1T1BA

Late intermediate il2 from time-resolved crystallography of the e46q mutant of pyp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title A Structural Pathway for Signaling in the E46Q Mutant of Photoactive Yellow Protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
total genus 31
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1t1bA00
3LIAA 1V9ZA 5HDDA 4HP9A 3VE4A 3NJAA 4WN5A 3C8CA 1DP8A 3FC7A 4F3LB 3RH8B 4BBUA 4DJ2A 1TS7A 1UWNX 2P7JA 4MN6A 4YWZA 4RQ9A 2PDRA 1GSVA 1S1ZA 4R70A 4GHIB 3ULFA 5TBMB 1F98A 3A0VA 1JNUA 3ICYA 3CLOA 1UWPX 4PKYA 4HHDA 5DJTA 2V1BA 3E4OA 5HD3A 5G4YA 3EWKA 2HV1A 2QJ7A 1D06A 5DKLA 2QJ5A 3CWFA 2VEAA 1VB6A 3UMEA 4EQ1A 3CAXA 5I5LA 3NOTC 2PD7A 4JGOA 2I9VA 4WF0A 5DJUA 3D72A 1XJ2A 4BBVA 4GS9A 3K3CA 4E04A 5AVEA 3F1OA 4I3IA 4HH2A 3OLOA 1S67L 4GW9A 3MQQA 3LICA 1OJGA 1XJ4A 1WA9A 2A24A 2QHKA 1KOUA 4LLOB 3LIFA 3UB6A 4K08A 4I38A 2ZOIA 2JHEA 3LI8A 5F69A 4EESA 2WKRA 1GSXA 1LT0A 3NOUC 1MZUA 2M1CA 1OTDA 1OTAA 4HOIA 1TS6A 2R78A 4XT2B 3KX0X 5EFWA 2L0WA 4H6JB 3A0SA 2PYPA 2GJ3A 4EETB 4WUJA 4I39A 2VV8A 5J7EA 2L1MA 4B9OA 3E4PA 2V9AA 1ODVA 4L9EA 4EERA 4HNBA 4HI4A 4MN5A 2V1AA 3F1PA 3IS2A 2BASA 4LRYC 2VLGA 4M4XA 3PYPA 3MQOA 4GCZA 2J80A 1G28A 2D02A 2VV7A 4KQDA 2WKPA 3UB7A 3F1NA 1NWZA 1GSWA 3E4QA 2OWHA 3H9WA 3UB9A 5G4ZA 2Z6CA 1OT6A 3MFXA 3K3DA 5IU1A 4DJ3A 1DRMA 4GS9B 3T50A 3GECA 1XJ3A 3F1OB 4HY8A 3H7WA 1N9NA 4R38A 2WKQA 1LSWA 5HWTA 1DP9A 2V0WA 3UE6A 2A24B 3PHYA 4JGPA 3H82A 2PD8A 1TS0A 1Y28A 2ZOHA 1XFNA 2KDKA 3BWLA 1OTEA 4LRXC 1OTBA 4NXEA 1S4RA 3HJKA 1F9IA 1OTIA 5HWWA 2YKFA 3LIDA 2W27A 1XFQA 3VE3A 1T1AA 2PYRA 4WLAA 4EXOA 3A0RA 2EA9A 1N9LA 2ZBBA 3LUQA 5HSQA 2YKHA 4LPZA 3ZQ5A 2W0NA 1UGUA 2L4RA 5HDSA 5F68A 5IS1A 3BY9A 3F1PB 4WL9A 3IS2B 5HZHA 5HD5A 1T18A 4NXBA 4I3AA 2QWSA 4NXFA 1DP6A 4L9FA 5F5YA 5AVFA 3FG8A 1LL8A 5A8BA 1D7EA 4I5SA 3G6OA 3HJIA 5J4EA 1S4SA 3F1NB 4F3LA 4LRZE 5F6AA 2VV6A 3EEHA 4R6LA 2OOLA 2K7SA 1T1CA 4GHIA 3LIEA 4HP4A 5TBMA 3UB8A 3LIBA 3SW1A 3GDIA 1N9OA 2B02A 1LSVA 2KX6A 2PR5A 2CMNA 2INWA 4KUKA 3H7WB 3UMDA 1T1BA 3NOPC 3BY8A 1P0ZA 4I3JA 1S66L 4HQAA 4EW7A 5KIZA 3H82B 1S1YA 5DKKA 3LYXA 3NHQA 4EEUA 1X0OA 2D01A 4R3AA 3MR0A 1T19A 2QKPA 4KUOA 2H28A 4HJ3A 4JGQA 1TS8A 3P7NA 3B33A 1XJ6A 4JGRA 2PHYA 1LSXA 2Z6DA 1OJ5A 4EEPA 1EW0A 4L9GA 1OT9A 4HJ6A 1P97A 3MJQA 3IBRA 5HWVA 4HH3A 1V9YA 3VOLA 3LI9A 4BBTA 3RTYA 4PKYG 2OWJA 5HDCA 2V0UA 3C2WA 2JN7A 4HIAA 2PR6A 5J3WA 4NXGA 1BYWA 4HJ4A 4XT2A 3MXQA 4H6JA
chains in the Genus database with same CATH superfamily
1W8QA 5M1AA 3HCYA 3WS0A 2HP5A 1ES5A 3C7UA 3IF5A 4OPRA 4MMNA 1K56A 2G2WA 1Q2QA 3Q7ZA 3ZG7B 3QNCA 4DE1A 5DF7A 2Z2LB 1UWNX 4S2NC 3ZVWA 4MN6A 2H10A 1MWRA 4YWZA 1XA1A 4X53A 1ERMA 3B47A 3A0VA 4BWIA 3BFDA 4X56A 1CEGA 1WYBA 3CPTA 2ZQCA 4HHDA 5HD3A 2WKIA 5G4YA 2Z2MB 2QJ7A 3SH8A 1YSPA 4OQIA 4S2KA 3MKFA 2J9OA 4EQ1A 3CAXA 3S1YA 2BG1A 2PD7A 4JGOA 1YLYA 4P6BA 2QMIA 5DJUA 4RX3A 2Y2KA 2EXAA 5HAQA 2Y8HA 3F1OA 1JWPA 1D1JA 1O7EA 3GMWA 4R4RA 3OLOA 1K0KA 1N9BA 3LR0A 3EOIA 1OJGA 4NEED 1LI0A 1SZVA 3WS1A 5EVIB 3SH9A 2OSUA 3IWOA 3NC8A 1L0DA 4LV1A 2VGLS 1CI9A 4ZRRA 1ACFA 2Q9NA 2Y59A 1TF1A 4O0PA 4DDYA 2JKFA 2WUQA 5FL3A 1GSXA 4MNRA 1MZUA 2ZC3B 5JYOA 2BLSA 4HOIA 5EFWA 2VK3A 4S2NA 4GDBA 2PRFA 1ZG4A 2Y2PA 3BFGA 5CGSA 4IUKA 2GJ3A 5KSCA 4E3IA 4EETB 2GNXA 1NZUA 4WUJA 2VV8A 3VFFA 2L1MA 3HLFA 3W2ZA 1JWVA 3VFHA 3IS2A 2BASA 4JXSA 1H3QA 3HLDA 3N6IA 3DTMA 4LV0A 1WE4A 2FH5A 4M4XA 1KE3A 4OOMA 4OH0A 3MQOA 3JPUA 3GVBA 3MBZA 4MN7A 1G28A 2JKTI 2EX2A 1HLUP 5FEGA 3B3XA 3Q81A 1O07A 3UB7A 4GD8A 3T4OA 5LBRA 5HW3A 2Y2QA 3EGDC 3E4QA 1EWZA 3UB9A 2ZMFA 2A49A 3IXDA 1MWTA 3EQVA 1OT6A 4A5RA 4XXRA 1PI4A 3C38A 3UB5P 1SHVA 1XJ3A 3LY4A 1YSQA 3DBAA 4HY8A 1GHPA 4PM9A 4F94A 4QB8A 1N9NA 2AVXA 2WKQA 3G4PA 3MZEA 4JXWA 4B4ZA 3UE6A 3N8RA 4OPYA 3C4PA 3D4FA 1IELA 5IT5A 2O99A 2ZM2A 4OKPA 2KDKA 3NULA 4DXCA 4NXEA 1HZOA 2XEPA 4CQHA 1PNEA 5JYPA 2W1TB 4DKIA 5HWWA 1BLSA 3E2LA 4OOYA 4Q8IA 2JKGA 4U3TA 1T1AA 4Y13A 1ZC2A 3GSGA 4KZ9A 4WMCD 3V50A 3Q07A 4RVAA 2EA9A 2Y79A 5HSQA 4LV3A 1UGUA 1NJ4A 5EOEA 2XFSA 5E2FA 2HDRA 2VGJA 3F1PB 5HD5A 1GCEA 2DCFA 1T18A 4NXBA 3C7VA 2QWSA 3GV9A 4S2MA 3IH9A 2HGVA 3MSHA 1YAXA 4Z9QA 1CJFA 3PBOA 2WKEA 4NETA 5F1GA 3RJUA 1D7EA 4I5SA 5TJJA 4F3LA 5F6AA 2Y2OA 4R6LA 1CQAA 2K7SA 5DTKA 4ESPA 3WRZA 3LIEA 2P74A 3LIBA 3W4PA 3SW1A 1K54C 1G6AA 4FSFA 3BW6A 1P9WA 5GHXA 5FI7A 3A3JA 2B02A 1BLHA 3LO7A 4OQGA 3UPPA 2INWA 3VSLA 1S6RA 2PBDP 2WZXA 1T1BA 4G3VA 3NOPC 3T4QA 3LR5A 2WKHA 3T1QB 5A91A 3H82B 5M18A 5DTTA 4N9LA 2UWXA 2EWVA 5GLCA 3RFBA 3LYXA 1X0OA 3LGOA 1FCNA 2D01A 3QP6A 3HLCA 4KUOA 5L07A 3PBQA 2K2NA 2Y91A 1WYCA 2W3DA 4MEZA 3R4KA 2P9VB 5FDSA 3FKVA 4EEPA 4FOFA 1ES2A 4U0TA 2ZQAA 3NBLA 4HJ6A 4KZAA 4PMAA 1YLJA 4O01A 4BD0A 1KVLA 3FPVA 5HL1A 4ZDXA 1V9YA 4L0LA 1IKGA 1K38A 2HJ9C 2PAVP 3VP0A 4BBTA 3PBRA 1F2KA 1VETB 4OP5A 1W7FA 4K91A 2V0UA 1Z09A 1GHIA 4HIAA 3P01A 3MXSA 1ESIA 1PWGA 2V2FF 3PBSA 5A93A 4NKPA 5L10A 4X6TA 4H6JA 2HPBA 3VSKA 4K0WA 3GQZA 5HARA 5IHVA 1ONHA 1M6KA 2HJEA 2Y55A 2VX8A 1BZAA 3UDFA 1K54A 2IWDA 3UPOA 1GA0A 3O87A 