  3FAH A;  3EC8 A;  2K25 A;  1RFA A;  2I2Y A;  4DQO C;  2LVQ A;  1V6E A;  4KIK B;  3AE9 B;  3DVG X;  2WXL A;  4REZ A;  3DOW A;  2AQ3 B;  5BMI A;  5LXH A;  2JX5 A;  1EU3 A;  2KDB A;  2H88 B;  1FPY A;  5I4D A;  3N32 A;  4P16 A;  1WX7 A;  1JML A;  2FNJ B;  1YMH E;  3RD2 A;  1QF6 A;  4W9C A;  4LNF A;  3L10 B;  3R66 C;  4ZRP A;  3VH4 B;  4II3 B;  4LNN A;  2MP2 A;  2JYT A;  3NVV A;  1K52 A;  1Q0W B;  3ML9 A;  3B08 A;  2JWU A;  4M01 A;  1EM7 A;  2XBB C;  2FE8 A;  3HVZ A;  3H7P A;  4G50 A;  2A4Z A;  2FBW B;  1SIJ A;  3MHS D;  2JWZ A;  1KTK A;  1NVI D;  1AN8 A;  3ZTD A;  1IBX B;  1WYW B;  3A9K A;  1D3Z A;  1WH3 A;  2QHO A;  2PTL A;  2JVC A;  3RN9 C;  1SEB D;  1I4X A;  4YT0 B;  3R7R A;  2K39 A;  1ZXI A;  4K81 A;  3Q8B A;  3Q8C A;  5BYR A;  2NCN A;  4YL8 A;  1L0Y B;  3P63 A;  3QQ8 B;  3J9C A;  2QDF A;  4K7S A;  3AE3 B;  5JZE B;  2MBB B;  1XO3 A;  4N9F 4;  3AE6 B;  4P1C C;  3H9D A;  3PV1 A;  2KX3 A;  1OEY A;  1SIF A;  2MH7 A;  2J7Q B;  4WWP A;  1H8C A;  3TEZ A;  3WA0 A;  3NVZ A;  3PRP B;  1QT9 A;  2MLB A;  1UH6 A;  1R4N B;  3BYT B;  2K9X A;  2D07 B;  2Y5P A;  1WM3 A;  2BYF A;  3DHG C;  2FIF A;  2OED A;  3RUL A;  4W9L A;  2WDV B;  2EEL A;  3FIL A;  1KJT A;  1WMH A;  2UYZ B;  5DCN A;  1CJE A;  3JW0 X;  1ROE A;  1RYJ A;  3AU4 A;  1V97 A;  4P1B C;  1XXG A;  2BS3 B;  2WXG A;  4ZRJ A;  2MA9 B;  3NJT A;  2KTR A;  5EE3 A;  1V80 A;  4YTN B;  3V3X A;  3L08 A;  2CHW A;  3V61 A;  1E9M A;  2XNA C;  1YX6 B;  2KFJ A;  5EE0 A;  3A9J B;  4S0R A;  3PGE A;  2DHZ A;  4DHZ B;  4G0N B;  3FIL B;  3ZQ4 A;  4HVB A;  3EGR A;  1E5W A;  1ZP0 B;  3RNB C;  4MJS B;  1EF5 A;  3DWM A;  1XQQ A;  4ZHO A;  4TQ1 A;  1E8X A;  1LQB A;  3KVF B;  1WE7 A;  3TEW A;  5D2M B;  1WGK A;  2GMI C;  1XT9 B;  2WXM A;  5E6J A;  1SGH A;  1FRR A;  2L05 A;  5L95 C;  1WGY A;  4EEW A;  5E6P A;  2DAJ A;  5GMV A;  2BWE S;  4ARC A;  4ANW A;  4AJY B;  3VDZ A;  5CTR C;  1EF1 A;  4BKG A;  2B3A A;  3VUW A;  2H89 B;  3ZTC A;  3P1M A;  2ZCB A;  2WU2 B;  4E3C A;  3PZ8 A;  1YQB A;  1KLU D;  