1T16A

Crystal structure of the bacterial fatty acid transporter fadl from escherichia coli
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
427
structure length
427
Chain Sequence
AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAFHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the long-chain fatty acid transporter FadL.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid transport
molecule keywords Long-chain fatty acid transport protein
total genus 110
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 1t16A00
2R4OA 3BS0A 2R4PA 3PGUA 3BRYA 3BRZA 2R88A 2R89A 2R4NA 1T1LA 1T16A 2R4LA 3PGSA 3DWNA 2R8AA 3PGRA 3DWOX 3PF1A
chains in the Genus database with same CATH superfamily
3AA0A 3LK3B 4G75A 5TISO 3T24A 2F1VA 2KXPA 5GV0A 3PGSA 1S5LO 1T16A 2JMMA 2R4LA 1E54A 4PR7A 2QTKA 5KAFO 4B61A 3AAEB 3DZMA 4K3CA 4FSOA 5B5EO 3BS0A 1BXWA 4AKRA 4AUIA 3EMNX 4D64A 3T20A 2KDYA 3AA1B 4IL6O 5E79O 5H2FO 3VZTX 4F4BA 2LFUA 4O3XB 3HOEA 4LSIA 5T5FA 1H6S1 4XNKA 4GCPA 3AAAA 4AFKA 3PQSA 1ZHYA 4FT6A 4N58A 5G39A 3HW9A 4FZMA 2R88A 2XTRA 4XNLA 4AKMA 3K19A 4FSPA 4U9CA 5DL6A 2XE1A 3SY7A 8PRNA 3DA4A 4C00A 2JQYA 1BT9A 2FGRA 4AZLA 1OPFA 4GCSA 5GTIO 3UPGA 1ZHTA 4N75A 5IYUA 2F1TA 3SYBA 1G90A 2KC0A 2XMXA 4C4VB 4RLCA 3PRNA 4BUMX 2K0LA 1QJ8A 3PF1A 4FMSA 7PRNA 3GP6A 1QJ9A 2J1NA 2MHLA 2XE2A 3LK2B 3UAQA 3UU2A 3VE1A 2J4UP 4O4XA 5DL7A 3POXA 3POQA 2AXTO 4GCQA 2KZ7A 3G7GA 3PQUA 4LSFA 3A2SX 3NSGA 2OMFA 4KR8A 4Z3TA 2IWWA 2K4TA 2WVPA 1T1LA 5ADXL 3AA1A 3DWNA 2GE4A 2WJQA 4N59A 3WU2O 4AYNA 4D65A 4FRXA 4RJWA 5GTHO 2XE5A 5EE2A 1IZNA 2Y2XA 3AAAB 5DL5A 1ZHZA 4FQEA 4AYDC 1GFNA 4AYEC 5DL8A 2ERVA 3V8UA 5AFUL 4RJXA 3WI5A 4K3BA 4JFBA 3LK42 3KZIO 1HXTA 2M06A 2MNHA 2W80C 4C69X 4LSEA 1P4TA 2F1CX 3QRCA 3AA7B 3SY9A 2N2MA 2Y0KA 3BRYA 3HOLA 1PRNA 1MM4A 4O3WA 1Q9GA 4E1SA 1MM5A 2YNKA 6PRNA 4C4VA 3VE2A 2R8AA 3PORA 3C5OA 1GFOA 1PHOA 2FGQX 3LK2A 3AA6B 4AYMC 3A0HO 3O0EA 4FOZA 2IWVA 2N2LA 2WJRA 5D5DA 1BH3A 1HXXA 2ZLDA 3T0SA 1GFPA 4FESA 2KZ7B 3NJTA 3PGRA 4UB8O 4N74A 3AA0B 3LK3A 4PJ0O 3PGUA 2KXPB 3VY9X 2Y7SA 2R89A 