4WN5A 3VP3A 3CITA 1MWUA 4LGWA 2M7VA 1J3WA 3C8CA 1M40A 1H8YA 4DJ2A 1LI9A 4GLQA 4RQ9A 2PDRA 2EFUA 5TGFA 1S1ZA 3JVVA 4GHIB 4ARZA 4JF5A 4WELA 5TBMB 1F98A 1LL5A 1YLWA 3T12B 4N9KA 3ZGAB 5CECA 2B95A 1JNUA 3ICYA 3CLOA 4PKYA 4CLCB 5AQBA 3E4OA 3MFDA 1YKDA 2B18A 4E6XA 3BLSA 2A2LA 3QHYA 3CWFA 5CHMA 3ISGA 5A90A 1JTGA 4KG6A 4QHCA 5AQ9A 4QD4A 4QY6A 1SKOB 4B4XA 3PXPA 4WF0A 4NK3A 4IVKA 1L0FA 4BBVA 3K3CA 4OONA 3BJNA 2ZMAA 1S67L 3BFEA 4S2IA 5L09A 3KSHA 4OQ0A 4Y0UA 3A3IA 2QHKA 4LFUA 4IHQA 4BLMA 5EVLA 3JVUA 1E25A 4K08A 3UB6A 2JHEA 2ZOIA 2M7UA 5F69A 2DRWA 3T4JA 4X55A 3R7WA 1XKZA 3C30A 2Q0OA 5CHJA 5HL6A 3NOUC 2ZL1B 3D3OA 1ZKJA 2E8IA 5TFQA 1OTDA 1OTAA 4RX2A 2WGWB 2R78A 3UE1A 3V39A 4DN0A 3KX0X 2P04A 2OLVA 2J8YA 4KZ6A 3CUEC 3UNWA 4IJGA 3TW8A 3AGFA 1K25A 1YPRA 3ZFZA 4E3NA 1BLPA 2W3FA 3AGEA 4KZ8A 4B9OA 1FSWA 1IKIA 1ALQA 1G68A 1PWCA 2XD1A 3NY4A 4Q0JA 4UEYA 2XD5A 1FIKA 4MN5A 1AWIA 4EBPA 1VEUA 4BENA 4GDNA 2XSSA 3CPTB 1FSYA 1PFLA 2JBFA 2XQZA 5GHYA 3M2KA 3LEQA 2VV7A 1XGJA 2W3HA 2HDQA 3F1NA 1NWZA 3CJMA 4KQOA 3S4XA 2R9WA 2ACGA 4R4SA 4MBKA 2ZJ9A 2OWHA 1CK3A 4DDSA 5F1FA 4P6ZM 1MKMA 1K55C 1KGGA 3LFVA 2ZQ7A 2Y2GA 3OBFA 2Y2LA 2C6WB 5AQAA 3L9KA 3GECA 4KQRA 2JE5A 3C5AA 3F1OB 5DFYA 1BTLA 2HDUA 5CX7A 1K57C 3NDGA 4R38A 4KZ4A 5HWTA 1DP9A 2V0WA 3PHYA 4GN2A 2XA7M 1I5QA 1TS0A 5L8MA 2OLUA 3CUEA 1XFNA 4LV2A 3VMAA 3VOYA 1KE4A 1L0GA 2J9PA 2GDNA 1S4RA 4Z1WA 4WYYA 3V5MA 1F9IA 1IEMA 3IQAA 2WYXA 3ZNTA 1W63Q 4UAAA 3O86A 3SH7A 3IH8A 3VE3A 3HLBA 3I7JA 2PYRA 1Q2PA 3A0RA 3BEBA 3LEZA 2Y2MA 1N9LA 3LUQA 2YKHA 1DJCA 3BQAA 5HDSA 2XROA 3BYDA 5J8XA 4FH4A 5E2GA 4FCFA 1H0MA 3GTCA 3IS2B 1YMXA 2V8CA 3E0YA 3FKWA 4NXFA 4L9FA 2LB5A 2XFTA 2ZC6B 4Y7PA 3GRJA 4IEDA 3BFFA 3IT9A 5A8BA 1K55A 2V8FA 4WZ4A 3QP2A 4OPQA 1LLBA 2HP9A 5J4EA 4ZJ2A 3C4OA 3CG5A 5FDHA 3EEHA 3FZCA 4E3OA 4EQIA 4EV4A 1K57A 1K6SA 3OZHA 4BL3A 3Q7VA 1LHYA 4BJPA 2EFXA 3IWQA 1W79A 1BSGA 3G35A 2KX6A 3MKEA 4E6WA 3NI9A 4E3MA 2JC7A 1FCMA 1L3LA 4KUKA 1YM1A 4P0MA 3UMDA 2ZQ9A 3BY8A 1P0ZA 3NECA 1ONGA 1W8YA 3BQ8A 5I94A 1JVJA 3UO9A 3SS4A 4N1XA 4QJGA 4HQAA 4EW7A 3UN7A 4E3LA 5CEDA 3O88A 1EROA 4R3AA 3MR0A 1J9MA 1T19A 4JXGA 2K31A 4DE3A 3WRTA 4GKUA 5EOOA 5AJGA 1IYQA 4JGQA 3UY6A 3E2KA 2W3EA 1XJ6A 2O9BA 4JGRA 4KENB 4L9GA 1OT9A 3A3FA 3OCLA 4KZ3A 1FOFA 3S22A 2ZLYA 1I2WA 3TJZC 2Y4AA 1NRJA 3HUMA 4D60A 1NLYA 1YQSA 3VOLA 3LI9A 5EM1A 4ID4A 3SZTA 2OWJA 1PWDA 5HDCA 5EUAA 3C2WA 3SOIA 3BECA 5EE8A 2PR6A 4WEJA 5J3WA 4NXGA 1RGZA 1BYWA 1E3UD 4LENA 5HPIA 4WZ5C 4HJ4A 4XT2A 2WGIA 3MXQA 2PD8A 4CPKA 5HX9A 3EEAA 3HBRA 4OOLA 1V9ZA 4HBTA 2QYBA 1GHMA 5DTSA 1PYYA 1MPLA 4X68A 3VE4A 3NJAA 1QMEA 3HUNA 2O9AA 3P09A 3IXBA 3FC7A 4F3LB 3ZHHA 2EX9A 3RH8B 4CLCE 1TS7A 3MZFA 4E3JA 3ZVTA 5CTMA 2Y2JA 1GSVA 3G34A 4N92A 1A0KA 4EU0A 4X1LA 3QNBA 1MY8A 4YNRA 4Y17A 1TDGA 1FQGA 5GL9A 5HAPA 3NDEA 5DJTA 2V1BA 3DTEA 3W4OA 3EWKA 2HV1A 3OPRA 4BD1A 1D06A 2QPNA 4H8RA 2QJ5A 4PM7A 4JF6A 2VEAA 1MXOA 3UMEA 5U47A 5I5LA 4P6ZS 1SKFA 5KMWA 3PAGA 3D72A 4ETZA 3NIAA 4EUVA 2J3TC 1XA7A 4R23A 4GS9A 3CHWP 5EVEA 3IWIA 1YT4A 4I3IA 1H8ZA 4HH2A 3N8SA 4GW9A 3Q1FA 3QP4A 3LICA 3IF6C 2VA0A 1WA9A 5FATA 1PRQA 3TRCA 1PW8A 4R0QA 2A24A 2XA7S 4Y0OA 3IXGA 4Q0IA 4LLOB 4WZ5A 1ZHHB 2DNSA 2OAQ1 5CRFA 3T1XA 4AFIA 1XGIA 4OLDA 4JKTA 3LI8A 1MWSA 4FD8A 4EESA 2R9XA 3FV7A 2WKRA 3IHAA 4IUHA 2VGKA 3VV4A 1LT0A 4OPZA 4KZBA 2CC1A 2M1CA 2H5SA 2WGVA 1NY0A 2XK1A 1KDWA 4Y15A 4O7DA 3D9YA 4JF4A 1YLTA 1E4DA 2L0WA 2ZM0A 4H6JB 1DJAA 3CI6A 1KVMA 3A0SA 2PYPA 3A3EA 3HLGA 1MKIA 4MBHA 3DWZA 3QP8A 5J7EA 1RP5A 4QU3A 3E4PA 2Y2HA 2O0YA 4L9EA 3OC2A 4EERA 4HNBA 2ZC7A 3ZDJA 4S2OA 4IBRA 4R3BA 4LRYC 1KGFA 1W63M 1I2SA 2JCHA 3VP4A 4WBGA 4ARZB 4RA7A 2XRNA 5CTNA 3WS4A 5GHZA 3PYPA 3O5YA 5EVID 3DTKA 4KQDA 4WM9A 3FWLA 4G3WA 4N1HA 2VKSA 1GSWA 3T1SA 3DWKA 4UQIM 3IF6A 3H9WA 3ZNYA 5KSHA 4YOFA 4X25A 1KDSA 4LCMA 1E3UA 3HLEA 5FI2A 1Y54A 3TOIA 3MFXA 4DJ3A 3V3RA 4Y3IA 1DRMA 3CMZA 2XGNA 5KZHA 3T50A 3BLMA 3WS2A 1G5UA 3H7WA 4OP8A 3M6HA 2ZQ8A 3ZG8B 4JGPA 3ITBA 2ZD8A 4GJ4A 5HPFA 4IBXA 2XDMA 3LR4A 3MMHA 3VOZA 5BOHA 3R7WB 3LY3A 3MZDA 5FQIA 1F5MA 2JKTM 5EECA 2VJWA 3G2YA 4RYEA 1H5XA 3BFCA 3DTIA 3S7QA 1GA9A 3SS3A 1OTIA 4FTXA 4MLLA 3IX4A 3KYZA 3LIDA 3B42A 2W27A 1S0WA 2W3GA 3FYZA 5FQ9A 1XFQA 4EXOA 4WLAA 2ZBBA 4LPZA 3ZQ5A 3VP2A 2L4RA 4M3KA 5GLDA 3KSIA 3K2NA 5HFOA 1FCOA 3AGDA 5EVIC 2X01A 5IS1A 3KYQA 3BY9A 4PM5A 3G30A 5FAQA 5HZHA 2XR0A 1VEUB 4I3AA 1NYMA 3SS5A 2PU2A 1DP6A 4MBFA 1PIOA 4ZJ1A 5AVFA 3W4QA 3FG8A 5AQ7A 4PAUA 3G31A 3OPLA 3G6OA 4ME4A 2GZAA 3F1NB 1VQQA 4WEKA 2O9CA 4LRZE 2H0TA 2OOLA 4ZBEA 4KZ5A 1T1CA 3KSFA 2PBYA 3IHBA 3N8LA 2E8JA 5FASA 4EBLA 2FFFB 1OMEA 4ETXA 4ZAMA 1VHMA 5FQKA 3GDIA 3RXXA 2IA2A 1L0EA 1YMSA 1LSVA 4UA6A 2PR5A 2CMNA 3S7OA 3E98A 1FILA 4EUZA 1W5DA 3IX8A 3ZCZA 2ZC5B 3BM6A 4I3JA 3IXHA 1S66L 5KIZA 4K0XA 5DKKA 4PPRA 3UPNA 3L7HA 1BULA 2H28A 4ZJ3A 3HLWA 4X69A 4HJ3A 5E43A 4YINA 2WAFA 4DE0A 1DY6A 3OCNA 4II7A 5FQJA 4KZ7A 1PW1A 1CI8A 2PT7A 1LSXA 2Z6DA 4JBFA 1IOUA 1OJ5A 5EVIA 4P85A 5FA7A 5D3OA 1P97A 4DXBA 4HEFA 2Y2NA 3IBRA 5HWVA 4S2PA 3TSGA 5A92A 4HH3A 5MC7A 2MJ6A 3RTYA 4PKYG 