4AUQ C;  4IM0 A;  1T0Q C;  3DBH I;  3PZD A;  2LD9 A;  2K5P A;  1JRP A;  4R3D A;  2IBI B;  2AWT A;  3VH3 B;  3URY A;  3EFC A;  1J7A A;  2GRI A;  3V60 A;  3PO0 A;  3KLS X;  4BOS C;  2WXO A;  4YSX B;  4US9 A;  1Q1O A;  3C19 A;  3KUZ A;  4M0W A;  3RMK C;  3BIN A;  3VHT C;  3R2T A;  2J42 A;  3KW5 B;  2G4D B;  1E8Z A;  3EHV A;  2ICI A;  3AEE B;  4S17 A;  2BGF A;  3OAW A;  3L13 A;  2DX5 B;  4TKN A;  2LXA A;  3BY4 B;  4LNI A;  1TZO A;  2WXN A;  5C23 A;  5D94 A;  2WXJ A;  2G4S A;  3PRE A;  4WWM A;  2DZJ A;  3T3N A;  2FAZ A;  1XLN A;  1TBE A;  1T0S C;  2DBY A;  2GI9 A;  3TEY A;  4RM8 A;  4IM3 A;  5D7G A;  2PW9 A;  3KYC D;  3N20 C;  4BAX A;  4CYE A;  4TSS A;  3HUI A;  3DDC B;  2RMM A;  2N9K A;  2W55 A;  5T8I A;  5H92 C;  2FCM A;  1L2N A;  2HD5 B;  4WQO B;  3SDL C;  3VQI A;  3PHX B;  2WDQ B;  1YJ1 A;  2MW5 A;  3EUB 2;  2KMA A;  4OVZ A;  1V1O A;  2SAK A;  4EOY A;  2KXJ A;  4IWP A;  2XK5 A;  2N0S B;  4BKT A;  2LHD A;  2NVU I;  2LVP A;  3Q8F A;  2BB5 A;  2JQR B;  1FNV A;  3H6N A;  4W9K A;  4NAM A;  4KSK C;  1SE4 A;  2PJH A;  1WRI A;  1ENF A;  2O6V B;  3TCA A;  4HRO A;  3LDZ E;  2KMM A;  2BS2 B;  1JWM D;  4XGA B;  2M0A A;  2RPV A;  2GBJ A;  1R4M B;  1LFD A;  1HZ6 A;  2LGS A;  2W3R A;  5AEK B;  1HEZ E;  1FRD A;  2W9N A;  2MBH A;  1S3S G;  3LB8 C;  2KD0 A;  1PFD A;  2DYB A;  4I6L B;  3DBL B;  4KV2 A;  1WJN A;  3I9V 1;  4NPN A;  1YN5 A;  2HTH A;  4B95 A;  3QHT A;  4CHK A;  4GMV A;  4DHZ E;  3N1X C;  1C9F A;  2CU1 A;  4FJY A;  2NTT A;  2D3B A;  1N60 A;  2LUE A;  3UQA A;  2KOX A;  4IM2 A;  4US8 A;  1V1P B;  1VRA B;  2LUM A;  2ZNV B;  3AEA B;  1OTR B;  3AXC A;  4W9F A;  2KFK B;  2VRR B;  4FN2 A;  4XDD A;  2BYV E;  3Q69 A;  4ZRK A;  1OQR A;  2IGG A;  1K51 A;  2C7M B;  2D5G A;  2GLS A;  2WX0 A;  3P42 A;  1K53 A;  1TS3 A;  1KLG D;  1PUT A;  2V4L A;  4WAA A;  2KKC A;  2ZCC A;  3P4Q B;  3PSE B;  3Q3J A;  4LTU A;  4QAY A;  2J0M A;  2KQS A;  2WDR B;  2JYE A;  4DHJ B;  2ON8 A;  3HM3 A;  3MJ5 A;  3VRB B;  3O13 A;  4W9H A;  3U4E G;  3MP9 A;  