1T25A

Plasmodium falciparum lactate dehydrogenase complexed with nadh and 3-hydroxyisoxazole-4-carboxylic acid
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
315
structure length
315
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and Activity of a Series of Azole-based Compounds with Lactate Dehydrogenase-directed Anti-malarial Activity.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
total genus 112
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1t25A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1t25A02
3ONDA 4CMEC 4K6FA 5IZCA 4KDEA 4E33A 3QLJA 1GU7A 1I32A 4E0BA 1IE3A 1W6UA 5FF9A 4J49A 5U9CA 4U8GA 5K6AC 1JWBB 3KSZO 4LMRA 4RZIA 1LJ8A 4FJ0A 1HZJA 1PGPA 4MVJG 3PFFA 3DBLB 3S55A 1YQDA 3V2UA 1NQAO 2BFOA 3LT1A 1C1DA 1DPGA 3DQPA 1CEQA 1NVTA 5FYDA 2R00C 3GLQA 1OZAA 3CSDA 4EJ0A 4HFNA 1BXGB 5TIIA 4OXYA 4AJKA 2G76A 1EDZA 4INAA 3D5QA 4GWKA 3R6DA 3OECA 5DDIP 4HP8A 5DBIA 3BTSA 4IGFA 2G82A 3JD3A 1KEWA 3PGXA 3RAJA 4D41A 4CR7A 1A4IA 1HSOA 3GVIA 4R41A 3P5SA 3U0BA 1E3WA 2QQ5A 3NDRA 4ND4A 4L76A 2GPTA 5DOZA 4Y6RA 4QSMA 2GZ1A 1R4MB 3H3JA 3T7EA 1AHHA 4W9NC 4HXYA 1O95A 2BKAA 4CLRA 1HDZA 2JAHA 4WECA 1E3WB 1X15A 3E5RA 3TZQA 2B36A 3GA0A 4RDIA 4RCVA 4AJ1A 4WNIA 1IULA 3WWZA 3M1AA 3RUDA 3PRJA 2HMSA 1HYEA 3FCOA 3ETEA 3VKVA 1LC3A 1E3EA 4W82A 1HDCA 1SAYA 4FJ1A 1GFSA 1G1AA 4U6SA 1DIGA 5LC1A 2PD6A 2NU9A 4JCOA 5ILGA 1NPYA 3QW2A 2DC1A 2G5CA 4I9UA 4BGVA 4B4VA 1LSUA 4DVJA 4AICA 1YBAA 2AQKA 1G6KA 4W7IA 1U3VA 4EZBA 3NYWA 1PJTA 5K6AA 3RFXA 4BO6A 3GEDA 3G49A 1JQBA 3PDUA 3FWNA 4XRRA 3PTZA 1B8VA 1R4NA 2AG8A 4MKXA 4GX5A 4ZQFA 4BQPA 3NTRA 3I9MA 3D4NA 5I8ZA 5IF3A 4P38A 3HHPA 4MIYA 4Q3BA 4RPKA 1F17A 4OHUA 3U3XA 3W4JA 3I6IA 4XB2A 1X1TA 3MEQA 1SEPA 5FFFA 1GEEA 5KJEA 1E7MA 4ZU3A 4YAKA 1EE2A 1E1KA 1Q7GA 1ZJZA 4RF3A 3E9QA 3C7DB 3WNVA 4BNHA 4NBTA 2O3QA 1O9BA 2Y1GA 3BMQA 1DLJA 5GZ3A 1T26A 2NADA 2YV1A 2EW8A 2O3TA 3B6ZA 2GSDA 2RCYA 4LISA 3TZKA 1PJ3A 4YAJA 1N92A 5KVVA 1U5CA 3ADOA 3IP3A 4GSKA 2I3AA 1CERA 2O50A 3NUGA 4UULA 2X86A 5BT9A 3I9OA 4DLAA 4PG4A 4E2YA 1P77A 2F1KA 1FDTA 2W2KB 1I2ZA 4IPTA 4FJ2A 5C7LO 1NVMB 2YV2A 1N7GA 2VWHA 4CMGA 5DCYA 3AFMA 2HU2A 4RPLA 4J3FA 4E5KA 5GMOA 1F12A 4PFJA 1V3VA 1ZBQA 2HMWA 1LDGA 2Q4BA 2J3KA 4ID9A 1VJ1A 2FR0A 4GMFA 2JFGA 1DFHA 2D1YA 4IM7A 4BMVA 1E7YA 4CQMD 3SVTA 4E5YA 2BGMA 5G4KA 3AY6A 1RYEA 1H2HA 5JNLA 5GY7A 2FP4A 1PSDA 3HADA 5KKAA 3ZI0A 2B4QA 3VH4A 1ULUA 2UV8A 1O6ZA 4R1TA 2A9FA 3KM0A 4HFMA 4MP6A 4CUJA 1J0XO 3B70A 1VKOA 2J5RA 4NPCA 2ZB4A 