4B88A 2HF6A 2JN7A 5C5KA 4JLFA 4EWFA 4GZBA 4GB7A 1JTDA 4QPRA 4C75A 4BQMA 3LIAA 2UV0E 4PM8A 5HDDA 1NRFA 3QP5A 1NZOA 3UDIA 5FSRA 4HP9A 4BL2A 4DRTA 4Y0TA 3ITAA 3UE3A 2HDSA 1SDNA 5FAPA 3BRMA 1DP8A 1SCWA 4BBUA 2OV5A 2ZQDA 2P7JA 3WWXA 1OPXA 3GR2A 3Q7VB 4X1MA 4R70A 1CEFA 3ULFA 2RCXA 3NCKA 2HZ5A 1TVFA 1QMFA 2ZM8A 3PR6A 1UWPX 3T4KA 4R1GA 4MCWA 1K6RA 5CGWA 3T4SA 1HVBA 2JKRI 5DKLA 3TE8A 4NG2A 3U2AA 3OPHA 4UQIS 3T4TA 4IVIA 1VB6A 5TR7A 3NOTC 1KGEA 3ZG9B 3HREA 2I9VA 4O8GA 5FEFA 1P9RA 1IYSA 1XJ2A 4E04A 3WS5A 1Y4OA 5AVEA 5FI6A 4Q0HA 1RCJA 2RL3A 3M2JA 1YLPA 3MQQA 3ZG0A 1XJ4A 3UE0A 1G6OA 3HVFA 4MDZA 1KOUA 3LIFA 3S7NA 4PHTA 2X71A 4I38A 4XUXA 2WK0A 2J3TD 2HP6A 3DW0A 4JPMA 4HESA 4DMZA 3OOVA 5EPHA 1Z6FA 4GNUA 3PAEA 2IWCA 2PU4A 5DVAA 5FQMA 2NUPC 2B5RA 2W1TA 1TS6A 3Q82A 5DF9A 1TD5A 4XT2B 4E3KA 4CLCD 4XUZA 3LR3A 2G2UA 2ZMVA 4I39A 3CZDA 5DF8A 3UDXA 5E2EA 1XX2A 2G7UA 2VZWA 2V9AA 4EBNA 4S2LA 1IYOA 1ODVA 4G3KA 3KYEA 2EX6A 3A3DA 1XPBA 4HI4A 1H8MA 2V1AA 3F1PA 2Y2IA 2C5WB 4B93A 4GD6A 1TDLA 2X02A 2VLGA 2FFYA 1ES3A 4KG2A 3MQ0A 4OVDA 1C3BA 3MXRA 5CERA 1BLCA 1CF0A 4GCZA 3G2ZA 2J80A 1XXMA 2D02A 2WKPA 2EWWA 3HUOA 4CJNA 3PTEA 1K4FA 2V1ZA 2XF3A 1ZG6A 1XP4A 3V67A 1ERQA 3KO6A 5M19A 5G4ZA 4UHUA 1SDEA 2I72A 5GLBA 2OAP1 2Z6CA 4Y5FA 1BT5A 3K3DA 5IU1A 5E2HA 1MBLA 1NXYA 4GS9B 3T1RA 3HL9A 1U60A 5EM0A 3IBJA 4KG5A 3V3SA 1LSWA 2A24B 2FZ0A 3H82A 2VGLM 1LL9A 1Y28A 2ZOHA 1K56D 2V20A 4CLCC 2KOIA 4DE2A 1AXBA 3BWLA 1OTEA 4LRXC 1OTBA 1IYPA 1JWZA 3RXWA 3HJKA 2LB9A 5HAIA 2P9VA 2EXBA 1DJBA 2YKFA 3N4IA 3ZG5A 3VP1A 4KQQA 2J7VA 5DFXA 5CEBA 3QP1A 2J3WA 3TG9A 1TEMA 4OLGA 1VETA 2W0NA 2A3UA 1PZOA 1KE0A 4DF6A 2P08A 5F68A 4WL9A 4GOGA 4BMWA 1NYYA 3P98A 1IFQA 2WADA 5CHUA 5F5YA 5F83A 1K4EA 2NUTC 2W1RA 5FAOA 1ESUA 2WZZA 1LL8A 4Y2FA 5F82A 4FUWA 1STZA 5CGXA 4U0XA 5GLAA 4D2OA 3HJIA 1S4SA 2EX8A 5FQQA 2VV6A 2GX5A 1YLZA 5L2FA 3OPPA 4QY5A 3S7PA 3T4LA 4HBUA 3IF6B 4LCLA 1MC0A 1L2SA 4GHIA 5K5BA 4HP4A 3UB8A 5TBMA 4R3JA 2IWBA 3JYIA 4UA7A 1N9OA 4CLCA 1PZPA 3MF0A 4WMCA 4PM6A 3IX3A 3DAVA 4ZTKA 2DMWA 3H7WB 1N4OA 2H0YA 3EGXC 2ZC4B 4JXVA 1NLZA 2WAEA 4UA9A 3EQUA 2QZ6A 4S2JA 5CXWA 1S1YA 3PBTA 3NHQA 2Q9MA 4EEUA 1FR1A 3LCEA 3MS6A 1SKOA 3W8KA 3O3VA 1ZTUA 2QKPA 4C6YA 4OQHA 4P87A 1TS8A 1VM1A 3P7NA 1BUEA 3B33A 2XH9A 2PHYA 3FPWA 2KLIA 5EV0A 4FH2A 1EW0A 1EI5A 1ES4A 3MJQA 1PI5A 1RGYA 2XLNA 1FR6A 3ZYTA 3U4LP 2BTFP 3M6BA 3PBNA 3KSGA 2ZL1A 2JKRM 1HTZA 3N7WA 5G18A 2WGWA 4QWOA 4YFMA 4C3QA 3G32A 1HD8A
chains in the Genus database with same CATH topology
4QPRA 4OOLA 3LIAA 1V9ZA 3HCYA 5HDDA 2QYBA 2HJEA 2VX8A 4HP9A 3VE4A 3NJAA 4MMNA 4WN5A 3CITA 2O9AA 2M7VA 3UE3A 3C8CA 1DP8A 3FC7A 4F3LB 3RH8B 4BBUA 4CLCE 4DJ2A 1TS7A 1UWNX 2P7JA 4GLQA 4MN6A 4YWZA 1OPXA 4RQ9A 2PDRA 1GSVA 1S1ZA 4R70A 3JVVA 4GHIB 3ULFA 4ARZA 4WELA 5TBMB 1F98A 3B47A 3A0VA 4EU0A 4BWIA 1JNUA 3PR6A 3ICYA 3CLOA 1UWPX 4PKYA 4YNRA 4CLCB 3T4KA 4HHDA 5DJTA 2V1BA 3E4OA 4MCWA 5HD3A 5G4YA 3T4SA 3EWKA 1YKDA 2HV1A 2B18A 2JKRI 2A2LA 2QJ7A 1D06A 5DKLA 3TE8A 1YSPA 2QJ5A 3CWFA 3U2AA 4UQIS 3T4TA 2VEAA 1VB6A 3UMEA 4EQ1A 3CAXA 5I5LA 3NOTC 4P6ZS 2PD7A 4JGOA 2I9VA 3PXPA 4WF0A 5DJUA 3D72A 4ETZA 4O8GA 4EUVA 2J3TC 1P9RA 1XJ2A 4BBVA 4GS9A 3K3CA 4E04A 3BJNA 5AVEA 2Y8HA 3F1OA 4I3IA 4Q0HA 4HH2A 3OLOA 1S67L 4GW9A 3MQQA 3LR0A 3LICA 2VA0A 1OJGA 3EOIA 4NEED 1XJ4A 1G6OA 1WA9A 3TRCA 3KSHA 4MDZA 2A24A 2QHKA 2XA7S 2VGLS 1KOUA 4Q0IA 4LLOB 1ZHHB 4IHQA 4ZRRA 3LIFA 2OAQ1 4AFIA 3JVUA 1TF1A 3S7NA 4K08A 4O0PA 4PHTA 3UB6A 4I38A 2JHEA 2ZOIA 3LI8A 2J3TD 5F69A 2M7UA 3T4JA 4EESA 4DMZA 2WKRA 3R7WA 4IUHA 3C30A 3OOVA 5FL3A 1GSXA 3VV4A 5HL6A 1LT0A 3NOUC 3D3OA 1MZUA 4H6JA 2M1CA 1OTDA 1OTAA 2NUPC 2W1TA 4HOIA 1TS6A 2R78A 5DF9A 1TD5A 4XT2B 4DN0A 3KX0X 2P04A 5EFWA 2L0WA 3CUEC 3CI6A 4H6JB 4CLCD 4IJGA 3TW8A 3LR3A 3A0SA 2ZMVA 2PYPA 4IUKA 2GJ3A 2W3FA 4EETB 2GNXA 4WUJA 4I39A 2VV8A 5J7EA 2L1MA 4B9OA 3E4PA 2VZWA 2G7UA 2V9AA 2O0YA 1ODVA 4G3KA 3W2ZA 4L9EA 3OC2A 4EERA 4HNBA 4HI4A 4Q0JA 1H8MA 4UEYA 4MN5A 2V1AA 3F1PA 3IS2A 2BASA 1H3QA 4B93A 4LRYC 1W63M 2VLGA 4ARZB 2XRNA 2FH5A 4M4XA 3MQ0A 4OOMA 2XSSA 3PYPA 3O5YA 3MQOA 4GCZA 2J80A 4MN7A 1G28A 2JKTI 2D02A 2VV7A 4KQDA 2W3HA 2WKPA 2EWWA 3UB7A 3F1NA 1NWZA 3T4OA 4KQOA 4G3WA 2VKSA 5LBRA 1GSWA 3EGDC 3E4QA 3V67A 4UQIM 2OWHA 3H9WA 3KO6A 3UB9A 5KSHA 5G4ZA 2ZMFA 4P6ZM 4YOFA 1MKMA 2OAP1 2Z6CA 3EQVA 3LFVA 1OT6A 3OBFA 3MFXA 4Y5FA 3K3DA 5IU1A 4DJ3A 4Y3IA 1DRMA 4GS9B 3C38A 3T50A 3GECA 1XJ3A 1YSQA 3DBAA 3F1OB 5DFYA 4HY8A 3H7WA 3IBJA 1N9NA 5CX7A 4R38A 2WKQA 1LSWA 5HWTA 1DP9A 2V0WA 3UE6A 2A24B 3PHYA 4JGPA 2FZ0A 3H82A 2XA7M 4GJ4A 2VGLM 5HPFA 1TS0A 1Y28A 5L8MA 2ZOHA 4CLCC 3CUEA 3LR4A 2KOIA 5IT5A 3MMHA 2O99A 1XFNA 2KDKA 3R7WB 3BWLA 1OTEA 4LRXC 1F5MA 1OTBA 4NXEA 2JKTM 2VJWA 4CQHA 1S4RA 4Z1WA 3HJKA 2LB9A 3S7QA 1F9IA 1OTIA 2W1TB 5HWWA 1W63Q 2YKFA 3KYZA 3LIDA 3B42A 2W27A 2W3GA 5DFXA 1XFQA 3VE3A 1T1AA 2PYRA 4WLAA 2J3WA 4EXOA 3A0RA 2EA9A 2Y79A 1N9LA 2ZBBA 3LUQA 5HSQA 2YKHA 4LPZA 3ZQ5A 2W0NA 1UGUA 3BQAA 2L4RA 5HDSA 2P08A 2XROA 5F68A 3KSIA 3K2NA 3MXQA 5IS1A 3KYQA 3BY9A 3F1PB 4WL9A 3IS2B 5HZHA 5HD5A 4BMWA 