3VAW A;  2N7D A;  3PHW B;  4WAF A;  1WX8 A;  1TKG A;  1TT5 B;  1AAR A;  1N61 A;  4ANU A;  3M63 B;  1YD8 U;  4WUR A;  4MH0 E;  4DXG A;  1C1Y B;  2V0G A;  3WAL A;  2N1W A;  4LCD E;  4TQ0 A;  1Q5W B;  4XZ4 A;  5HHD G;  1NEK B;  4LJP B;  4G3X B;  1JW9 D;  1UWX A;  3EFU A;  2W82 A;  5BMG A;  4MT5 A;  4FUL A;  4N6E B;  3MFG A;  4RNA A;  2KVR A;  1MVK A;  1L6U A;  2IGH A;  2GBN A;  3VUX A;  3L54 A;  4HKQ A;  1C4A A;  1LO5 D;  4OZA A;  3CST A;  2J4X A;  3ZNZ B;  1FO4 A;  1FFV A;  2R2Q A;  1GG3 A;  3A1Q B;  3GZN I;  1TTN A;  2GBK A;  2EMT A;  2PPH A;  1YQ4 B;  5CHF A;  5C1Z A;  4JWS C;  1NYQ A;  2KO3 A;  3EEC A;  1FNW A;  1WR1 A;  4OW0 A;  4JX1 C;  5DPS A;  4MAC A;  4MM3 B;  4NAW B;  1IUE A;  4B9K A;  3DWG C;  3AEC B;  1KRH A;  2NBW B;  3DCG A;  1PGB A;  3AV8 A;  1ZXH A;  1MG8 A;  3AEF B;  4K3C A;  2DZI A;  1T6B X;  1QOB A;  1V5T A;  1X1M A;  3UF8 A;  4EZJ A;  3NVW A;  2DAF A;  1WXS A;  3RNA C;  4Q2J A;  2KJ6 A;  4NJC A;  4GDL A;  1P7F A;  2Y5B B;  3DBR I;  1XLP A;  2UU7 A;  3MTN B;  2LGY A;  2C60 A;  3HHM A;  4RF0 A;  3VTV A;  1ZOY B;  1FXA A;  1XCQ L;  4ZYS A;  3TUO A;  1GC6 A;  3R3M A;  1KOT A;  1V8C A;  3BVM A;  1D5Z C;  3FC4 A;  1E0Z A;  4JGH B;  1HE8 A;  5JH5 C;  3WIM A;  2M4N A;  1BT0 A;  2D3C A;  3Q6B A;  1YJI A;  1WMH B;  4G11 A;  2IO3 B;  3RT3 B;  2KLC A;  3NOB A;  1C4P A;  2GOW A;  2E3T A;  2KK8 A;  3SD5 A;  3DQV A;  2WXI A;  2WS3 B;  2RR9 A;  3HRD D;  3NVY A;  4OVU A;  4PT5 A;  1WGG A;  2K8H A;  3PRZ A;  4TV3 A;  5BO4 B;  3BVG A;  3A1Q A;  5JHA A;  1C76 A;  3NS1 A;  4ACF A;  2NBV B;  2NTS A;  1QIL A;  1CK1 A;  5E6N A;  5IN7 A;  1MHX A;  2WXP A;  4TMA B;  1HXY D;  2WP9 B;  2QMT A;  4ZYN A;  4EZK A;  2V1Y A;  3V05 A;  2UWQ A;  1IGC A;  1RLF A;  1WGR A;  2HDE A;  3WAP A;  1L6V A;  2C5L C;  3RYT A;  2BYE A;  1N5X A;  1T5X D;  2DLB A;  2OOB B;  3P2B A;  1XF5 L;  2LEK A;  1QOA A;  3HK0 A;  1PDX A;  1WJU A;  4GDL B;  3LYY A;  1GUA B;  1R4N I;  2KC2 A;  4MGK E;  1F2R C;  2PE9 A;  4WJP A;  3L17 A;  1E10 A;  4DXA B;  