4HX5A 2FR8A 2FSSA 2VN8A 1IZ0A 4BV8A 1I2BA 1F8GA 5G0UA 2OMEA 1EVYA 3PEFA 1GEGA 2WMDA 2GZ2A 3PWZA 1F8FA 2BGLA 3BHMA 2BHLA 3FNHA 3N74A 4I1IA 4UAGA 2HK9A 3ETDA 4DREA 3H9QA 4CQMA 1LDEA 2W8ZA 3H5RA 4XA8A 5I9LA 4FFMA 3DBLA 2QYSA 5FI5A 3BAZA 4FSHA 4PLVA 2ZTVA 3NEPX 4CUKA 3GRKA 3MTJA 5U1PA 4FBGA 2GNAA 5HS6A 3SXPA 3ZN2A 2D5CA 3H5AA 3KUXA 5CPFA 3B1KA 1DIBA 3PQEA 4F45A 4UUOA 3KVOA 2W4QA 4B4WA 3PLNA 3QVOA 1PJQA 2VWGA 1N9GA 1E0DA 3EC7A 4OMUA 1EQUA 1LNQA 3HDJA 3JQFC 3BYZA 4O0LA 3L77A 5BNIA 3PWSA 2Q99A 1FDVA 1Q1NA 4XIJA 3IS3A 3RC2A 1B2LA 1LUAA 1GUZA 2EWMA 3G3EA 4BO7A 5TT0A 3PHLA 3PJFA 4TROA 3ZU2A 1H5QA 4RO0A 3WOHA 3CXRA 1L1FA 4D79A 5JDIA 1DRWA 4BV9A 3GN1A 2CDBA 1NR7A 2EKPA 2Y67A 3IC5A 1YB5A 1DDOA 3KETA 3JV7A 1NAIA 4Q3CA 4W7HA 4YTEA 4GGOA 2O7QA 1I3KA 2YFQA 4CV3A 3F46A 3KRTA 1R66A 2OP0A 5IXSA 3ZV3A 2YQ4A 5TNXA 3TSCA 4YJHA 3TOXA 2V65A 1C1DB 1QORA 1M75A 4O63O 3GMSA 4P4GA 2DBVO 2VUUA 5KJ6A 2EJVA 1GPJA 2HJSA 2VRCA 3KYCA 4LN1A 4AJHA 4S3MA 4FFPA 2V6GA 1H6BA 1VE9A 2Q1TA 1HLDA 1R16A 3BTOA 3DBVO 3V1TC 3U09A 2YJZA 3HWRA 3JQ9A 3OH8A 3RQSA 1CJCA 1XA0A 3A28A 4WEQA 1LRKA 3NDIA 3R3SA 2FPPA 2G1UA 3MZ0A 2AA3A 3K6JA 3GK3A 3C1TA 4Z0HO 3OETA 1P44A 1Z73A 1UAYA 1PGOA 2OGUA 1VJTA 2VZ8A 2CZCA 3V1YA 4D7AA 3GGOA 4QTZA 3T7CA 3JQ7A 4N18A 4ESOA 5IZCC 4M49A 1IPFA 1P0CA 2JD1A 1JAYA 1NFFA 2WE7A 3S8MA 3EAGA 1EFKA 1PWXA 3FBTA 1CETA 3QWAA 3TZHA 5F1OA 4G81A 2BI8A 3LDHA 2XXJA 3KYDB 4WUVA 2EF1A 4ZQHA 2BELA 3L07A 2V6MA 3Q0EA 4BMSA 1VSUA 1A7AA 3O9ZA 4GVXA 3PJDA 1YDEA 1JKIA 4U5QA 4A03A 4A73A 3ZNOA 1BGVA 5ICSA 1MB4A 1SC6A 3JD4A 2NV6A 3ST7A 1R0LA 3PHJA 2FY8A 1R12A 1IY8A 1RPNA 3RC7A 5CDGA 5HM8A 5A9TA 5KOIA 3BZUA 1CF2O 4CLEA 3EZLA 4J4HA 3K2EA 3MJ4A 1X13A 4CPDA 3ZWWA 2GASA 5TGDA 3VH2A 1WNTA 4XYLA 3VZRA 4YQYA 4ZJUA 3HFGA 2VZ0A 1LRLA 4NJMA 4G5HA 3GGPA 4XDYA 3HDQA 4QXMA 4YDRA 3QVTA 5JE8A 2GO1A 3RUHA 1UDAA 4JJGA 3UGKA 5TS3A 1FDWA 4KQWA 3VKUA 3NRCA 4K1LA 4YT5A 3RJ9A 2VHZA 2P9GA 4OO3A 3DMTC 1CQJA 5BQFA 1ARZA 3BMQB 1XGKA 3PZRA 2RHCA 4D3DA 2C7VA 3S2FA 1U2GA 4RVHA 3IKTA 1ULSA 4EGFA 3DZFA 4GSLA 4GAEA 5K9ZA 3C3XA 5G0VA 3GNQA 1Q2XA 1BWSA 4R5MA 4CMKA 1NFRA 5JYDA 3F3SA 5JO9A 3D3EA 1IB6A 3P7MA 4J90A 5DT9A 3ZNQA 1KY4A 4EW6A 1HDRA 4GPD1 2O3RA 2I67A 4FCCA 4L75A 4AFNA 4HV4A 4A5OA 4KMSA 1YQXA 4CQMB 4DQVA 1JWAB 1E3IA 2B35A 4GVLA 4L4RA 1MX3A 2C7GA 2X0NA 3DDNA 5TC4A 2PD3A 1CIVA 1YXMA 3L9XA 2B37A 1W4ZA 1VM6A 4MVJM 1E3LA 5AXDA 2C82A 2VHVA 4ALMA 2X0IA 1PTJA 3C1AA 2Q2WA 5I7VA 1X0VA 2RAFA 3WQRA 3NX4A 2NM0A 3DTYA 3K5PA 4YPOA 2PH3A 3MCVA 