1T18A 4NXBA 4I3AA 2QWSA 3E0YA 1IFQA 4NXFA 1DP6A 4L9FA 5F5YA 2HGVA 2LB5A 5AVFA 1YAXA 2NUTC 2W1RA 3PBOA 3FG8A 1LL8A 4Y2FA 5A8BA 1STZA 4PAUA 1D7EA 4I5SA 3G6OA 4ME4A 5TJJA 3HJIA 5J4EA 1S4SA 2GZAA 3F1NB 4F3LA 4WEKA 2O9CA 2VV6A 4LRZE 3EEHA 2GX5A 5F6AA 4R6LA 2OOLA 2K7SA 1T1CA 3S7PA 3T4LA 3KSFA 1MC0A 4GHIA 5K5BA 3LIEA 4HP4A 5TBMA 3UB8A 3LIBA 3SW1A 4ETXA 4BJPA 4FSFA 1VHMA 3BW6A 3GDIA 1N9OA 1P9WA 2IA2A 2B02A 4CLCA 1LSVA 3MF0A 2KX6A 2PR5A 2CMNA 3S7OA 2INWA 3E98A 4KUKA 2DMWA 3H7WB 3UMDA 1T1BA 4G3VA 3NOPC 3EGXC 3BY8A 1P0ZA 3BQ8A 3T4QA 3LR5A 1NLZA 4I3JA 1S66L 4HQAA 4EW7A 3EQUA 5KIZA 3H82B 1S1YA 3PBTA 2EWVA 3RFBA 5DKKA 3LYXA 3NHQA 4EEUA 1X0OA 2D01A 4R3AA 3MR0A 1T19A 2K31A 1ZTUA 2QKPA 4KUOA 2H28A 4HJ3A 3PBQA 5AJGA 2K2NA 4JGQA 3OCNA 1TS8A 2W3DA 3P7NA 2W3EA 3B33A 1XJ6A 4II7A 2O9BA 4JGRA 2PHYA 3FPWA 2PT7A 3R4KA 1LSXA 2KLIA 2Z6DA 1IOUA 1OJ5A 4EEPA 1EW0A 4FOFA 4L9GA 1OT9A 4HJ6A 1P97A 3MJQA 3OCLA 4O01A 3FPVA 3TJZC 1NRJA 3ZYTA 3IBRA 5HWVA 1NLYA 4HH3A 1V9YA 4L0LA 3VOLA 2MJ6A 3LI9A 5MC7A 2HJ9C 4BBTA 3RTYA 3PBRA 4PKYG 3PBNA 2OWJA 3KSGA 5HDCA 2V0UA 2HF6A 2JKRM 3C2WA 2JN7A 4HIAA 2PR6A 3P01A 4WEJA 5J3WA 5C5KA 4NXGA 3PBSA 1BYWA 5HPIA 4HJ4A 4NKPA 4XT2A 2PD8A 3EEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIA A;  1V9Z A;  5HDD A;  4HP9 A;  3VE4 A;  3NJA A;  4WN5 A;  3C8C A;  1DP8 A;  3FC7 A;  4F3L B;  3RH8 B;  4BBU A;  4DJ2 A;  1TS7 A;  1UWN X;  2P7J A;  4MN6 A;  4YWZ A;  4RQ9 A;  2PDR A;  1GSV A;  1S1Z A;  4R70 A;  4GHI B;  3ULF A;  5TBM B;  1F98 A;  3A0V A;  1JNU A;  3ICY A;  3CLO A;  1UWP X;  4PKY A;  4HHD A;  5DJT A;  2V1B A;  3E4O A;  5HD3 A;  5G4Y A;  3EWK A;  2HV1 A;  2QJ7 A;  1D06 A;  5DKL A;  2QJ5 A;  3CWF A;  2VEA A;  1VB6 A;  3UME A;  4EQ1 A;  3CAX A;  5I5L A;  3NOT C;  2PD7 A;  4JGO A;  2I9V A;  4WF0 A;  5DJU A;  3D72 A;  1XJ2 A;  4BBV A;  4GS9 A;  3K3C A;  4E04 A;  5AVE A;  3F1O A;  4I3I A;  4HH2 A;  3OLO A;  1S67 L;  4GW9 A;  3MQQ A;  3LIC A;  1OJG A;  1XJ4 A;  1WA9 A;  2A24 A;  2QHK A;  1KOU A;  4LLO B;  3LIF A;  3UB6 A;  4K08 A;  4I38 A;  2ZOI A;  2JHE A;  3LI8 A;  5F69 A;  4EES A;  2WKR A;  1GSX A;  1LT0 A;  3NOU C;  1MZU A;  2M1C A;  1OTD A;  1OTA A;  4HOI A;  1TS6 A;  2R78 A;  4XT2 B;  3KX0 X;  5EFW A;  2L0W A;  4H6J B;  3A0S A;  2PYP A;  2GJ3 A;  4EET B;  4WUJ A;  4I39 A;  2VV8 A;  5J7E A;  2L1M A;  4B9O A;  3E4P A;  2V9A A;  1ODV A;  4L9E A;  4EER A;  4HNB A;  4HI4 A;  4MN5 A;  2V1A A;  3F1P A;  3IS2 A;  2BAS A;  4LRY C;  2VLG A;  4M4X A;  3PYP A;  3MQO A;  4GCZ A;  2J80 A;  1G28 A;  2D02 A;  2VV7 A;  4KQD A;  2WKP A;  3UB7 A;  3F1N A;  1NWZ A;  1GSW A;  3E4Q A;  2OWH A;  3H9W A;  3UB9 A;  5G4Z A;  2Z6C A;  1OT6 A;  3MFX A;  3K3D A;  5IU1 A;  4DJ3 A;  1DRM A;  4GS9 B;  3T50 A;  3GEC A;  1XJ3 A;  3F1O B;  4HY8 A;  3H7W A;  1N9N A;  4R38 A;  2WKQ A;  1LSW A;  5HWT A;  1DP9 A;  2V0W A;  3UE6 A;  2A24 B;  3PHY A;  4JGP A;  3H82 A;  2PD8 A;  1TS0 A;  1Y28 A;  2ZOH A;  1XFN A;  2KDK A;  3BWL A;  1OTE A;  4LRX C;  1OTB A;  4NXE A;  1S4R A;  3HJK A;  1F9I A;  1OTI A;  5HWW A;  2YKF A;  3LID A;  2W27 A;  1XFQ A;  3VE3 A;  1T1A A;  2PYR A;  4WLA A;  4EXO A;  3A0R A;  2EA9 A;  1N9L A;  2ZBB A;  3LUQ A;  5HSQ A;  2YKH A;  4LPZ A;  3ZQ5 A;  2W0N A;  1UGU A;  2L4R A;  5HDS A;  5F68 A;  5IS1 A;  3BY9 A;  3F1P B;  4WL9 A;  3IS2 B;  5HZH A;  5HD5 A;  1T18 A;  4NXB A;  4I3A A;  2QWS A;  4NXF A;  1DP6 A;  4L9F A;  5F5Y A;  5AVF A;  3FG8 A;  1LL8 A;  5A8B A;  1D7E A;  4I5S A;  3G6O A;  3HJI A;  5J4E A;  1S4S A;  3F1N B;  4F3L A;  4LRZ E;  5F6A A;  2VV6 A;  3EEH A;  4R6L A;  2OOL A;  2K7S A;  1T1C A;  4GHI A;  3LIE A;  4HP4 A;  5TBM A;  3UB8 A;  3LIB A;  3SW1 A;  3GDI A;  1N9O A;  2B02 A;  1LSV A;  2KX6 A;  2PR5 A;  2CMN A;  2INW A;  4KUK A;  3H7W B;  3UMD A;  1T1B A;  3NOP C;  3BY8 A;  1P0Z A;  4I3J A;  1S66 L;  4HQA A;  4EW7 A;  5KIZ A;  3H82 B;  1S1Y A;  5DKK A;  3LYX A;  3NHQ A;  4EEU A;  1X0O A;  2D01 A;  4R3A A;  3MR0 A;  1T19 A;  2QKP A;  4KUO A;  2H28 A;  4HJ3 A;  4JGQ A;  1TS8 A;  3P7N A;  3B33 A;  1XJ6 A;  4JGR A;  2PHY A;  1LSX A;  2Z6D A;  1OJ5 A;  4EEP A;  1EW0 A;  4L9G A;  1OT9 A;  4HJ6 A;  1P97 A;  3MJQ A;  3IBR A;  5HWV A;  4HH3 A;  1V9Y A;  3VOL A;  3LI9 A;  4BBT A;  3RTY A;  4PKY G;  2OWJ A;  5HDC A;  2V0U A;  3C2W A;  2JN7 A;  4HIA A;  2PR6 A;  5J3W A;  4NXG A;  1BYW A;  4HJ4 A;  4XT2 A;  3MXQ A;  4H6J A; 
#chains in the Genus database with same CATH topology
