1T16A

Crystal structure of the bacterial fatty acid transporter fadl from escherichia coli
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
427
structure length
427
Chain Sequence
AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAFHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Long-chain fatty acid transport protein
publication title Crystal structure of the long-chain fatty acid transporter FadL.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid transport
total genus 110
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 1t16A00
3BRZA 3PGSA 3PGUA 2R88A 3PGRA 1T16A 2R8AA 1T1LA 2R89A 3DWOX 2R4NA 3BRYA 3PF1A 3DWNA 2R4LA 2R4PA 2R4OA 3BS0A
chains in the Genus database with same CATH superfamily
2FGQX 3O0EA 4D5UA 2YPVA 4FOZA 5JDPA 2N2LA 4FZNA 1MPFA 1GFQA 3GP6A 2R8AA 2R4NA 4N74A 3T0SA 3BS0A 3G7GA 3V8UA 4GF4A 3VY9X 2Y0KA 1ZHTA 4O49A 1THQA 3VE2A 1PHOA 4AZLA 2ZLDA 2Y0HA 1ORMA 5GTIO 4G75A 2M06A 3PORA 3QRAA 5B66O 2R88A 2ERVA 2Y0LA 1HXXA 2WJQA 2PRNA 3FYXA 4AYDC 4D65A 2XMXA 4KRAA 4RJXA 4XNLA 3HWBA 2N2MA 5B5EO 2IWVA 2Y7SA 4AYNA 4N58A 2K4TA 5G38A 2GE4A 5ADXL 2JMMA 3A2SX 2XE5A 5FVNA 1BT9A 2MNHA 4FSOA 5TISO 3QRCA 4LSFA 3LK41 2OMFA 4CTDA 4Z3TA 2XE2A 4RLBA 4AKMA 3T20A 1GFOA 3PRNA 1P4TA 3WI4A 2F1CX 2JQYA 3LK3A 4O3YA 4LSEA 1GFMA 3LK3B 4RL9A 1HXTA 3AA1A 3LK2A 3WI5A 4FUVA 2ZFGA 4XNKA 3AA1B 3LK2B 3PQSA 4N59A 4KR4A 4PR7A 5G26A 3NSGA 3DA3A 3UAQA 4BUMX 1QJPA 1E54A 2YNKA 5EE2A 4FZMA 5DL6A 3PF1A 3DWOX 5KAIO 2ODJA 3DZMA 3TZGA 3VZUX 1ZHWA 2W80C 3POQA 4FMSA 3BRZA 4FRTA 4FESA 1BH3A 3A0HO 4FT6A 4JCHA 4RLCA 3SYSA 4C4VA 1ZHYA 2O4VA 2WJRA 1T1LA 3AA6A 4C4VB 1Q9GA 2J1NA 4UB6O 1IZNA 3AA6B 2LHFA 3DWNA 3K19A 5G39A 3RBHA 3SYBA 3SZDA 1IZNB 1ZHZA 5H2FO 3PGSA 2AXTO 5DL8A 4N75A 1OPFA 1T16A 3LK42 4PUXA 2XE1A 5PRNA 4FZLA 1PRNA 2F1VA 4K3BA 3SY9A 5AFUL 2MHLA 3PGRA 4F4BA 2KXPA 4GCQA 4KR8A 2W81C 4D64A 2IWWA 2XTQA 1GFNA 2KXPB 1BXWA 4IL6O 3AA0A 2K0LA 4C00A 1S5LO 4FSPA 3AA7A 3AA0B 3SZVA 5DL7A 5GTHO 3PGUA 3AA7B 2KC0A 3POUA 2FGRA 1HXUA 2R89A 3KVDD 3WU2O 4AKRA 3NJTA 1GFPA 2XE3A 4G76A 4AKRB 3T24A 