2GN9A 3MJSA 1P45A 2P9CA 1DRVA 3WMWA 3ZV6A 3D3WA 3I9NA 4B3JA 4PG8A 5A02A 3STHA 4FS3A 2O4CA 4B7CA 4YRAA 1C0PA 2JJYA 4QUKA 5B12A 2I66A 1XELA 5DZSA 2UUOA 3K73O 4IXWA 4XGKA 3KSUA 4ALIA 1ISHA 3LVFO 5ER9A 4RLHA 1K3TA 3INGA 3Q2KA 4PG5A 5G0TA 3KLPX 1Y1PA 4U6QA 3WG9A 5JCJD 4XQEA 3HDYA 3OEWA 4N54A 3AW9A 4OOEA 1U2DA 4KUEA 1D8AA 3I6QA 3TWOA 3BMCB 1MP0A 3GEGA 5I7FA 2HUNA 1ZMOA 4LRTB 4Z9FA 3VZSA 4L73A 2B69A 3UH1A 4N5LA 3BMNB 4AJ2A 8LDHA 3DWFA 4TRRA 4MVJH 2JKVA 4W99A 3U9LA 4BS9A 1QV7A 4IDEA 5JAZA 4OM8A 1BW9B 2NQTA 5AOVA 5BNFA 1D4FA 4YJHB 4CL3A 1EVJA 3V2GA 2OO5A 5H82A 2PGLA 5DNAA 1CQIA 3E5MA 3GOHA 8ADHA 2EP7A 1O8CA 1U7TA 2EEZA 1NXQA 1E7WA 3BHJA 3W8FA 1NQTA 3F1KA 1F0YA 1LSSA 4OQYA 1LI4A 4GI2A 3OIDA 3RROA 4HFRA 4L4XA 5IFLA 1P74A 3NGLA 3MJVA 3VPHA 3VDQA 3FR7A 4H3VA 2I65A 1OFGA 4ILKA 2LDXA 1Z7BA 3H9UA 3D5TA 3ON5A 3TFQA 3TZ6A 1I3MA 1PS0A 3GDGA 4JP3A 5IN5A 4IIVA 4I08A 3U49A 3NAQA 4ND1A 2GUGA 3X2FA 1SO8A 3H7AA 4IZIA 1DJNA 1S6YA 4QFCA 4YJGB 3V1UA 3ZDFA 3COSA 4TKMA 5EQFA 3QE3A 1P1RA 1HE3A 1GPDG 9LDTA 2XAAA 3IUPA 3WBFA 1RM0A 2H5LA 1O0SA 2E82A 3A14A 2NVUB 5IDQA 3NJ8A 1K0UA 1HXHA 3PHGA 1UUFA 2Q45A 4DC1A 3M1LA 4YJDA 3OIGA 3EVNA 4Z6KA 2ET6A 3F6YA 1C1XB 1ZXBA 2QRLA 2QZ9A 5G2OA 3GVXA 3UCFA 1XYGA 3ZWYA 1TLTA 3G17A 4RPJA 4D43A 2EKQA 3BMOB 2ZIZA 4KTVE 4CMIB 4WOKA 4ZQEA 1PWZA 3DFZA 4Y98A 2PA3A 2PKQP 1BXKA 3GY0A 3JQ6A 1K5HA 3IIEA 4XYEA 3W8EA 2Y99A 3AOEC 5EINA 1ZVMA 4Q3NA 2J6IA 1DIRA 2DQ4A 1P1HA 1U1IA 5HS4A 4NBRA 2YUTA 4JK3A 3EYWA 4OGWA 5GZ1A 5L95A 4IJWA 4J1TA 2XF8A 4ZA2A 1DIAA 4TRNA 3U62A 3D3WB 1PL7A 4RL6A 4CM7A 1UP7A 3E1KA 3KYDA 3I4CA 4YA6A 4E12A 1HEUA 3UHAA 4DMLA 5L7TA 1EK6A 5LDGA 1YDWA 5EIOA 2V6BA 3QWHA 1P3DA 4FDAA 1IZ9A 3HFSA 3LU1A 1GZ3A 1K2WA 1PZHA 2Q50A 4GX2A 3G1UA 2R2GA 4I9HA 5EESA 4BGIA 5ITVA 1V3UA 3JYOA 3ZHBA 1ZK1A 3DEYX 3PWKA 2Q3EA 3RASA 3ZHZA 1IL0A 1HE5A 3NGXA 2DT5A 3ASVA 1XIVA 2ZJ0A 4L9RA 4XRGA 3AFNA 3OMLA 4PVCA 4LMPA 1G0OA 4EYEA 4GLLA 4TMFA 5T64A 2HSDA 3BMNA 4LW8A 4IS3A 5TQVA 2PTGA 1DC3A 4OJNA 4AJNA 3CTMA 4PLCA 1GADO 3LK7A 4YJFA 4GX0A 3H2ZA 2DBQA 4CMHA 1PR3A 2GN4A 3ENNA 3DTTA 1GCUA 1Y8QB 2EKLA 5AXCA 2DVMA 1ZKMA 1PQUA 2VWPA 4XR4A 4DQXA 2VWQA 3FNFA 1RKXA 1MGOA 2NSDA 2VYVA 3K8ZA 4UUPA 3WYBA 5IN4A 4UVGA 5L4LA 2GLXA 5IDXA 2GGSA 4BNXA 5KVCA 2WYWA 4I5EA 2YZ7A 1Q7CA 1ZSVA 4ND5A 3TJRA 4PZDA 3WXBA 1DBVO 1SOVA 3PDJA 2Y66A 2X7HA 1LQTA 4JQCA 4WCFA 4BKRA 4BO4A 1PZGA 3E03A 4DIOA 1PIWA 2Y93A 4GL4A 3TPCA 1MLDA 1LX6A 1SZJG 3LC2O 1ZEMA 3KYCB 3OICA 5THQA 5ENVA 2Z95A 1QMGA 5T6BA 2Q1UA 1GTMA 