 1W8Q A;  5M1A A;  3HCY A;  3WS0 A;  2HP5 A;  1ES5 A;  3C7U A;  3IF5 A;  4OPR A;  4MMN A;  1K56 A;  2G2W A;  1Q2Q A;  3Q7Z A;  3ZG7 B;  3QNC A;  4DE1 A;  5DF7 A;  2Z2L B;  1UWN X;  4S2N C;  3ZVW A;  4MN6 A;  2H10 A;  1MWR A;  4YWZ A;  1XA1 A;  4X53 A;  1ERM A;  3B47 A;  3A0V A;  4BWI A;  3BFD A;  4X56 A;  1CEG A;  1WYB A;  3CPT A;  2ZQC A;  4HHD A;  5HD3 A;  2WKI A;  5G4Y A;  2Z2M B;  2QJ7 A;  3SH8 A;  1YSP A;  4OQI A;  4S2K A;  3MKF A;  2J9O A;  4EQ1 A;  3CAX A;  3S1Y A;  2BG1 A;  2PD7 A;  4JGO A;  1YLY A;  4P6B A;  2QMI A;  5DJU A;  4RX3 A;  2Y2K A;  2EXA A;  5HAQ A;  2Y8H A;  3F1O A;  1JWP A;  1D1J A;  1O7E A;  3GMW A;  4R4R A;  3OLO A;  1K0K A;  1N9B A;  3LR0 A;  3EOI A;  1OJG A;  4NEE D;  1LI0 A;  1SZV A;  3WS1 A;  5EVI B;  3SH9 A;  2OSU A;  3IWO A;  3NC8 A;  1L0D A;  4LV1 A;  2VGL S;  1CI9 A;  4ZRR A;  1ACF A;  2Q9N A;  2Y59 A;  1TF1 A;  4O0P A;  4DDY A;  2JKF A;  2WUQ A;  5FL3 A;  1GSX A;  4MNR A;  1MZU A;  2ZC3 B;  5JYO A;  2BLS A;  4HOI A;  5EFW A;  2VK3 A;  4S2N A;  4GDB A;  2PRF A;  1ZG4 A;  2Y2P A;  3BFG A;  5CGS A;  4IUK A;  2GJ3 A;  5KSC A;  4E3I A;  4EET B;  2GNX A;  1NZU A;  4WUJ A;  2VV8 A;  3VFF A;  2L1M A;  3HLF A;  3W2Z A;  1JWV A;  3VFH A;  3IS2 A;  2BAS A;  4JXS A;  1H3Q A;  3HLD A;  3N6I A;  3DTM A;  4LV0 A;  1WE4 A;  2FH5 A;  4M4X A;  1KE3 A;  4OOM A;  4OH0 A;  3MQO A;  3JPU A;  3GVB A;  3MBZ A;  4MN7 A;  1G28 A;  2JKT I;  2EX2 A;  1HLU P;  5FEG A;  3B3X A;  3Q81 A;  1O07 A;  3UB7 A;  4GD8 A;  3T4O A;  5LBR A;  5HW3 A;  2Y2Q A;  3EGD C;  3E4Q A;  1EWZ A;  3UB9 A;  2ZMF A;  2A49 A;  3IXD A;  1MWT A;  3EQV A;  1OT6 A;  4A5R A;  4XXR A;  1PI4 A;  3C38 A;  3UB5 P;  1SHV A;  1XJ3 A;  3LY4 A;  1YSQ A;  3DBA A;  4HY8 A;  1GHP A;  4PM9 A;  4F94 A;  4QB8 A;  1N9N A;  2AVX A;  2WKQ A;  3G4P A;  3MZE A;  4JXW A;  4B4Z A;  3UE6 A;  3N8R A;  4OPY A;  3C4P A;  3D4F A;  1IEL A;  5IT5 A;  2O99 A;  2ZM2 A;  4OKP A;  2KDK A;  3NUL A;  4DXC A;  4NXE A;  1HZO A;  2XEP A;  4CQH A;  1PNE A;  5JYP A;  2W1T B;  4DKI A;  5HWW A;  1BLS A;  3E2L A;  4OOY A;  4Q8I A;  2JKG A;  4U3T A;  1T1A A;  4Y13 A;  1ZC2 A;  3GSG A;  4KZ9 A;  4WMC D;  3V50 A;  3Q07 A;  4RVA A;  2EA9 A;  2Y79 A;  5HSQ A;  4LV3 A;  1UGU A;  1NJ4 A;  5EOE A;  2XFS A;  5E2F A;  2HDR A;  2VGJ A;  3F1P B;  5HD5 A;  1GCE A;  2DCF A;  1T18 A;  4NXB A;  3C7V A;  2QWS A;  3GV9 A;  4S2M A;  3IH9 A;  2HGV A;  3MSH A;  1YAX A;  4Z9Q A;  1CJF A;  3PBO A;  2WKE A;  4NET A;  5F1G A;  3RJU A;  1D7E A;  4I5S A;  5TJJ A;  4F3L A;  5F6A A;  2Y2O A;  4R6L A;  1CQA A;  2K7S A;  5DTK A;  4ESP A;  3WRZ A;  3LIE A;  2P74 A;  3LIB A;  3W4P A;  3SW1 A;  1K54 C;  1G6A A;  4FSF A;  3BW6 A;  1P9W A;  5GHX A;  5FI7 A;  3A3J A;  2B02 A;  1BLH A;  3LO7 A;  4OQG A;  3UPP A;  2INW A;  3VSL A;  1S6R A;  2PBD P;  2WZX A;  1T1B A;  4G3V A;  3NOP C;  3T4Q A;  3LR5 A;  2WKH A;  3T1Q B;  5A91 A;  3H82 B;  5M18 A;  5DTT A;  4N9L A;  2UWX A;  2EWV A;  5GLC A;  3RFB A;  3LYX A;  1X0O A;  3LGO A;  1FCN A;  2D01 A;  3QP6 A;  3HLC A;  4KUO A;  5L07 A;  3PBQ A;  2K2N A;  2Y91 A;  1WYC A;  2W3D A;  4MEZ A;  3R4K A;  2P9V B;  5FDS A;  3FKV A;  4EEP A;  4FOF A;  1ES2 A;  4U0T A;  2ZQA A;  3NBL A;  4HJ6 A;  4KZA A;  4PMA A;  1YLJ A;  4O01 A;  4BD0 A;  1KVL A;  3FPV A;  5HL1 A;  4ZDX A;  1V9Y A;  4L0L A;  1IKG A;  1K38 A;  2HJ9 C;  2PAV P;  3VP0 A;  4BBT A;  3PBR A;  1F2K A;  1VET B;  4OP5 A;  1W7F A;  4K91 A;  2V0U A;  1Z09 A;  1GHI A;  4HIA A;  3P01 A;  3MXS A;  1ESI A;  1PWG A;  2V2F F;  3PBS A;  5A93 A;  4NKP A;  5L10 A;  4X6T A;  4H6J A;  2HPB A;  3VSK A;  4K0W A;  3GQZ A;  5HAR A;  5IHV A;  1ONH A;  1M6K A;  2HJE A;  2Y55 A;  2VX8 A;  1BZA A;  3UDF A;  1K54 A;  2IWD A;  3UPO A;  1GA0 A;  3O87 A;  4WN5 A;  3VP3 A;  3CIT A;  1MWU A;  4LGW A;  2M7V A;  1J3W A;  3C8C A;  1M40 A;  1H8Y A;  4DJ2 A;  1LI9 A;  4GLQ A;  4RQ9 A;  2PDR A;  2EFU A;  5TGF A;  1S1Z A;  3JVV A;  4GHI B;  4ARZ A;  4JF5 A;  4WEL A;  5TBM B;  1F98 A;  1LL5 A;  1YLW A;  3T12 B;  4N9K A;  3ZGA B;  5CEC A;  2B95 A;  1JNU A;  3ICY A;  3CLO A;  4PKY A;  4CLC B;  5AQB A;  3E4O A;  3MFD A;  1YKD A;  2B18 A;  4E6X A;  3BLS A;  2A2L A;  3QHY A;  3CWF A;  5CHM A;  3ISG A;  5A90 A;  1JTG A;  4KG6 A;  4QHC A;  5AQ9 A;  4QD4 A;  4QY6 A;  1SKO B;  4B4X A;  3PXP A;  4WF0 A;  4NK3 A;  4IVK A;  1L0F A;  4BBV A;  3K3C A;  4OON A;  3BJN A;  2ZMA A;  1S67 L;  3BFE A;  4S2I A;  5L09 A;  3KSH A;  4OQ0 A;  4Y0U A;  3A3I A;  2QHK A;  4LFU A;  4IHQ A;  4BLM A;  5EVL A;  3JVU A;  1E25 A;  4K08 A;  3UB6 A;  2JHE A;  2ZOI A;  2M7U A;  5F69 A;  2DRW A;  3T4J A;  4X55 A;  3R7W A;  1XKZ A;  3C30 A;  2Q0O A;  5CHJ A;  5HL6 A;  3NOU C;  2ZL1 B;  3D3O A;  1ZKJ A;  2E8I A;  5TFQ A;  1OTD A;  1OTA A;  4RX2 A;  2WGW B;  2R78 A;  3UE1 A;  3V39 A;  4DN0 A;  3KX0 X;  2P04 A;  2OLV A;  2J8Y A;  4KZ6 A;  3CUE C;  3UNW A;  4IJG A;  3TW8 A;  3AGF A;  1K25 A;  1YPR A;  3ZFZ A;  4E3N A;  1BLP A;  2W3F A;  3AGE A;  4KZ8 A;  4B9O A;  1FSW A;  1IKI A;  1ALQ A;  1G68 A;  1PWC A;  2XD1 A;  3NY4 A;  4Q0J A;  4UEY A;  2XD5 A;  1FIK A;  4MN5 A;  1AWI A;  4EBP A;  1VEU A;  4BEN A;  4GDN A;  2XSS A;  3CPT B;  1FSY A;  1PFL A;  2JBF A;  2XQZ A;  5GHY A;  3M2K A;  3LEQ A;  2VV7 A;  1XGJ A;  2W3H A;  2HDQ A;  3F1N A;  1NWZ A;  3CJM A;  4KQO A;  3S4X A;  2R9W A;  2ACG A;  4R4S A;  4MBK A;  2ZJ9 A;  2OWH A;  1CK3 A;  4DDS A;  5F1F A;  4P6Z M;  1MKM A;  1K55 C;  1KGG A;  3LFV A;  2ZQ7 A;  2Y2G A;  3OBF A;  2Y2L A;  2C6W B;  5AQA A;  3L9K A;  3GEC A;  4KQR A;  2JE5 A;  3C5A A;  3F1O B;  5DFY A;  1BTL A;  2HDU A;  5CX7 