1GB4 A;  3W9C B;  1YJJ A;  3GP7 A;  1WXA A;  2WXF A;  3I57 A;  4D2K A;  5KHO A;  3Q3O C;  2KHW B;  2KYW A;  4H2A A;  3RCZ A;  4F7Z A;  4GGQ A;  2D3A A;  2KNB A;  3VTU A;  1RAX A;  1SE2 A;  4W9E A;  3RNE C;  1KF6 B;  3AMZ A;  1NBF C;  3ZVV A;  3E56 A;  2JF5 A;  5IOI A;  1LXD A;  3UIN B;  1IYF A;  5AUI A;  1WR6 E;  3GOE A;  1DGJ A;  2K8B A;  1FFU A;  2RDG A;  4KGT A;  4NQL B;  1NI2 A;  3WAO A;  2REX A;  2HJ8 A;  1E90 A;  4K7W A;  5J2R A;  4A9A A;  4BKS A;  4DHJ D;  2FUG 1;  2WXQ A;  3RNC C;  1J19 A;  4GIV A;  3A33 B;  1C77 A;  4YXD B;  4JIO U;  2DWQ A;  2MJ3 A;  2WHI A;  3H7P B;  4HPM B;  3ZDM C;  1M4V A;  4KGR A;  2GBM A;  3TSS A;  3V62 A;  2NS5 A;  2M19 A;  4W9I A;  4A6Q A;  2JUO A;  4JL9 A;  1ZE3 D;  4DXF A;  2LXC A;  4AP4 C;  4GSW A;  5FKA C;  4N58 A;  3SR6 A;  1J8C A;  1F52 A;  3W5V B;  4IOI E;  2BKF A;  4YSZ B;  3WCQ A;  2FCN A;  3IG3 A;  4LDT D;  2LJI A;  1GNU A;  2MCN B;  2WU5 B;  1EWC A;  1WE6 A;  2SEB D;  4P7I A;  1ET9 A;  2AYO B;  3AE8 B;  1ZUD 2;  4RF1 A;  1V9J A;  3ENE A;  4FJV B;  5LNK 1;  4IG7 B;  2BS4 B;  4XWT A;  5C3J B;  2V3S A;  4JPS A;  2N4F A;  5CHW A;  4RH6 A;  2KDE B;  3R2I A;  3VFK A;  2KWU B;  3Q2A C;  1NDD A;  5G5G A;  2MHJ A;  3ML8 A;  5D3I B;  4C56 C;  5AZH A;  1ISN A;  1YNT E;  5DPR A;  1P1A A;  2BQQ A;  1RRB A;  2KQ4 X;  3QCA A;  3FKY A;  4LJO B;  2KDI A;  1WJ4 A;  2IDY A;  4M00 A;  2QEJ C;  3KUC B;  4W9J A;  3ZNG C;  3AB5 A;  4PS8 A;  2IO2 B;  3PTF C;  4A55 A;  3ZLZ A;  5FK9 C;  2ONQ A;  2KVZ A;  3QA8 A;  5JXV A;  1FXT B;  5J17 A;  2ZPY A;  3U30 A;  2QIL A;  2QCZ A;  2D10 A;  4CO7 A;  2RSU A;  3Q14 C;  2B76 B;  2I1J A;  3AE4 B;  3MC9 A;  2ZNV C;  4ANX A;  1MPE A;  3QAQ A;  3DBS A;  1E7U A;  1UUP A;  1HQR D;  2A5U A;  2LFI A;  2K8C A;  2K1F A;  3NS8 A;  5D6J B;  2NPT B;  2XN9 C;  5BYS A;  1N6Z A;  2QC8 A;  3NRZ A;  2LRW A;  3L0W B;  2I1K A;  2DEN B;  2AL6 A;  3ZIM A;  4LK0 M;  4IWO A;  4YTM B;  4JLC A;  3X0W A;  4C4V A;  2D3G A;  1A5R A;  1T0R C;  3ZRC A;  1G6J A;  2CJO A;  3B2G A;  2WQY