1Z82A 2FWMX 1Z74A 3DR3A 5A04A 4WLOA 1TA4A 3RUCA 5B4VA 4H15A 2JAPA 1Z6ZA 4KQXA 1XEAA 1A9YA 3GFGA 2VYVD 3O8QB 4II3A 3GF4A 3VPFA 1HZZA 1HWYA 1B3BA 3DMTA 3Q3CA 3SX2A 5MGBA 3ONEA 1E92A 2QRJA 3SJUA 4JBIA 3DHNA 3GVPA 4IQGA 2Y1FA 4KP7A 5DF1A 2P4QA 1TT5A 2XXBA 2UDPA 5IJZA 5A5FA 1JDJA 4RORA 2FPIA 1YVEI 4EBFA 4YACA 3FI9A 4J4TA 1LRJA 2WD7A 2WYUA 4OYRA 2X23A 4YJGA 1YO6A 1Y9EA 2JCXA 4ZHSA 3NTOA 4R3NA 4CM4B 1SCUA 4HADA 3DONA 4KDFA 4ZVVA 3LLSA 3GG9A 3FHLA 3UFXA 3GT0A 1A27A 1ISJA 4IJVA 3GH3A 4R51A 1X14A 2CNBA 4IUYA 3HG7A 4CM9A 5I7EA 3BMOA 4CMAA 1WMAA 2OP1A 1N8KA 1NPDA 4AVYA 3NT5A 1P1KA 4TRJA 1KVTA 3VH3A 2J5KA 2P2SA 2VRBA 4II2A 3VVCA 4AJLA 4E21A 4B7XA 3O38A 4O5OA 4CMCA 3FPLA 5ICMA 3EMKA 1VPDA 4WJZA 4YAIA 3RUIA 2YYYA 1Z45A 4W9NA 4D42A 3CMCO 3PFWO 3AU8A 3SBOA 1A7KA 1CDOA 4QX6A 3FBGA 4R9RA 1V6AA 1BDMA 1M76A 2I9PA 1K6JA 3RSHA 2WEKA 5HWSA 1WPQA 1WZIA 5T5QA 5CEJA 3D0OA 4BVAA 1E77A 1ZFNA 2CFCA 2VT2A 4J1QA 3PQDA 4RQTA 3C1OA 3GRPA 1NHWA 2VNSA 2I5PO 2Y1CA 2IRWA 2HLPA 4IDBA 1YS4A 4FD3A 4WGGA 1C1XA 4B8ZA 5CEEA 3JQ9C 4E5NA 2QG4A 4B3HA 4BIIA 2OOSA 1YBMA 5JDIC 2FSVA 4Y6SA 3VAZA 2GN6A 4DMMA 3S2IA 4FGWA 1YRLA 1OC2A 1NM5A 3DAGA 5EMHA 1P1JA 3AJRA 3IJRA 1KVRA 2BD0A 2DUWA 5LCXA 5JFOA 5A4DA 3CH6A 1Y5RA 3L4BA 2Y0DA 4EEZA 1QYVA 2A35A 1YGYA 2X5OA 1GQ2A 4MIEA 2J3JA 5C37A 2D2IA 4J1SA 1R37A 2NWQA 9LDBA 4I5FA 2Q2QA 3KEOA 1VL6A 4Q3AA 3E9NA 1H94A 2B5WA 3PXXA 3NT2A 3JQCA 3VDRA 4CLDA 3E8XA 4JJIA 2EG9A 4AL4A 1PQPA 1R4MA 1DFIA 3AY7A 2AEJA 4FW8A 3WDSA 3H3FA 4NK5A 1MG5A 1A5ZA 5CDSA 3FNEA 4UVEA 3W8DA 4A2CA 3AM4A 4PZCA 1N7HA 2R6JA 3INTA 4BNNA 1PS8A 4TSKA 5DP1A 4RJTA 4XJTA 1J4AA 3RUAA 1B26A 2VHXA 1IOLA 1HDOA 3GDFA 1U7HA 2ZB3A 1NASA 1VLLA 1XG5A 2JHFA 4MO2A 5F3RA 1U8FO 2DU8A 3L6EA 2TMGA 3OJEA 3PPIA 3UF0A 1GYRA 1GZ6A 3KXDA 4IGEA 3F4BA 3ZWMA 4BO8A 4E3ZA 1P1IA 3GQVA 2O3JA 3JD1A 4ZRMA 2DTDA 1I01A 1XQ1A 3K92A 2PR2A 4EUHA 4AJEA 1P9LA 3WICA 4BNLA 3KTDA 5COBA 4IDGA 3QWFA 1JW9B 1D7OA 3ROMA 2F00A 3GAFA 1YJQA 5A03A 4KZPA 4D3FA 5CP8A 4GLOA 2Z5LA 1WLYA 4CLRB 4IDAA 3MJEA 4Z9XA 1OOEA 4CMBA 1HYHA 4N5MA 3M2PA 4R16A 4KUHA 3CPSA 3GVHA 3DC2A 4OOFA 4JNKA 5BSFA 4D0SA 2CVQA 2RH8A 2WTBA 2A94A 1IYZA 1RYDA 2AEFA 4BNUA 2X6TA 1ADCA 3KEQA 3ULKA 2UAGA 4PLWA 4A26A 3GMDA 1YH3A 2NACA 1ZSYA 2JFHA 3IQDB 1FDUA 3P2OA 4YAEA 4YT4A 2VUTA 5KCZA 4LK3A 4N5NA 3WJAA 2RH4A 1ZK0A 4HNGA 5JC1A 4R68A 3HZZA 3IJPA 2ZQYA 2YFHA 1JVBA 2QIOA 1I8TA 4AJPA 3O8QA 3ZH2A 4WK6A 2VZ9A 1SB8A 3I9KA 3Q6IA 4GWGA 5DBFA 3VVBA 1YB1A 1ZJYA 3FD8A 4XDZA 1UXJA 4Y67A 3AWDA 3H6KA 