A;  1K57 C;  3NDG A;  4R38 A;  4KZ4 A;  5HWT A;  1DP9 A;  2V0W A;  3PHY A;  4GN2 A;  2XA7 M;  1I5Q A;  1TS0 A;  5L8M A;  2OLU A;  3CUE A;  1XFN A;  4LV2 A;  3VMA A;  3VOY A;  1KE4 A;  1L0G A;  2J9P A;  2GDN A;  1S4R A;  4Z1W A;  4WYY A;  3V5M A;  1F9I A;  1IEM A;  3IQA A;  2WYX A;  3ZNT A;  1W63 Q;  4UAA A;  3O86 A;  3SH7 A;  3IH8 A;  3VE3 A;  3HLB A;  3I7J A;  2PYR A;  1Q2P A;  3A0R A;  3BEB A;  3LEZ A;  2Y2M A;  1N9L A;  3LUQ A;  2YKH A;  1DJC A;  3BQA A;  5HDS A;  2XRO A;  3BYD A;  5J8X A;  4FH4 A;  5E2G A;  4FCF A;  1H0M A;  3GTC A;  3IS2 B;  1YMX A;  2V8C A;  3E0Y A;  3FKW A;  4NXF A;  4L9F A;  2LB5 A;  2XFT A;  2ZC6 B;  4Y7P A;  3GRJ A;  4IED A;  3BFF A;  3IT9 A;  5A8B A;  1K55 A;  2V8F A;  4WZ4 A;  3QP2 A;  4OPQ A;  1LLB A;  2HP9 A;  5J4E A;  4ZJ2 A;  3C4O A;  3CG5 A;  5FDH A;  3EEH A;  3FZC A;  4E3O A;  4EQI A;  4EV4 A;  1K57 A;  1K6S A;  3OZH A;  4BL3 A;  3Q7V A;  1LHY A;  4BJP A;  2EFX A;  3IWQ A;  1W79 A;  1BSG A;  3G35 A;  2KX6 A;  3MKE A;  4E6W A;  3NI9 A;  4E3M A;  2JC7 A;  1FCM A;  1L3L A;  4KUK A;  1YM1 A;  4P0M A;  3UMD A;  2ZQ9 A;  3BY8 A;  1P0Z A;  3NEC A;  1ONG A;  1W8Y A;  3BQ8 A;  5I94 A;  1JVJ A;  3UO9 A;  3SS4 A;  4N1X A;  4QJG A;  4HQA A;  4EW7 A;  3UN7 A;  4E3L A;  5CED A;  3O88 A;  1ERO A;  4R3A A;  3MR0 A;  1J9M A;  1T19 A;  4JXG A;  2K31 A;  4DE3 A;  3WRT A;  4GKU A;  5EOO A;  5AJG A;  1IYQ A;  4JGQ A;  3UY6 A;  3E2K A;  2W3E A;  1XJ6 A;  2O9B A;  4JGR A;  4KEN B;  4L9G A;  1OT9 A;  3A3F A;  3OCL A;  4KZ3 A;  1FOF A;  3S22 A;  2ZLY A;  1I2W A;  3TJZ C;  2Y4A A;  1NRJ A;  3HUM A;  4D60 A;  1NLY A;  1YQS A;  3VOL A;  3LI9 A;  5EM1 A;  4ID4 A;  3SZT A;  2OWJ A;  1PWD A;  5HDC A;  5EUA A;  3C2W A;  3SOI A;  3BEC A;  5EE8 A;  2PR6 A;  4WEJ A;  5J3W A;  4NXG A;  1RGZ A;  1BYW A;  1E3U D;  4LEN A;  5HPI A;  4WZ5 C;  4HJ4 A;  4XT2 A;  2WGI A;  3MXQ A;  2PD8 A;  4CPK A;  5HX9 A;  3EEA A;  3HBR A;  4OOL A;  1V9Z A;  4HBT A;  2QYB A;  1GHM A;  5DTS A;  1PYY A;  1MPL A;  4X68 A;  3VE4 A;  3NJA A;  1QME A;  3HUN A;  2O9A A;  3P09 A;  3IXB A;  3FC7 A;  4F3L B;  3ZHH A;  2EX9 A;  3RH8 B;  4CLC E;  1TS7 A;  3MZF A;  4E3J A;  3ZVT A;  5CTM A;  2Y2J A;  1GSV A;  3G34 A;  4N92 A;  1A0K A;  4EU0 A;  4X1L A;  3QNB A;  1MY8 A;  4YNR A;  4Y17 A;  1TDG A;  1FQG A;  5GL9 A;  5HAP A;  3NDE A;  5DJT A;  2V1B A;  3DTE A;  3W4O A;  3EWK A;  2HV1 A;  3OPR A;  4BD1 A;  1D06 A;  2QPN A;  4H8R A;  2QJ5 A;  4PM7 A;  4JF6 A;  2VEA A;  1MXO A;  3UME A;  5U47 A;  5I5L A;  4P6Z S;  1SKF A;  5KMW A;  3PAG A;  3D72 A;  4ETZ A;  3NIA A;  4EUV A;  2J3T C;  1XA7 A;  4R23 A;  4GS9 A;  3CHW P;  5EVE A;  3IWI A;  1YT4 A;  4I3I A;  1H8Z A;  4HH2 A;  3N8S A;  4GW9 A;  3Q1F A;  3QP4 A;  3LIC A;  3IF6 C;  2VA0 A;  1WA9 A;  5FAT A;  1PRQ A;  3TRC A;  1PW8 A;  4R0Q A;  2A24 A;  2XA7 S;  4Y0O A;  3IXG A;  4Q0I A;  4LLO B;  4WZ5 A;  1ZHH B;  2DNS A;  2OAQ 1;  5CRF A;  3T1X A;  4AFI A;  1XGI A;  4OLD A;  4JKT A;  3LI8 A;  1MWS A;  4FD8 A;  4EES A;  2R9X A;  3FV7 A;  2WKR A;  3IHA A;  4IUH A;  2VGK A;  3VV4 A;  1LT0 A;  4OPZ A;  4KZB A;  2CC1 A;  2M1C A;  2H5S A;  2WGV A;  1NY0 A;  2XK1 A;  1KDW A;  4Y15 A;  4O7D A;  3D9Y A;  4JF4 A;  1YLT A;  1E4D A;  2L0W A;  2ZM0 A;  4H6J B;  1DJA A;  3CI6 A;  1KVM A;  3A0S A;  2PYP A;  3A3E A;  3HLG A;  1MKI A;  4MBH A;  3DWZ A;  3QP8 A;  5J7E A;  1RP5 A;  4QU3 A;  3E4P A;  2Y2H A;  2O0Y A;  4L9E A;  3OC2 A;  4EER A;  4HNB A;  2ZC7 A;  3ZDJ A;  4S2O A;  4IBR A;  4R3B A;  4LRY C;  1KGF A;  1W63 M;  1I2S A;  2JCH A;  3VP4 A;  4WBG A;  4ARZ B;  4RA7 A;  2XRN A;  5CTN A;  3WS4 A;  5GHZ A;  3PYP A;  3O5Y A;  5EVI D;  3DTK A;  4KQD A;  4WM9 A;  3FWL A;  4G3W A;  4N1H A;  2VKS A;  1GSW A;  3T1S A;  3DWK A;  4UQI M;  3IF6 A;  3H9W A;  3ZNY A;  5KSH A;  4YOF A;  4X25 A;  1KDS A;  4LCM A;  1E3U A;  3HLE A;  5FI2 A;  1Y54 A;  3TOI A;  3MFX A;  4DJ3 A;  3V3R A;  4Y3I A;  1DRM A;  3CMZ A;  2XGN A;  5KZH A;  3T50 A;  3BLM A;  3WS2 A;  1G5U A;  3H7W A;  4OP8 A;  3M6H A;  2ZQ8 A;  3ZG8 B;  4JGP A;  3ITB A;  2ZD8 A;  4GJ4 A;  5HPF A;  4IBX A;  2XDM A;  3LR4 A;  3MMH A;  3VOZ A;  5BOH A;  3R7W B;  3LY3 A;  3MZD A;  5FQI A;  1F5M A;  2JKT M;  5EEC A;  2VJW A;  3G2Y A;  4RYE A;  1H5X A;  3BFC A;  3DTI A;  3S7Q A;  1GA9 A;  3SS3 A;  1OTI A;  4FTX A;  4MLL A;  3IX4 A;  3KYZ A;  3LID A;  3B42 A;  2W27 A;  1S0W A;  2W3G A;  3FYZ A;  5FQ9 A;  1XFQ A;  4EXO A;  4WLA A;  2ZBB A;  4LPZ A;  3ZQ5 A;  3VP2 A;  2L4R A;  4M3K A;  5GLD A;  3KSI A;  3K2N A;  5HFO A;  1FCO A;  3AGD A;  5EVI C;  2X01 A;  5IS1 A;  3KYQ A;  3BY9 A;  4PM5 A;  3G30 A;  5FAQ A;  5HZH A;  2XR0 A;  1VEU B;  4I3A A;  1NYM A;  3SS5 A;  2PU2 A;  1DP6 A;  4MBF A;  1PIO A;  4ZJ1 A;  5AVF A;  3W4Q A;  3FG8 A;  5AQ7 A;  4PAU A;  3G31 A;  3OPL A;  3G6O A;  4ME4 A;  2GZA A;  3F1N B;  1VQQ A;  4WEK A;  2O9C A;  4LRZ E;  2H0T A;  2OOL A;  4ZBE A;  4KZ5 A;  1T1C A;  3KSF A;  2PBY A;  3IHB A;  3N8L A;  2E8J A;  5FAS A;  4EBL A;  2FFF B;  1OME A;  4ETX A;  4ZAM