1T16A

Crystal structure of the bacterial fatty acid transporter fadl from escherichia coli
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
427
structure length
427
Chain Sequence
AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAFHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the long-chain fatty acid transporter FadL.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid transport
molecule keywords Long-chain fatty acid transport protein
total genus 110
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 1t16A00
2R4NA 3DWOX 3PGSA 3BRZA 3PGRA 3PGUA 3PF1A 2R88A 3DWNA 1T1LA 2R4LA 3BS0A 1T16A 2R8AA 2R4OA 2R89A 2R4PA 3BRYA
chains in the Genus database with same CATH superfamily
5JDPA 4U9CA 2F1TA 1T1LA 4LSEA 4N59A 2XTQA 5H2FO 3WI5A 3SY7A 3DWNA 4FZNA 2R88A 4Z3TA 2M07A 1MM5A 2W81C 2MNHA 2X27X 4FT6A 4KR4A 4GF4A 2WJRA 4FQEA 4O3XB 2R89A 5IYUA 3VZWX 1P4TA 4AFKA 2XMXA 1BH3A 2Y0LA 2KDYA 2WJQA 3PGUA 4RJXA 4O3YA 2KC0A 5FVNA 3UU2A 3A0HO 5E79O 4RLBA 3K19A 3POUA 3PRNA 5GTIO 4C69X 2WVPA 4AKRA 3AAEA 3PF1A 2XE2A 4O3WA 2ODJA 5T5FA 4FMSA 5DL5A 3WU2O 1BXWA 4FOZA 4UB8O 4O3ZA 4PR7A 4FESA 3DA4A 4RL9A 3AA0A 2F1CX 3C5OA 2KXPA 4G76A 3FYXA 5DL7A 5ADXL 2Y2XA 2YNKA 3AAEB 3BRYA 3G7GA 4D65A 1GFMA 1OPFA 3HW9A 4GHBA 2Y0HA 3VE1A 4AZLA 1IZNB 1IZNA 4LSIA 3VY9X 1T16A 3VE2A 3O0EA 3LK2A 3AA0B 2XTRA 3AA7B 2ZFGA 3LK3A 3WI4A 2LFUA 3HWBA 4N74A 5TISO 3T0SA 4C4VB 4F4BA 5AFUL 3VZTX 1GFOA 2LHFA 4RJWA 5B66O 3QRAA 2R8AA 2PORA 4JFBA 4AYEC 1H6S1 2JMMA 3UAQA 3JTYA 5B5EO 1ZHTA 2YPVA 2ZLDA 2J4UP 2F1VA 1G90A 2N2MA 4FZLA 2R4LA 3AA7A 7PRNA 5PRNA 3QRCA 3A2SX 1QJPA 5DL6A 2KZ7A 3VY8X 3LK42 3LK3B 1ZHZA 4G75A 2FGQX 3PQSA 4IL6O 2Y0KA 4KR8A 1QJ8A 2FGRA 3EMNX 4PJ0O 5D5DA 1Q9FA 3V8UA 1HXTA 3AA1B 3AA1A 4GCSA 1ZHYA 2JQYA 4JCHA 1QJ9A 4XNKA 2R4OA 3AA6A 4N75A 2R4NA 3PGSA 1OSMA 3SY9A 5EE2A 2KZ7B 1MPFA 1ORMA 1THQA 2QTKA 5G26A 3GP6A 3POXA 3HOEA 1BT9A 4AYID 4CTDA 1GFQA 5DL8A 4K3CA 3SYBA 4E1SA 1HXXA 3T20A 3BRZA 2K0LA 3NSGA 4O4UA 2M06A 4AKRB 4FRXA 4LSHA 2ERVA 3KVDD 4AKMA 3AAAA 2K4TA 2Y7SA 2W80C 4GCPA 2GE4A 4PUXA 