B;  2GB1 A;  4ICU A;  3A4R A;  1PGX A;  3JVZ X;  2MRP A;  1OQQ A;  4PK1 A;  1FXI A;  1L5P A;  3N1Y C;  3GE8 C;  2IGD A;  2N7J A;  2C9W B;  5CX3 A;  1VZ6 A;  4LLG M;  1EU4 A;  2IJ0 A;  1TGZ B;  4FXC A;  3VTW A;  2N9E B;  4GDK A;  2JRH A;  4LNO A;  5EE9 A;  3U7D A;  3IAS 1;  1GB1 A;  3ZUN A;  3IBE A;  1C79 A;  4KKI A;  3V6C B;  3RNF C;  2CKH B;  2FUH B;  2KMC A;  3M95 A;  4IDI A;  3AEB B;  4HJK A;  3ZO5 B;  4IWQ A;  3MHZ A;  4MJS A;  4XX5 A;  3MJW A;  3AE1 B;  3IT6 B;  3BYY B;  2V3N A;  2MJE A;  4GN1 A;  1CZP A;  4MGY E;  1UNS A;  3U2S C;  2LVO A;  3AEG B;  4RMA A;  1VZ8 A;  2PVO D;  3KQ4 A;  1YX5 B;  4MM3 A;  2M56 B;  3ZRF A;  3TIX A;  3JSV A;  1UEL A;  4GXB A;  1WM2 A;  3MC0 B;  2KN4 A;  1HA5 A;  2LI5 A;  2JZZ A;  1Y8R C;  2XK5 B;  3NZ3 A;  5IKC M;  2HTM E;  2DYO A;  1JQ4 A;  4KZC A;  1P98 A;  2IO1 B;  5G2N A;  4ANV A;  2YEP F;  1BML C;  2EKI A;  2R2O A;  4HWI B;  5EDS A;  3UIO B;  3IFW B;  1VR9 A;  2FCQ A;  4EUT A;  1L7Y A;  3SHQ A;  1FMA D;  3JSV B;  3AN1 A;  2PKO A;  4IKG A;  3N1Z C;  2CS4 A;  4WJQ A;  2Z8L A;  1SBB B;  2BW2 A;  3M3J A;  1Y56 A;  4B6W A;  2W3S A;  1IP9 A;  2YVC A;  1Q10 A;  1YQ3 B;  2J53 A;  3OJ4 B;  1IPG A;  3E9S A;  3WAM A;  1VJK A;  1E7V A;  2WX1 A;  3QK0 A;  2KC1 A;  5G55 A;  4E71 A;  2JZP A;  2G1E A;  3ZJT A;  2ZJD A;  4F1S A;  1E6E B;  2Z0E B;  4P6V F;  1UBQ A;  2L83 A;  1TY2 A;  2D2Q A;  2AQ2 B;  1FCL A;  2WLB A;  4AWJ A;  2HJ1 A;  3AU5 A;  3BZD B;  4AQ7 A;  4BZA A;  4AS1 A;  5C2T B;  3C0R B;  1XD3 B;  3BK2 A;  3QJZ A;  1NEN B;  3DHH C;  3KYD D;  2AEH A;  3TEX A;  2N9P C;  4EKU A;  3ZW3 A;  4WH4 A;  4DK5 A;  4LDT B;  4OZB A;  1JRU A;  2MX2 A;  2EMS A;  5HKH A;  2N9X A;  3NUH B;  4MDK E;  5TR5 A;  2BBC A;  3B1L X;  1UWM A;  4NJ7 A;  3LJ3 A;  2HE7 A;  5G5H A;  2L8J A;  4HCP B;  4WIP A;  2ZW1 A;  3ZXV A;  2ZZP B;  1FCC C;  1J7C A;  2CR5 A;  5KHQ A;  3RZF A;  3ZYY X;  4XC2 A;  3P4S B;  3VUY A;  2BKR B;  4C80 A;  4CQN A;  3ABV B;  4ZOH C;  3HIZ A;  4C7Z A;  1STE A;  5FR6 A;  3A4S C;  3QC8 