A;  1VHM A;  5FQK A;  3GDI A;  3RXX A;  2IA2 A;  1L0E A;  1YMS A;  1LSV A;  4UA6 A;  2PR5 A;  2CMN A;  3S7O A;  3E98 A;  1FIL A;  4EUZ A;  1W5D A;  3IX8 A;  3ZCZ A;  2ZC5 B;  3BM6 A;  4I3J A;  3IXH A;  1S66 L;  5KIZ A;  4K0X A;  5DKK A;  4PPR A;  3UPN A;  3L7H A;  1BUL A;  2H28 A;  4ZJ3 A;  3HLW A;  4X69 A;  4HJ3 A;  5E43 A;  4YIN A;  2WAF A;  4DE0 A;  1DY6 A;  3OCN A;  4II7 A;  5FQJ A;  4KZ7 A;  1PW1 A;  1CI8 A;  2PT7 A;  1LSX A;  2Z6D A;  4JBF A;  1IOU A;  1OJ5 A;  5EVI A;  4P85 A;  5FA7 A;  5D3O A;  1P97 A;  4DXB A;  4HEF A;  2Y2N A;  3IBR A;  5HWV A;  4S2P A;  3TSG A;  5A92 A;  4HH3 A;  5MC7 A;  2MJ6 A;  3RTY A;  4PKY G;  4B88 A;  2HF6 A;  2JN7 A;  5C5K A;  4JLF A;  4EWF A;  4GZB A;  4GB7 A;  1JTD A;  4QPR A;  4C75 A;  4BQM A;  3LIA A;  2UV0 E;  4PM8 A;  5HDD A;  1NRF A;  3QP5 A;  1NZO A;  3UDI A;  5FSR A;  4HP9 A;  4BL2 A;  4DRT A;  4Y0T A;  3ITA A;  3UE3 A;  2HDS A;  1SDN A;  5FAP A;  3BRM A;  1DP8 A;  1SCW A;  4BBU A;  2OV5 A;  2ZQD A;  2P7J A;  3WWX A;  1OPX A;  3GR2 A;  3Q7V B;  4X1M A;  4R70 A;  1CEF A;  3ULF A;  2RCX A;  3NCK A;  2HZ5 A;  1TVF A;  1QMF A;  2ZM8 A;  3PR6 A;  1UWP X;  3T4K A;  4R1G A;  4MCW A;  1K6R A;  5CGW A;  3T4S A;  1HVB A;  2JKR I;  5DKL A;  3TE8 A;  4NG2 A;  3U2A A;  3OPH A;  4UQI S;  3T4T A;  4IVI A;  1VB6 A;  5TR7 A;  3NOT C;  1KGE A;  3ZG9 B;  3HRE A;  2I9V A;  4O8G A;  5FEF A;  1P9R A;  1IYS A;  1XJ2 A;  4E04 A;  3WS5 A;  1Y4O A;  5AVE A;  5FI6 A;  4Q0H A;  1RCJ A;  2RL3 A;  3M2J A;  1YLP A;  3MQQ A;  3ZG0 A;  1XJ4 A;  3UE0 A;  1G6O A;  3HVF A;  4MDZ A;  1KOU A;  3LIF A;  3S7N A;  4PHT A;  2X71 A;  4I38 A;  4XUX A;  2WK0 A;  2J3T D;  2HP6 A;  3DW0 A;  4JPM A;  4HES A;  4DMZ A;  3OOV A;  5EPH A;  1Z6F A;  4GNU A;  3PAE A;  2IWC A;  2PU4 A;  5DVA A;  5FQM A;  2NUP C;  2B5R A;  2W1T A;  1TS6 A;  3Q82 A;  5DF9 A;  1TD5 A;  4XT2 B;  4E3K A;  4CLC D;  4XUZ A;  3LR3 A;  2G2U A;  2ZMV A;  4I39 A;  3CZD A;  5DF8 A;  3UDX A;  5E2E A;  1XX2 A;  2G7U A;  2VZW A;  2V9A A;  4EBN A;  4S2L A;  1IYO A;  1ODV A;  4G3K A;  3KYE A;  2EX6 A;  3A3D A;  1XPB A;  4HI4 A;  1H8M A;  2V1A A;  3F1P A;  2Y2I A;  2C5W B;  4B93 A;  4GD6 A;  1TDL A;  2X02 A;  2VLG A;  2FFY A;  1ES3 A;  4KG2 A;  3MQ0 A;  4OVD A;  1C3B A;  3MXR A;  5CER A;  1BLC A;  1CF0 A;  4GCZ A;  3G2Z A;  2J80 A;  1XXM A;  2D02 A;  2WKP A;  2EWW A;  3HUO A;  4CJN A;  3PTE A;  1K4F A;  2V1Z A;  2XF3 A;  1ZG6 A;  1XP4 A;  3V67 A;  1ERQ A;  3KO6 A;  5M19 A;  5G4Z A;  4UHU A;  1SDE A;  2I72 A;  5GLB A;  2OAP 1;  2Z6C A;  4Y5F A;  1BT5 A;  3K3D A;  5IU1 A;  5E2H A;  1MBL A;  1NXY A;  4GS9 B;  3T1R A;  3HL9 A;  1U60 A;  5EM0 A;  3IBJ A;  4KG5 A;  3V3S A;  1LSW A;  2A24 B;  2FZ0 A;  3H82 A;  2VGL M;  1LL9 A;  1Y28 A;  2ZOH A;  1K56 D;  2V20 A;  4CLC C;  2KOI A;  4DE2 A;  1AXB A;  3BWL A;  1OTE A;  4LRX C;  1OTB A;  1IYP A;  1JWZ A;  3RXW A;  3HJK A;  2LB9 A;  5HAI A;  2P9V A;  2EXB A;  1DJB A;  2YKF A;  3N4I A;  3ZG5 A;  3VP1 A;  4KQQ A;  2J7V A;  5DFX A;  5CEB A;  3QP1 A;  2J3W A;  3TG9 A;  1TEM A;  4OLG A;  1VET A;  2W0N A;  2A3U A;  1PZO A;  1KE0 A;  4DF6 A;  2P08 A;  5F68 A;  4WL9 A;  4GOG A;  4BMW A;  1NYY A;  3P98 A;  1IFQ A;  2WAD A;  5CHU A;  5F5Y A;  5F83 A;  1K4E A;  2NUT C;  2W1R A;  5FAO A;  1ESU A;  2WZZ A;  1LL8 A;  4Y2F A;  5F82 A;  4FUW A;  1STZ A;  5CGX A;  4U0X A;  5GLA A;  4D2O A;  3HJI A;  1S4S A;  2EX8 A;  5FQQ A;  2VV6 A;  2GX5 A;  1YLZ A;  5L2F A;  3OPP A;  4QY5 A;  3S7P A;  3T4L A;  4HBU A;  3IF6 B;  4LCL A;  1MC0 A;  1L2S A;  4GHI A;  5K5B A;  4HP4 A;  3UB8 A;  5TBM A;  4R3J A;  2IWB A;  3JYI A;  4UA7 A;  1N9O A;  4CLC A;  1PZP A;  3MF0 A;  4WMC A;  4PM6 A;  3IX3 A;  3DAV A;  4ZTK A;  2DMW A;  3H7W B;  1N4O A;  2H0Y A;  3EGX C;  2ZC4 B;  4JXV A;  1NLZ A;  2WAE A;  4UA9 A;  3EQU A;  2QZ6 A;  4S2J A;  5CXW A;  1S1Y A;  3PBT A;  3NHQ A;  2Q9M A;  4EEU A;  1FR1 A;  3LCE A;  3MS6 A;  1SKO A;  3W8K A;  3O3V A;  1ZTU A;  2QKP A;  4C6Y A;  4OQH A;  4P87 A;  1TS8 A;  1VM1 A;  3P7N A;  1BUE A;  3B33 A;  2XH9 A;  2PHY A;  3FPW A;  2KLI A;  5EV0 A;  4FH2 A;  1EW0 A;  1EI5 A;  1ES4 A;  3MJQ A;  1PI5 A;  1RGY A;  2XLN A;  1FR6 A;  3ZYT A;  3U4L P;  2BTF P;  3M6B A;  3PBN A;  3KSG A;  2ZL1 A;  2JKR M;  1HTZ A;  3N7W A;  5G18 A;  2WGW A;  4QWO A;  4YFM A;  4C3Q A;  3G32 A;  1HD8 A; 
#chains in the Genus database with same CATH homology