3SYSA 4N58A 2IWVA 3KZIO 4XNLA 4AUIA 4FSOA 3RBHA 3VZUX 4GCQA 4D64A 3T24A 6PRNA 1GFNA 2J1NA 2XE3A 5G39A 5G3AA 4FSPA 4RLCA 4D5UA 2X9KA 2PRNA 4O4XA 2N2LA 3LK41 4BUMX 3POQA 1HXUA 3DWOX 3DZMA 8PRNA 3PGRA 5G38A 5ADXK 1PRNA 3PQUA 4K3BA 3A0BO 3UPGA 4AYDC 3NJTA 1PHOA 1Q9GA 4KRAA 3DA3A 5KAFO 4B61A 5AFUK 2R4PA 2XG6A 3JCUO 4UB6O 2OMFA 4C4VA 1ZHXA 1S5LO 4O49A 3PORA 4AYMC 4E1TA 3TZGA 3BS0A 3LK2B 5GTHO 4FUVA 4FZMA 2O4VA 1GFPA 4C00A 2XE5A 3AA6B 3SZDA 4AYNA 2XE1A 4QQ1A 1ZHWA 2IWWA 1E54A 1YS5A 3AAAB 5GV0A 1MM4A 2AXTO 2MHLA 3HOLA 4FRTA 4LSFA 3SZVA 2KXPB 5KAIO
chains in the Genus database with same CATH topology
2R4NA 3DWOX 3PGSA 3BRZA 3PGRA 3PGUA 3PF1A 2R88A 3DWNA 1T1LA 2R4LA 3BS0A 1T16A 2R8AA 2R4OA 2R89A 2R4PA 3BRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4N A;  3DWO X;  3PGS A;  3BRZ A;  3PGR A;  3PGU A;  3PF1 A;  2R88 A;  3DWN A;  1T1L A;  2R4L A;  3BS0 A;  1T16 A;  2R8A A;  2R4O A;  2R89 A;  2R4P A;  3BRY A; 
#chains in the Genus database with same CATH topology
 5JDP A;  4U9C A;  2F1T A;  1T1L A;  4LSE A;  4N59 A;  2XTQ A;  5H2F O;  3WI5 A;  3SY7 A;  3DWN A;  4FZN A;  2R88 A;  4Z3T A;  2M07 A;  1MM5 A;  2W81 C;  2MNH A;  2X27 X;  4FT6 A;  4KR4 A;  4GF4 A;  2WJR A;  4FQE A;  4O3X B;  2R89 A;  5IYU A;  3VZW X;  1P4T A;  4AFK A;  2XMX A;  1BH3 A;  2Y0L A;  2KDY A;  2WJQ A;  3PGU A;  4RJX A;  4O3Y A;  2KC0 A;  5FVN A;  3UU2 A;  3A0H O;  5E79 O;  4RLB A;  3K19 A;  3POU A;  3PRN A;  5GTI O;  4C69 X;  2WVP A;  4AKR A;  3AAE A;  3PF1 A;  2XE2 A;  4O3W A;  2ODJ A;  5T5F A;  4FMS A;  5DL5 A;  3WU2 O;  1BXW A;  4FOZ A;  4UB8 O;  4O3Z A;  4PR7 A;  4FES A;  3DA4 A;  4RL9 A;  3AA0 A;  2F1C X;  3C5O A;  2KXP A;  4G76 A;  3FYX A;  5DL7 A;  5ADX L;  2Y2X A;  2YNK A;  3AAE B;  3BRY A;  3G7G A;  4D65 A;  1GFM A;  1OPF A;  3HW9 A;  4GHB A;  2Y0H A;  3VE1 A;  4AZL A;  1IZN B;  1IZN A;  4LSI A;  3VY9 X;  1T16 A;  3VE2 A;  3O0E A;  3LK2 A;  3AA0 B;  2XTR A;  3AA7 B;  2ZFG A;  3LK3 A;  3WI4 A;  2LFU A;  3HWB A;  4N74 A;  5TIS O;  3T0S A;  4C4V B;  4F4B A;  5AFU L;  3VZT X;  1GFO A;  2LHF