B;  3H1U A;  4KGS A;  4I6N B;  1XEE A;  3Q8E A;  5HG2 A;  5IO9 A;  3VR9 B;  4MGZ E;  1SE3 A;  1OQY A;  3HVD A;  4HXD A;  2JY6 A;  1DOY A;  3TMP B;  2VZK B;  5HI1 A;  4MSQ B;  2V3P A;  1XLO A;  3APF A;  2DYM A;  1M94 A;  1TJE A;  3SFD B;  1NYR A;  1TIF A;  1V81 A;  4C00 A;  1L0V B;  1WX9 A;  1JWS D;  4PYZ A;  2V9H A;  2X38 A;  3AE7 B;  3AE2 B;  2J52 A;  2BWF A;  2L3Z A;  3N30 A;  1GC7 A;  1QZE A;  1IBX A;  4J6I A;  4M8M A;  1VD2 A;  3A9K B;  4E74 A;  3DBH B;  1V1P A;  1UD7 A;  2ASQ A;  4K7U A;  2G3Q B;  2ZVO A;  3CMM B;  1V2Y A;  1JRO A;  2L7R A;  1I35 A;  2NPT A;  3DHI C;  1LM8 B;  1F2R I;  1PGA A;  5DPW A;  3V6E B;  1MHH E;  3DPD A;  3BK1 A;  2L52 A;  1WIA A;  2MWS B;  5CHV C;  2AQ1 B;  1Z5S B;  2K6D B;  1RWS A;  1IGD A;  3Q8A A;  2O2V A;  2JRI B;  1WI0 A;  2BB6 A;  4HPL B;  2CU3 A;  4NAW A;  1I4G A;  3VVW B;  1J0G A;  4EFO A;  1T0Y A;  1D5M C;  1WRD B;  2WYQ A;  1K50 A;  2BF8 B;  1L4D B;  1OFF A;  4W9D A;  1WZ3 A;  2PVG C;  2VH2 A;  3U8Z A;  1D6E C;  5AUK A;  2INC C;  1J7B A;  3RPF C;  2LJ5 A;  1TKY A;  4JQW C;  3VXW A;  4ICV A;  4PYU A;  4JWU C;  2DZK A;  3TBL D;  3C8Y A;  1QQR A;  3U7Z A;  3B2F A;  1RFK A;  1U4A A;  2BYT A;  4HRS A;  4NQK E;  3RNG C;  3PPA A;  2Z0D B;  5GXG B;  1YIW A;  4A3O A;  2CHZ A;  2KWC A;  4C7Y A;  3APD A;  3RI7 C;  2FID A;  3GZN B;  1AWD A;  3BII D;  2WGS A;  4I6P A;  4A20 A;  4MGI E;  3R8B A;  2DZM A;  2KWV B;  4XYC A;  1KFY B;  4ITK A;  3ZGZ A;  3Q3F A;  2BVC A;  3CIR B;  3CWI A;  4GB9 A;  4ZRQ A;  4EZL A;  2G9H D;  3P4R B;  3NZS A;  2R61 A;  1R4M I;  4KDL B;  1MG4 A;  2CJN A;  4GDK B; 
#chains in the Genus database with same CATH homology
 3DHH C;  3RNA C;  3Q3M C;  3RNF C;  3DHG C;  3Q2A C;  3I5J C;  3N1Y C;  3N1X C;  2IND C;  3RNC C;  3RNG C;  3GE8 C;  3RMK C;  3Q3N C;  3Q3O C;  2RDB C;  2INC C;  1T0Q C;  4P1B C;  1T0S C;  3GE3 C;  1T0R C;  3DHI C;  3RNB C;  3RI7 C;  3I63 C;  3RN9 C;  3Q14 C;  4P1C C;  3N20 C;  3N1Z C;  3RNE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...