2J4UP 1Q9FA 3VZTX 4E1TA 4B61A 4LSIA 5ADXK 2KDYA 4O3XB 2PORA 3VY8X 4C69X 5D5DA 1YS5A 2F1TA 2X27X 4LSHA 4O4XA 3JTYA 4FQEA 3VE1A 2WVPA 3HOEA 7PRNA 4AYMC 3SY7A 4GCPA 4FRXA 5G3AA 2QTKA 4GHBA 4O4UA 3BRYA 4PJ0O 1MM4A 1QJ9A 2XTRA 4U9CA 3A0BO 5E79O 4E1SA 1G90A 3VZWX 1H6S1 3HOLA 3POXA 3KZIO 4JFBA 4O3ZA 8PRNA 5GV0A 3DA4A 2Y2XA 2LFUA 3AAAA 4RJWA 2R4PA 5T5FA 3AAAB 4K3CA 3UPGA 2M07A 3PQUA 3C5OA 6PRNA 4AYEC 5AFUK 2XG6A 4GCSA 4AFKA 2R4LA 2R4OA 3AAEA 1ZHXA 3EMNX 3UU2A 3HW9A 1QJ8A 2X9KA 3AAEB 1MM5A 3JCUO 2KZ7A 1OSMA 4QQ1A 4UB8O 5IYUA 2KZ7B 5DL5A 4AUIA 4AYID 4O3WA 5KAFO
chains in the Genus database with same CATH topology
3BRZA 3PGSA 3PGUA 2R88A 3PGRA 1T16A 2R8AA 1T1LA 2R89A 3DWOX 2R4NA 3BRYA 3PF1A 3DWNA 2R4LA 2R4PA 2R4OA 3BS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BRZ A;  3PGS A;  3PGU A;  2R88 A;  3PGR A;  1T16 A;  2R8A A;  1T1L A;  2R89 A;  3DWO X;  2R4N A;  3BRY A;  3PF1 A;  3DWN A;  2R4L A;  2R4P A;  2R4O A;  3BS0 A; 
#chains in the Genus database with same CATH topology
 2FGQ X;  3O0E A;  4D5U A;  2YPV A;  4FOZ A;  5JDP A;  2N2L A;  4FZN A;  1MPF A;  1GFQ A;  3GP6 A;  2R8A A;  2R4N A;  4N74 A;  3T0S A;  3BS0 A;  3G7G A;  3V8U A;  4GF4 A;  3VY9 X;  2Y0K A;  1ZHT A;  4O49 A;  1THQ A;  3VE2 A;  1PHO A;  4AZL A;  2ZLD A;  2Y0H A;  1ORM A;  5GTI O;  4G75 A;  2M06 A;  3POR A;  3QRA A;  5B66 O;  2R88 A;  2ERV A;  2Y0L A;  1HXX A;  2WJQ A;  2PRN A;  3FYX A;  4AYD C;  4D65 A;  2XMX A;  4KRA A;  4RJX A;  4XNL A;  3HWB A;  2N2M A;  5B5E O;  2IWV A;  2Y7S A;  4AYN A;  4N58 A;  2K4T A;  5G38 A;  2GE4 A;  5ADX L;  2JMM A;  3A2S X;  2XE5 A;  5FVN A;  1BT9 A;  2MNH A;  4FSO A;  5TIS O;  3QRC A;  4LSF A;  3LK4 1;  2OMF A;  4CTD A;  4Z3T A;  2XE2 A;  4RLB A;  4AKM A;  3T20 A;  1GFO A;  3PRN A;  1P4T A;  3WI4 A;  2F1C X;  2JQY A;  3LK3 A;  4O3Y A;  4LSE A;  1GFM A;  3LK3 B;  4RL9 A;  1HXT A;  3AA1 A;  3LK2 A;  3WI5 A;  4FUV A;  2ZFG A;  4XNK A;  3AA1 B;  3LK2 B;  3PQS A;  4N59 A;  4KR4 A;  4PR7 A;  5G26 A;  3NSG A;  3DA3 A;  3UAQ A;  4BUM X;  1QJP A;  1E54 A;  2YNK A;  5EE2 A;  4FZM