1JVSA 2GZ3A 2BGKA 3DBRA 3OP4A 3GPDG 1GD1O 5AQ1A 1JAXA 1ZK2A 2O3SA 2O3UA 3H2SA 3OM9A 3VTZA 1QR6A 2J3HA 3L6OO 2IDZA 4XZ3A 5L7YA 3WGQA 1C0KA 1BVUA 4PCVA 5C5IA 2YHUA 3FSRA 4P22A 2X22A 3RFVA 4EI2A 2P5YA 3AK4A 5CG2A 4IJUA 2IEDA 2DBRA 5JYEA 2BLLA 2WWRA 4BKOA 2J3IA 1ZK3A 1PGJA 1T4BA 2H1SA 1D1TA 4ZD6A 4BO5A 1ADBA 1O89A 4TKLA 4ROSA 5AVOA 4DPLA 3Q9NA 4OKNA 1B3RA 1DLIA 3GHHA 3OHSX 3JQ8A 4I8XA 2IZ0A 3QRWA 3W1VA 2DUUA 3I9JA 1SBYA 1LSOA 4Q3DA 4AJOA 5KNLA 4XCVA 3VZPA 2ZYDA 3M6IA 1DRUA 3JYLA 1ENYA 2ZATA 1GL3A 2VOJA 4Y9DA 1DXYA 3GC6A 3K31A 1KS9A 4HUJA 4C4OA 4M86A 4LVUA 2GDZA 5COQA 3EGOA 3VHRA 5I9NA 1QLJA 2ZCUA 3OJ0A 3M2TA 4LRSB 1K6IA 1N1EA 3CZRA 5ILOA 2I3GA 4OXNA 2OZPA 2O23A 1H9BA 4F6CA 2EXXA 1BRMA 3I9LA 4DBVO 4ZGWA 5FEUA 5IXYA 1UAGA 1TVEA 2CF6A 4FOSA 2VYNA 1E3JA 1MC4A 2HO5A 5THKA 5BNTA 3ETGA 4FIZA 3QQPA 4MVJE 2FPGA 4WCDA 1EUDA 1DEHA 1NYTA 1MV8A 1EE9A 3QV1A 4Q3EA 4MDHA 4Z3KA 4J0EA 4F46A 3EHEA 3K96A 5IAAA 1X1EA 3MWEB 4EDFA 5DN9A 2IYPA 4YT8A 5JXWA 3WIDA 2OORA 2ZK7A 2HK8A 3WGTA 4DTIA 1PR9A 4PG6A 1GZ4A 3F5QA 1J6UA 3LYLA 4UREA 1JTVA 3PIIA 5L40A 3U4DA 2Q2VA 1Y8RB 1XU9A 2GN8A 1KBZA 2C2YA 2EJWA 3UW3A 4NI5A 4E5PA 5C3MA 4RVDA 1JKJA 4JN6B 5G0SA 1W0CA 1H6DA 4PN3A 4JX8A 2RIRA 1CWUA 3K9QO 2Y1OA 2ZJ1A 3LT4A 2VUSA 3NKLA 3PK0A 5G4KB 4QEDA 3NJ4A 1EK5A 3RD5A 2X4GA 4NNJA 3QIVA 4J7XA 3NTQA 5K0ZA 1AXEA 1HE4A 2AEMA 3WQQA 4UUNA 2HCTA 3D7LA 3QSGA 3ZWVA 5CEFA 2PK3A 3WTBA 4DA9A 5KVSA 1BXGA 2E48A 2OFPA 3ADPA 3DZHA 3IOYA 4I9NA 4XX0A 2OXIA 4NU6A 4MKRA 2FR1A 1TT7A 1I3LA 5FI3A 3ZW8A 1UZNA 5ER6A 4BQRA 4DWVA 3OQ1A 4FPXA 7MDHA 4NZ9A 3RBVA 1PL6A 1UXHA 1XCBA 4NBVA 1DOHA 1YL6A 3I1JA 3KO8A 3HNPA 1PJCA 3F9IA 3H4VA 3WX0A 4RVFA 4HWKA 4L8VA 4XGIA 5TRTA 4R4JA 5DCUA 3ABIA 4FR5A 2X9VA 4FFNA 4FC7A 1KC1A 3CEAA 1KEPA 4JGBA 4NR0A 2H63A 5KVQA 1U3UA 1H93A 1P31A 1U5AA 4MVJI 3OSUA 2NU7A 4E4YA 1HF3A 3JD2A 4RPGA 2JFFA 3PYLA 1B14A 1T2FA 5KIAA 1GQYA 4NK4A 2PNFA 1B15A 3D64A 4J2HA 2XOXA 2O48X 2BFMA 1ZUD1 1NFQA 5T67A 5MDHA 4PLZA 4EJMA 2YV3A 1DHTA 1DAPA 4PLFA 5CPBA 3DZGA 5A1TA 4O59O 5H81A 3I3OA 3GAZA 1AXGA 3UCEA 3H5NA 4AG3A 3QVSA 2B5VA 1P0FA 1C0IA 3C8MA 4CM3A 3DOOA 4DL9A 4OXKA 2OUIA 4OSPA 1AUPA 2H9IA 4DLLA 1XHLA 1TI7A 5L51A 2QYTA 5IG2A 3DZJA 4BB5A 4P4NA 5A9SA 3ITKA 1NNUA 1KY5A 2GERA 2ZB7A 1I24A 4ZRNA 3CIFA 2PGJA 5A9RA 3ANNA 4NU5A 2NU8A 3ZHXA 4RF4A 3IAHA 3H9JA 5L9AA 1ENPA 1QYDA 3A06A 2A92A 3ZWPA 1NBOA 4L4SA 3Q2IA 2Y05A 4AJJA 1KERA 1SEVA 1ISIA 3A1NA 2DTXA 2NTJA 4CM6A 1I5RA 1HE2A 4WCFC 2PV7A 5EN4A 1LDNA 1SPXA 1QYCA 1W73A 5G0WA 