2R4NA 5AFUK 3JCUO 3DA3A 4JCHA 3RBHA 4GF4A 4PUXA 1ZHWA 5KAIO 4QQ1A 5JDPA 3AAEA 2M07A 2ZFGA 2XTQA 3HWBA 2R4PA 2PORA 4FUVA 1IZNB 4FZLA 1GFMA 1YS5A 4AKRB 2XE3A 2PRNA 1HXUA 5G3AA 3BRZA 3SZDA 3VZWX 4KRAA 4O3YA 2LHFA 3A0BO 4O3ZA 5ADXK 4CTDA 2X27X 1Q9FA 3QRAA 2O4VA 1THQA 4G76A 1ZHXA 4LSHA 3LK41 5FVNA 3SZVA 3VY8X 3POUA 1GFQA 4E1TA 2R4OA 2X9KA 1MPFA 3AA7A 4AYID 2YPVA 5B66O 4FRTA 3KVDD 2ODJA 4UB6O 2Y0HA 4FZNA 2W81C 3SYSA 4RLBA 3VZUX 4O4UA 3AA6A 4KR4A 5G26A 4D5UA 1QJPA 2XG6A 5PRNA 3TZGA 3WI4A 2Y0LA 1ORMA 4GHBA 3JTYA 4O49A 3FYXA 1OSMA 4RL9A 5G38A 3DWOX
chains in the Genus database with same CATH topology
2R4OA 3BS0A 2R4PA 3PGUA 3BRYA 3BRZA 2R88A 2R89A 2R4NA 1T1LA 1T16A 2R4LA 3PGSA 3DWNA 2R8AA 3PGRA 3DWOX 3PF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4O A;  3BS0 A;  2R4P A;  3PGU A;  3BRY A;  3BRZ A;  2R88 A;  2R89 A;  2R4N A;  1T1L A;  1T16 A;  2R4L A;  3PGS A;  3DWN A;  2R8A A;  3PGR A;  3DWO X;  3PF1 A; 
#chains in the Genus database with same CATH topology
 3AA0 A;  3LK3 B;  4G75 A;  5TIS O;  3T24 A;  2F1V A;  2KXP A;  5GV0 A;  3PGS A;  1S5L O;  1T16 A;  2JMM A;  2R4L A;  1E54 A;  4PR7 A;  2QTK A;  5KAF O;  4B61 A;  3AAE B;  3DZM A;  4K3C A;  4FSO A;  5B5E O;  3BS0 A;  1BXW A;  4AKR A;  4AUI A;  3EMN X;  4D64 A;  3T20 A;  2KDY A;  3AA1 B;  4IL6 O;  5E79 O;  5H2F O;  3VZT X;  4F4B A;  2LFU A;  4O3X B;  3HOE A;  4LSI A;  5T5F A;  1H6S 1;  4XNK A;  4GCP A;  3AAA A;  4AFK A;  3PQS A;  1ZHY A;  4FT6 A;  4N58 A;  5G39 A;  3HW9 A;  4FZM A;  2R88 A;  2XTR A;  4XNL A;  4AKM A;  3K19 A;  4FSP A;  4U9C A;  5DL6 A;  2XE1 A;  3SY7 A;  8PRN A;  3DA4 A;  4C00 A;  2JQY A;  1BT9 A;  2FGR A;  4AZL A;  1OPF A;  4GCS A;  5GTI O;  3UPG A;  1ZHT A;  4N75 A;  5IYU A;  2F1T A;  3SYB A;  1G90 A;  2KC0 A;  2XMX A;  4C4V B;  4RLC A;  3PRN A;  4BUM X;  2K0L A;  1QJ8 A;  3PF1 A;  4FMS A;  7PRN A;  3GP6 A;  1QJ9 A;  2J1N A;  2MHL A;  2XE2 A;  3LK2 B;  3UAQ A;  3UU2 A;  3VE1 A;  2J4U P;  4O4X A;  5DL7 A;  3POX A;  3POQ A;  2AXT O;  4GCQ A;  2KZ7 A;  3G7G A;  3PQU A;  4LSF A;  3A2S X;  3NSG