A;  4RJW A;  5B66 O;  3QRA A;  2R8A A;  2POR A;  4JFB A;  4AYE C;  1H6S 1;  2JMM A;  3UAQ A;  3JTY A;  5B5E O;  1ZHT A;  2YPV A;  2ZLD A;  2J4U P;  2F1V A;  1G90 A;  2N2M A;  4FZL A;  2R4L A;  3AA7 A;  7PRN A;  5PRN A;  3QRC A;  3A2S X;  1QJP A;  5DL6 A;  2KZ7 A;  3VY8 X;  3LK4 2;  3LK3 B;  1ZHZ A;  4G75 A;  2FGQ X;  3PQS A;  4IL6 O;  2Y0K A;  4KR8 A;  1QJ8 A;  2FGR A;  3EMN X;  4PJ0 O;  5D5D A;  1Q9F A;  3V8U A;  1HXT A;  3AA1 B;  3AA1 A;  4GCS A;  1ZHY A;  2JQY A;  4JCH A;  1QJ9 A;  4XNK A;  2R4O A;  3AA6 A;  4N75 A;  2R4N A;  3PGS A;  1OSM A;  3SY9 A;  5EE2 A;  2KZ7 B;  1MPF A;  1ORM A;  1THQ A;  2QTK A;  5G26 A;  3GP6 A;  3POX A;  3HOE A;  1BT9 A;  4AYI D;  4CTD A;  1GFQ A;  5DL8 A;  4K3C A;  3SYB A;  4E1S A;  1HXX A;  3T20 A;  3BRZ A;  2K0L A;  3NSG A;  4O4U A;  2M06 A;  4AKR B;  4FRX A;  4LSH A;  2ERV A;  3KVD D;  4AKM A;  3AAA A;  2K4T A;  2Y7S A;  2W80 C;  4GCP A;  2GE4 A;  4PUX A;  3SYS A;  4N58 A;  2IWV A;  3KZI O;  4XNL A;  4AUI A;  4FSO A;  3RBH A;  3VZU X;  4GCQ A;  4D64 A;  3T24 A;  6PRN A;  1GFN A;  2J1N A;  2XE3 A;  5G39 A;  5G3A A;  4FSP A;  4RLC A;  4D5U A;  2X9K A;  2PRN A;  4O4X A;  2N2L A;  3LK4 1;  4BUM X;  3POQ A;  1HXU A;  3DWO X;  3DZM A;  8PRN A;  3PGR A;  5G38 A;  5ADX K;  1PRN A;  3PQU A;  4K3B A;  3A0B O;  3UPG A;  4AYD C;  3NJT A;  1PHO A;  1Q9G A;  4KRA A;  3DA3 A;  5KAF O;  4B61 A;  5AFU K;  2R4P A;  2XG6 A;  3JCU O;  4UB6 O;  2OMF A;  4C4V A;  1ZHX A;  1S5L O;  4O49 A;  3POR A;  4AYM C;  4E1T A;  3TZG A;  3BS0 A;  3LK2 B;  5GTH O;  4FUV A;  4FZM A;  2O4V A;  1GFP A;  4C00 A;  2XE5 A;  3AA6 B;  3SZD A;  4AYN A;  2XE1 A;  4QQ1 A;  1ZHW A;  2IWW A;  1E54 A;  1YS5 A;  3AAA B;  5GV0 A;  1MM4 A;  2AXT O;  2MHL A;  3HOL A;  4FRT A;  4LSF A;  3SZV A;  2KXP B;  5KAI O; 
#chains in the Genus database with same CATH homology
 2R4N A;  3DWO X;  3PGS A;  3BRZ A;  3PGR A;  3PGU A;  3PF1 A;  2R88 A;  3DWN A;  1T1L A;  2R4L A;  3BS0 A;  1T16 A;  2R8A A;  2R4O A;  2R89 A;  2R4P A;  3BRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...