5T8KC 3DZKA 4CMIA 1VL0A 3GZNA 3H9GA 1QG6A 2BMAA 2Q1WA 3VPSA 1L7EA 4B79A 2CVZA 2X1HA 4H7PA 4PVDA 4RVGA 1R15A 2VRCD 1LDMA 4IQ0A 3OEYA 5AYVA 2DLDA 5L4NA 1VSVA 3HJAA 1ZZEA 4FGSA 1UH5A 5CDYA 2R00A 1A71A 2PH5A 2X0RA 3Q1LA 4ALKA 3UXYA 3TL2A 4ALLA 2X58A 2D59A 2WM3A 1H9AA 2WJPA 4RLSA 2C07A 1PS9A 2YDYA 1DHRA 3VOSA 2HMVA 4ONEA 3RC9A 3QJ5A 1WDKA 1I2CA 3I4FA 3QP9A 1HETA 2O7SA 2DBZA 1QYWA 1EUCA 4WLUA 4RVUA 1LTHR 4DIBA 4ND3A 2IZ1A 1HYGA 3IP1A 4D44A 2B4RO 1H6CA 1M6WA 2NLOA 5HRUA 3PVZA 1PGQA 1YJ8A 3BIOA 3GEMA 3WYCA 4JROA 4CR8A 1DC5A 3WJ7A 4IDFA 3AUUA 1DSSG 2NNLD 3AOGA 3GNSA 3WFIA 4GQAA 4BNVA 1H0KA 3KV3O 4WLFA 1MXHA 3WGGA 2ZYAA 3FTNA 1B0AA 4XYMA 1XQ6A 2NU6A 4EJ6A 4U7WA 5G4LA 3KBOA 3FRJA 2Y0EA 3GUYA 1MC5A 4DBZA 1J5PA 5CAEA 2WE8A 2BH9A 3VH1A 3PHIA 1LDBA 4B3IA 4C7KA 2GCGA 3U4IA 5AXAA 1GYPA 4BO2A 4YVFA 4YJFB 4EEXA 4P8RA 3WSWA 4IINA 1OI7A 2CDCA 1MG0A 1UXKA 1Y6JA 2A4KA 1UXIA 1GUFA 1QSGA 3B1JA 3AOEA 1N1GA 4XYGA 4R1UA 1ZK4A 4BNZA 3RKUA 2SCUA 3T4EA 4DIFA 4G2NA 1JA9A 3QWIA 2B83A 5CHEA 1XWFA 2Q46A 1X0XA 5BSHA 3I23A 3WTCA 4L74A 4DXHA 2PGDA 3ZU3A 1IHXA 3DBHA 3DOJA 1B16A 2E4AA 1JKFA 2C29D 4FC6A 1ADGA 3GZ4A 4WCFB 1Q0HA 4IDCA 4YWJA 1KOLA 3ZNPA 3JQAB 3I5MA 4OQZA 1EQ2A 3RI3A 3E18A 1DC6A 3RUFA 2EERA 3CE6A 4XD2A 1WZEA 4MP8A 3WIEA 4N7RA 4MVJP 4CMJA 4P4LA 3H9EO 3JQAD 2Z1NA 3WR5A 4B7UA 2AE2A 3TRIA 4NQZA 2ZKLA 2PWZA 1FJHA 3WNQA 3QWBA 4KOAA 1YWGO 1G0NA 1ZCJA 4HFJA 2IXAA 3JQBC 3OA0A 3L9WA 4R69A 1YOVB 2PLAA 4XR9A 4Z3DA 3L4BC 2HMTA 3BXXA 3PI7A 3BTUA 1XLTA 1C3VA 1T2DA 2YHIA 3JD0A 1B8UA 4A10A 4MVJF 1MFZA 1EEHA 1TEHA 4R5HA 5TX7A 3BA1A 4JP2A 3IDSA 3MJCA 2FN7A 3EZYA 4E6PA 1UJMA 4R3WA 3O03A 3JQAA 3W6UA 2CY0A 4MJLA 2DFDA 4R01A 1OC4A 3HQ4O 3OQBA 4BMNA 1SB9A 1PZFA 3DFUA 4Q9NA 4URFA 4CQLB 3S2EA 1HT0A 2PKQO 2DKNA 2NVWA 1NPTO 1YKFA 4LVCA 3KOUA 4J7UA 1LU9A 2AHRA 2C59A 1HDXA 4IMRA 4DC0A 1M67A 2FHSA 3DB2A 3JQBA 3N58A 5KJ1A 1WDLA 3LF2A 4IDDA 2XPCA 3WFJA 4Z9YA 4AJIA 2CUKA 5BR7A 5CDUA 5CFZA 1DJQA 2DFVA 4CV1A 3UVEA 4ALNA 3W4IA 5J23A 1EUZA 5L7WA 3A4VA 2ZB8A 1UZLA 3FPCA 3DBRB 4PRKA 2W2LA 4FB5A 3ROQA 4BKUA 2FMUA 4WLEA 4IZHA 3E9MA 1T4DA 5F21A 1U3WA 1TB4A 3L4SO 2UVDA 1VI2A 1AN9A 3DAPA 4JBHA 5DOVA 4E2WA 3ROKA 1NWCA 5L45A 1I33A 4WEOA 1T25A 4YRDA 3RBZA 2HDHA 4DPMA 3CKYA 4OL9A 5C7IO 1UP6A 3EW7A 2AE1A 5JAIA 4BUCA 2IYOA 4DQUA 3MOIA 1FF9A 4J91A 2JD2A 1WDMA 5HTOA 3ZWOA 4PRLA 2HK7A 1Y81A 1ISFA 3FN4A 2HRBA 4R1SA 4MVJD 1D1SA 1GR0A 4F6LA 2JCVA 1NQOA 1A9ZA 1GDHA 3NDJA 3GPIA 3D4OA 4IY1A 3ICCA 5JY1A 1B8PA 1KYQA 5BSEA 7ADHA 