A;  2OMF A;  4KR8 A;  4Z3T A;  2IWW A;  2K4T A;  2WVP A;  1T1L A;  5ADX L;  3AA1 A;  3DWN A;  2GE4 A;  2WJQ A;  4N59 A;  3WU2 O;  4AYN A;  4D65 A;  4FRX A;  4RJW A;  5GTH O;  2XE5 A;  5EE2 A;  1IZN A;  2Y2X A;  3AAA B;  5DL5 A;  1ZHZ A;  4FQE A;  4AYD C;  1GFN A;  4AYE C;  5DL8 A;  2ERV A;  3V8U A;  5AFU L;  4RJX A;  3WI5 A;  4K3B A;  4JFB A;  3LK4 2;  3KZI O;  1HXT A;  2M06 A;  2MNH A;  2W80 C;  4C69 X;  4LSE A;  1P4T A;  2F1C X;  3QRC A;  3AA7 B;  3SY9 A;  2N2M A;  2Y0K A;  3BRY A;  3HOL A;  1PRN A;  1MM4 A;  4O3W A;  1Q9G A;  4E1S A;  1MM5 A;  2YNK A;  6PRN A;  4C4V A;  3VE2 A;  2R8A A;  3POR A;  3C5O A;  1GFO A;  1PHO A;  2FGQ X;  3LK2 A;  3AA6 B;  4AYM C;  3A0H O;  3O0E A;  4FOZ A;  2IWV A;  2N2L A;  2WJR A;  5D5D A;  1BH3 A;  1HXX A;  2ZLD A;  3T0S A;  1GFP A;  4FES A;  2KZ7 B;  3NJT A;  3PGR A;  4UB8 O;  4N74 A;  3AA0 B;  3LK3 A;  4PJ0 O;  3PGU A;  2KXP B;  3VY9 X;  2Y7S A;  2R89 A;  2R4N A;  5AFU K;  3JCU O;  3DA3 A;  4JCH A;  3RBH A;  4GF4 A;  4PUX A;  1ZHW A;  5KAI O;  4QQ1 A;  5JDP A;  3AAE A;  2M07 A;  2ZFG A;  2XTQ A;  3HWB A;  2R4P A;  2POR A;  4FUV A;  1IZN B;  4FZL A;  1GFM A;  1YS5 A;  4AKR B;  2XE3 A;  2PRN A;  1HXU A;  5G3A A;  3BRZ A;  3SZD A;  3VZW X;  4KRA A;  4O3Y A;  2LHF A;  3A0B O;  4O3Z A;  5ADX K;  4CTD A;  2X27 X;  1Q9F A;  3QRA A;  2O4V A;  1THQ A;  4G76 A;  1ZHX A;  4LSH A;  3LK4 1;  5FVN A;  3SZV A;  3VY8 X;  3POU A;  1GFQ A;  4E1T A;  2R4O A;  2X9K A;  1MPF A;  3AA7 A;  4AYI D;  2YPV A;  5B66 O;  4FRT A;  3KVD D;  2ODJ A;  4UB6 O;  2Y0H A;  4FZN A;  2W81 C;  3SYS A;  4RLB A;  3VZU X;  4O4U A;  3AA6 A;  4KR4 A;  5G26 A;  4D5U A;  1QJP A;  2XG6 A;  5PRN A;  3TZG A;  3WI4 A;  2Y0L A;  1ORM A;  4GHB A;  3JTY A;  4O49 A;  3FYX A;  1OSM A;  4RL9 A;  5G38 A;  3DWO X; 
#chains in the Genus database with same CATH homology
 2R4O A;  3BS0 A;  2R4P A;  3PGU A;  3BRY A;  3BRZ A;  2R88 A;  2R89 A;  2R4N A;  1T1L A;  1T16 A;  2R4L A;  3PGS A;  3DWN A;  2R8A A;  3PGR A;  3DWO X;  3PF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...