 4QPR A;  4OOL A;  3LIA A;  1V9Z A;  3HCY A;  5HDD A;  2QYB A;  2HJE A;  2VX8 A;  4HP9 A;  3VE4 A;  3NJA A;  4MMN A;  4WN5 A;  3CIT A;  2O9A A;  2M7V A;  3UE3 A;  3C8C A;  1DP8 A;  3FC7 A;  4F3L B;  3RH8 B;  4BBU A;  4CLC E;  4DJ2 A;  1TS7 A;  1UWN X;  2P7J A;  4GLQ A;  4MN6 A;  4YWZ A;  1OPX A;  4RQ9 A;  2PDR A;  1GSV A;  1S1Z A;  4R70 A;  3JVV A;  4GHI B;  3ULF A;  4ARZ A;  4WEL A;  5TBM B;  1F98 A;  3B47 A;  3A0V A;  4EU0 A;  4BWI A;  1JNU A;  3PR6 A;  3ICY A;  3CLO A;  1UWP X;  4PKY A;  4YNR A;  4CLC B;  3T4K A;  4HHD A;  5DJT A;  2V1B A;  3E4O A;  4MCW A;  5HD3 A;  5G4Y A;  3T4S A;  3EWK A;  1YKD A;  2HV1 A;  2B18 A;  2JKR I;  2A2L A;  2QJ7 A;  1D06 A;  5DKL A;  3TE8 A;  1YSP A;  2QJ5 A;  3CWF A;  3U2A A;  4UQI S;  3T4T A;  2VEA A;  1VB6 A;  3UME A;  4EQ1 A;  3CAX A;  5I5L A;  3NOT C;  4P6Z S;  2PD7 A;  4JGO A;  2I9V A;  3PXP A;  4WF0 A;  5DJU A;  3D72 A;  4ETZ A;  4O8G A;  4EUV A;  2J3T C;  1P9R A;  1XJ2 A;  4BBV A;  4GS9 A;  3K3C A;  4E04 A;  3BJN A;  5AVE A;  2Y8H A;  3F1O A;  4I3I A;  4Q0H A;  4HH2 A;  3OLO A;  1S67 L;  4GW9 A;  3MQQ A;  3LR0 A;  3LIC A;  2VA0 A;  1OJG A;  3EOI A;  4NEE D;  1XJ4 A;  1G6O A;  1WA9 A;  3TRC A;  3KSH A;  4MDZ A;  2A24 A;  2QHK A;  2XA7 S;  2VGL S;  1KOU A;  4Q0I A;  4LLO B;  1ZHH B;  4IHQ A;  4ZRR A;  3LIF A;  2OAQ 1;  4AFI A;  3JVU A;  1TF1 A;  3S7N A;  4K08 A;  4O0P A;  4PHT A;  3UB6 A;  4I38 A;  2JHE A;  2ZOI A;  3LI8 A;  2J3T D;  5F69 A;  2M7U A;  3T4J A;  4EES A;  4DMZ A;  2WKR A;  3R7W A;  4IUH A;  3C30 A;  3OOV A;  5FL3 A;  1GSX A;  3VV4 A;  5HL6 A;  1LT0 A;  3NOU C;  3D3O A;  1MZU A;  4H6J A;  2M1C A;  1OTD A;  1OTA A;  2NUP C;  2W1T A;  4HOI A;  1TS6 A;  2R78 A;  5DF9 A;  1TD5 A;  4XT2 B;  4DN0 A;  3KX0 X;  2P04 A;  5EFW A;  2L0W A;  3CUE C;  3CI6 A;  4H6J B;  4CLC D;  4IJG A;  3TW8 A;  3LR3 A;  3A0S A;  2ZMV A;  2PYP A;  4IUK A;  2GJ3 A;  2W3F A;  4EET B;  2GNX A;  4WUJ A;  4I39 A;  2VV8 A;  5J7E A;  2L1M A;  4B9O A;  3E4P A;  2VZW A;  2G7U A;  2V9A A;  2O0Y A;  1ODV A;  4G3K A;  3W2Z A;  4L9E A;  3OC2 A;  4EER A;  4HNB A;  4HI4 A;  4Q0J A;  1H8M A;  4UEY A;  4MN5 A;  2V1A A;  3F1P A;  3IS2 A;  2BAS A;  1H3Q A;  4B93 A;  4LRY C;  1W63 M;  2VLG A;  4ARZ B;  2XRN A;  2FH5 A;  4M4X A;  3MQ0 A;  4OOM A;  2XSS A;  3PYP A;  3O5Y A;  3MQO A;  4GCZ A;  2J80 A;  4MN7 A;  1G28 A;  2JKT I;  2D02 A;  2VV7 A;  4KQD A;  2W3H A;  2WKP A;  2EWW A;  3UB7 A;  3F1N A;  1NWZ A;  3T4O A;  4KQO A;  4G3W A;  2VKS A;  5LBR A;  1GSW A;  3EGD C;  3E4Q A;  3V67 A;  4UQI M;  2OWH A;  3H9W A;  3KO6 A;  3UB9 A;  5KSH A;  5G4Z A;  2ZMF A;  4P6Z M;  4YOF A;  1MKM A;  2OAP 1;  2Z6C A;  3EQV A;  3LFV A;  1OT6 A;  3OBF A;  3MFX A;  4Y5F A;  3K3D A;  5IU1 A;  4DJ3 A;  4Y3I A;  1DRM A;  4GS9 B;  3C38 A;  3T50 A;  3GEC A;  1XJ3 A;  1YSQ A;  3DBA A;  3F1O B;  5DFY A;  4HY8 A;  3H7W A;  3IBJ A;  1N9N A;  5CX7 A;  4R38 A;  2WKQ A;  1LSW A;  5HWT A;  1DP9 A;  2V0W A;  3UE6 A;  2A24 B;  3PHY A;  4JGP A;  2FZ0 A;  3H82 A;  2XA7 M;  4GJ4 A;  2VGL M;  5HPF A;  1TS0 A;  1Y28 A;  5L8M A;  2ZOH A;  4CLC C;  3CUE A;  3LR4 A;  2KOI A;  5IT5 A;  3MMH A;  2O99 A;  1XFN A;  2KDK A;  3R7W B;  3BWL A;  1OTE A;  4LRX C;  1F5M A;  1OTB A;  4NXE A;  2JKT M;  2VJW A;  4CQH A;  1S4R A;  4Z1W A;  3HJK A;  2LB9 A;  3S7Q A;  1F9I A;  1OTI A;  2W1T B;  5HWW A;  1W63 Q;  2YKF A;  3KYZ A;  3LID A;  3B42 A;  2W27 A;  2W3G A;  5DFX A;  1XFQ A;  3VE3 A;  1T1A A;  2PYR A;  4WLA A;  2J3W A;  4EXO A;  3A0R A;  2EA9 A;  2Y79 A;  1N9L A;  2ZBB A;  3LUQ A;  5HSQ A;  2YKH A;  4LPZ A;  3ZQ5 A;  2W0N A;  1UGU A;  3BQA A;  2L4R A;  5HDS A;  2P08 A;  2XRO A;  5F68 A;  3KSI A;  3K2N A;  3MXQ A;  5IS1 A;  3KYQ A;  3BY9 A;  3F1P B;  4WL9 A;  3IS2 B;  5HZH A;  5HD5 A;  4BMW A;  1T18 A;  4NXB A;  4I3A A;  2QWS A;  3E0Y A;  1IFQ A;  4NXF A;  1DP6 A;  4L9F A;  5F5Y A;  2HGV A;  2LB5 A;  5AVF A;  1YAX A;  2NUT C;  2W1R A;  3PBO A;  3FG8 A;  1LL8 A;  4Y2F A;  5A8B A;  1STZ A;  4PAU A;  1D7E A;  4I5S A;  3G6O A;  4ME4 A;  5TJJ A;  3HJI A;  5J4E A;  1S4S A;  2GZA A;  3F1N B;  4F3L A;  4WEK A;  2O9C A;  2VV6 A;  4LRZ E;  3EEH A;  2GX5 A;  5F6A A;  4R6L A;  2OOL A;  2K7S A;  1T1C A;  3S7P A;  3T4L A;  3KSF A;  1MC0 A;  4GHI A;  5K5B A;  3LIE A;  4HP4 A;  5TBM A;  3UB8 A;  3LIB A;  3SW1 A;  4ETX A;  4BJP A;  4FSF A;  1VHM A;  3BW6 A;  3GDI A;  1N9O A;  1P9W A;  2IA2 A;  2B02 A;  4CLC A;  1LSV A;  3MF0 A;  2KX6 A;  2PR5 A;  2CMN A;  3S7O A;  2INW A;  3E98 A;  4KUK A;  2DMW A;  3H7W B;  3UMD A;  1T1B A;  4G3V A;  3NOP C;  3EGX C;  3BY8 A;  1P0Z A;  3BQ8 A;  3T4Q A;  3LR5 A;  1NLZ A;  4I3J A;  1S66 L;  4HQA A;  4EW7 A;  3EQU A;  5KIZ A;  3H82 B;  1S1Y A;  3PBT A;  2EWV A;  3RFB A;  5DKK A;  3LYX A;  3NHQ A;  4EEU A;  1X0O A;  2D01 A;  4R3A A;  3MR0 A;  1T19 A;  2K31 A;  1ZTU A;  2QKP A;  4KUO A;  2H28 A;  4HJ3 A;  3PBQ A;  5AJG A;  2K2N A;  4JGQ A;  3OCN A;  1TS8 A;  2W3D A;  3P7N A;  2W3E A;  3B33 A;  1XJ6 A;  4II7 A;  2O9B A;  4JGR A;  2PHY A;  3FPW A;  2PT7 A;  3R4K A;  1LSX A;  2KLI A;  2Z6D A;  1IOU A;  1OJ5 A;  4EEP A;  1EW0 A;  4FOF A;  4L9G A;  1OT9 A;  4HJ6 A;  1P97 A;  3MJQ A;  3OCL A;  4O01 A;  3FPV A;  3TJZ C;  1NRJ A;  3ZYT A;  3IBR A;  5HWV A;  1NLY A;  4HH3 A;  1V9Y A;  4L0L A;  3VOL A;  2MJ6 A;  3LI9 A;  5MC7 A;  2HJ9 C;  4BBT A;  3RTY A;  3PBR A;  4PKY G;  3PBN A;  2OWJ A;  3KSG A;  5HDC A;  2V0U A;  2HF6 A;  2JKR M;  3C2W A;  2JN7 A;  4HIA A;  2PR6 A;  3P01 A;  4WEJ A;  5J3W A;  5C5K A;  4NXG A;  3PBS A;  1BYW A;  5HPI A;  4HJ4 A;  4NKP A;  4XT2 A;  2PD8 A;  3EEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...