2NQ8A 4MINA 4DGSA 2C5EA 1EBFA 5T57A 1NVGA 2O2YA 4BO0A 1T2AA 1V3TA 2I76A 4LSMA 5F5LA 3WGYA 2WDZA 2NVBA 3TNLA 2G17A 1QYXA 3HN7A 3WYEA 1C0LA 2CMDA 2O4UX 1HTBA 1QRRA 1PJ4A 3E48A 4K9DA 1XDWA 2X5JO 4XQGA 3UUWA 4CLXA 5T8KA 2B0JA 1LBEA 3DXFA 1Y5MA 4KWIA 5KWEA 4M89A 1KEVA 3V5NA 1U9JA 2GF2A 5JS6A 4MVJA 4E30A 5JAQA 4QT0A 1E7QA 3PHHA 4ND2A 2UYYA 4B8WA 1HRDA 4QQRA 4BO3A 4GMGA 1AE1A 1P1FA 4Q39A 5A05A 2J5QA 4BKQA 4MP3A 1BTOA 3CZMA 3ROPA 5EL0A 5ES3A 2ILTA 2Z1MA 4OSOA 1BHSA 5IDYA 3U4CA 5JLAA 1T24A 3FWZA 5B1YA 4DYVA 3ZZNA 1E1LA 3IUSA 4QO8A 4PLGA 1GYQA 3SLKA 2W98A 1PJSA 4PZEA 1LQUA 3PLRA 1Z75A 2V7PA 3RVDA 5IDWA 1PU2A 2BFAA 5L3ZA 4E5MA 4UVHA 3MWDB 1KC3A 3D4PA 4G65A 4OAQA 4XJSA 3ZHYA 4EITA 3C7CB 4OKIA 4Z0PA 3U5TA 1NR1A 4D3SA 2GR9A 4YCAA 2P68A 4YB8A 2P5UA 2EP5A 4LSWA 5TSDA 2TMDA 3OJLA 2EHDA 2PY6A 2IODA 4NFHA 1NQ5A 4FFRA 3ZWBA 4NHEA 4BL5A 1R6DA 5A5EA 4YQZA 2AQIA 4BO1A 1E6UA 3DL2A 1T2CA 4UEKA 3OA2A 3OBBA 4HNHA 3RCBA 4CODB 2AQHA 1Z7EA 2QHXA 4CR6A 5JY6A 6ADHA 4NFYA 1NWHA 2WD8A 1B7GO 3ORFA 3ZWCA 1RM4A 2YHIB 3IMFA 2JHGA 1EFLA 5F1PA 2AQ8A 2QZZA 1E6EA 3HE3A 5A3VA 2C54A 3L6DA 5CG1A 3QVWA 3R0IA 4IXTA 3EK2A 1MXFA 1V0JA 3SEFA 4XQCA 4PLYA 1BG6A 4FFOA 1WMBA 3K2BA 4NG5A 4IBOA 1MA0A 2W2KA 1LA2A 3O4RA 4R1NA 2Y68A 4PIVA 3ASUA 3WBBA 1MUUA 3EDMA 4J9VA 2X5KO 1ONOA 4BNFA 3WS7A 3AM3A 1ZSNA 4U0JA 5JCXA 5JSFA 4KUGA 4YXFA 2VOEA 1BSVA 3G0OA 4MOWA 3V2HA 4BNWA 2P4HX 2W90A 4J16A 4WE3A 5EPOA 1LEHA 4J0FA 4CLOB 4RVSA 3WMXA 1WP4A 4DPKA 1S7CA 3KYBA 2POQX 4RDHA 1EZ4A 4BB6A 1LLQA 6LDHA 2E6UX 5DBGA 5JO0A 5KTKA 1DAOA 2PKRA 1M66A 2BF7A 4JIGA 4XB1A 1E3SA 2IXBA 4K6CA 5CDTA 1YOVA 2RBEA 5U4QA 3MOGA 3DZBA 1Y9AA 3U4HA 4M8SA 1BVRA 2VHYA 4GKBA 3WB9A 4LCJA 2J8ZA 2OL4A 2JD0A 2VYND 5JCJA 3AUTA 3ZWXA 2YDXA 3RWBA 5I7SA 1D3AA 1HDYA 1E6WA 1Q0QA 2Y1DA 1L7DA 4O6VA 5KKCA 2NUAA 3KHUA 2P91A 4WPGA 3EVTA 3CINA 3GFBA 5EERA 1T2EA 2AXQA 5EJ2A 3ZV4A 4LGVA 4YEDA 4GBJA 3ZWNA 4BO9A 4BKPA 5FWNA 3AM5A 2VT3A 4IJKA 2IEBA 1YONA 3JTMA 2VTEA 4C7JA 1Y8RA 1M2WA 3RFTA 3RKRA 2Q4EA 3MTGA 3SLGA 1ISMA 5AXBA 2X9GA 5KJFA 4Y6PA 2GRAA 3DAFA 1GAEO 4RGBA 3PJEA 1V9LA 3LLVA 3E6AA 4WLNA 1MFPA 1I36A 1OAAA 2FOIA 1E5QA 3GGGA 3VZQA 2VTDA 5C7OO 3UN1A 2ZTUA 3GNTA 5JDCC 3MJTA 1M6HA 4E32A 1K89A 3OQ6A 3C24A 1Q7BA 4S1VA 1A72A 3P19A 3ZWAA 3TFOA 3DOCA 3WGHA 3DO5A 3ZU4A 3HSKA 3TN7A 4BGUA 2X8LA 1ORRA 1RWBA 2QX7A 5EQDA 4CM1A 1U28A 4UVIA 3ZGYA 4RPHA 5LDHA 4OH1A 1XU7A 1ISGA 3DHEA 4HY3A 1KETA 4CM5A 4E2XA 4TRMA 4TZTA 4H16A 2AW5A 3INRA 1CYDA 3ANMA 4GKVA 1U4SA 2YW9A 3GHYA 2D3TA 