A;  5DL6 A;  3PF1 A;  3DWO X;  5KAI O;  2ODJ A;  3DZM A;  3TZG A;  3VZU X;  1ZHW A;  2W80 C;  3POQ A;  4FMS A;  3BRZ A;  4FRT A;  4FES A;  1BH3 A;  3A0H O;  4FT6 A;  4JCH A;  4RLC A;  3SYS A;  4C4V A;  1ZHY A;  2O4V A;  2WJR A;  1T1L A;  3AA6 A;  4C4V B;  1Q9G A;  2J1N A;  4UB6 O;  1IZN A;  3AA6 B;  2LHF A;  3DWN A;  3K19 A;  5G39 A;  3RBH A;  3SYB A;  3SZD A;  1IZN B;  1ZHZ A;  5H2F O;  3PGS A;  2AXT O;  5DL8 A;  4N75 A;  1OPF A;  1T16 A;  3LK4 2;  4PUX A;  2XE1 A;  5PRN A;  4FZL A;  1PRN A;  2F1V A;  4K3B A;  3SY9 A;  5AFU L;  2MHL A;  3PGR A;  4F4B A;  2KXP A;  4GCQ A;  4KR8 A;  2W81 C;  4D64 A;  2IWW A;  2XTQ A;  1GFN A;  2KXP B;  1BXW A;  4IL6 O;  3AA0 A;  2K0L A;  4C00 A;  1S5L O;  4FSP A;  3AA7 A;  3AA0 B;  3SZV A;  5DL7 A;  5GTH O;  3PGU A;  3AA7 B;  2KC0 A;  3POU A;  2FGR A;  1HXU A;  2R89 A;  3KVD D;  3WU2 O;  4AKR A;  3NJT A;  1GFP A;  2XE3 A;  4G76 A;  4AKR B;  3T24 A;  2J4U P;  1Q9F A;  3VZT X;  4E1T A;  4B61 A;  4LSI A;  5ADX K;  2KDY A;  4O3X B;  2POR A;  3VY8 X;  4C69 X;  5D5D A;  1YS5 A;  2F1T A;  2X27 X;  4LSH A;  4O4X A;  3JTY A;  4FQE A;  3VE1 A;  2WVP A;  3HOE A;  7PRN A;  4AYM C;  3SY7 A;  4GCP A;  4FRX A;  5G3A A;  2QTK A;  4GHB A;  4O4U A;  3BRY A;  4PJ0 O;  1MM4 A;  1QJ9 A;  2XTR A;  4U9C A;  3A0B O;  5E79 O;  4E1S A;  1G90 A;  3VZW X;  1H6S 1;  3HOL A;  3POX A;  3KZI O;  4JFB A;  4O3Z A;  8PRN A;  5GV0 A;  3DA4 A;  2Y2X A;  2LFU A;  3AAA A;  4RJW A;  2R4P A;  5T5F A;  3AAA B;  4K3C A;  3UPG A;  2M07 A;  3PQU A;  3C5O A;  6PRN A;  4AYE C;  5AFU K;  2XG6 A;  4GCS A;  4AFK A;  2R4L A;  2R4O A;  3AAE A;  1ZHX A;  3EMN X;  3UU2 A;  3HW9 A;  1QJ8 A;  2X9K A;  3AAE B;  1MM5 A;  3JCU O;  2KZ7 A;  1OSM A;  4QQ1 A;  4UB8 O;  5IYU A;  2KZ7 B;  5DL5 A;  4AUI A;  4AYI D;  4O3W A;  5KAF O; 
#chains in the Genus database with same CATH homology
 3BRZ A;  3PGS A;  3PGU A;  2R88 A;  3PGR A;  1T16 A;  2R8A A;  1T1L A;  2R89 A;  3DWO X;  2R4N A;  3BRY A;  3PF1 A;  3DWN A;  2R4L A;  2R4P A;  2R4O A;  3BS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...