3ONFA 3QHAA 1KVSA 2FRDA 2W2LD 3FNGA 1I10A 4J43A 3UICA 2PZKA 5A06A 4B4OA 1GQQA 1IHYA 3BMCA 4J6FA 1BW9A 2V6FA 2ZTMA 3A9WA 1YE3A 2CF5A 4U0KA 5B37A 1QXSA 2PD4A 4M54A 4XKJA 2EGGA 4A0SA 2BFPA 1NHGA 4PG7A 1EDOA 3I83A 1ONNA 3D1LA 5I8WA 1UZMA 3PGJA 3NT4A 2X0JA 1LDYA 2D0IA 4IMPA 1LLDA 3WGIA 1SMKA 4M55A 1UP4A 5KJCA 3LC7O 1HLPA 4I5DA 4CLHA 2G0TA 3Q11A 3TDKA 3KZVA 3PIDA 4M87A 1JLLA 1BDBA 4GGPA 1EMDA 4YRBA 1QV6A 1R4NB 4JBGA 1HSZA 4FQ8A 2HKIA 2I6TA 2O2SA 5TLSA 4WOJA 2EV9A 1XSEA 4B4UA 1GUYA 4CL8A 3LSYA 2HJRA 5B4TA 2JCYA 3PQFA 3AU9A 2NTNA 3TQHA 4R54A 1BXZA 1X7HA 3GDOA 4UVDA 1NAHA 4W4TA 4E31A 5A9SB 2LDBA 2Y0CA 4D46A 3KB6A 4NFSA 1I30A 3QVXA 3WGZA 1JU9A 2C20A 4YBZA 5TF4A 3FR8A 3JQEA 3ITDA 1VC2A 3ICPA 3G1TA 5BSGA 4IQ8A 1N5DA 2P9EA 2GD1O 3VPGA 4ZN6A 1IUKA 1X7DA 5ADHA 1I0ZA 4YAGA 4BNIA 1KVQA 3IL2A 2EW2A 4W6ZA 4NH4A 3WQSB 1E5LA 4CM4A 3HUDA 2Q49A 1K6XA 2PFGA 1UXGA 3LT0A 4MPDA 2AMFA 1LLUA 1IPEA 3B1FA 4JXKA 3JCZA 3F4LA 2PZJA 1KEUA 4CLOA 2D8AA 4MIOA 1WVGA 1T1RA 3FF4A 1RJWA 3LZ6A 3ZW9A 4ITUA 3FTPA 4ZQGA 3EUWA 4A27A 1PX0A 1O94A 1EVZA 3EY4A 3H65A 4AJ4A 3GR6A 4KWHA 4J1NA 5ITWA 3HN2A 3CMMA 4RQUA 4LCEA 4TQGA 3UOGA 5JW6A 4WASA 4BNTA 2H6EA 5L53A 3ZNNA 1ZEJA 4NBWA 4WKGA 5JDCA 1XKQA 1WW8A 4L0QA 3O26A 1EBUA 4CJXA 4XGNA 1CRWG 2VNAA 3KSDO 5H83A 1T1SA 2GYYA 2B4TO 3OF2A 1VJ0A 2Y1EA 4HKTA 4M1QA 1WWKA 4HBGA 3K30A 2OHXA 1A4UA 3PYMA 1NP3A 3LQFA 4IS2A 3F5SA 3W4KA 3B20A 2I99A 1X7GA 2HMUA 3PP8A 4OIMA 3TL3A 3X2EA 3AUSA 4YR9A 4DLBA 5B4UA 5DP2A 1Y7TA 3GZNB 4BNJA 4DUPA 2DPGA 4IIUA 1NTOA 1VL8A 1E1NA 1H2BA 1O5IA 2VQ3A 3OJFA 4UEOA 2YQ5A 2WYVA 4NJMB 4PGFA 3ANLA 5L4SA 1ENZA 1FXSA 5JAMA 4K26A 1E7RA 1GY8A 1VKNA 2CSUA 3DHYA 3VTFA 3F47A 1ONPA 1HL3A 4D0RA 4JLWA 1ZIDA 1I3NA 4CUZA 2CVOA 2ZQZA 1ZNQO 3RUEA 2E37A 4E13A 3RJ5A 4CM8A 3AI2A 3GVCA 5JPIA 4BNKA 5GZ6A 3WSVA 5JC8A 3JYNA 4F3YA 2IE0A 5HBRA 1PQWA 2DM6A 3NV9A 1TT5B 4I5GA 1EVIA 4XWYA 4NIMA 4NMHA 3I52A 1E1MA 3RC1A 2BRUA 3TOZA 3R3JA 1PJLA 1OMOA 1SOWA 3AI1A 3HDHA 3P2YA 2VCYA 1ADFA 1ENOA 1AHIA 4R9SA 2NTVA 3AI3A 4NDNE 1PJ2A 2JL1A 4TWRA 4EUEA 4ZQBA 4QECA 1ZO8A 2OBNA 4CM9D 2PZMA 3UAGA 4TVOA 3LC1O 3N7UA 1ML3A 4ZICA 2C2XA 1YBVA 1PL8A 2EIHA 2C0CA 3UKOA 3JYPA 1U3TA 1Q0LA 1LXCA 2CDAA 2DPHA 3V8BA 1KVUA 3QY9A 4CMEA 1RM5A 4DRYA 2WSBA 2D5AA 3S2GA 4X54A 1DC4A 4BNYA 1GV0A 2RHRA 2QW8A 4FN4A 2E49A 3HB5X 1DFGA 1HDGO 3JQGB 2OBYA 2ZTLA 1F14A 3PYXA 1N9GB 2PZLA 4UUMA 1PEDA 4YT2A 5TJHA 4RF5A 2CD9A 3WLFA 4FFLA 1UR5A 2WD7B 3OFSA 2DAPA 3ENKA 4KTTE 3RIHA 3JQGA 3QA9A 5JMWA 3PJGA 5HA5A 4GH5A 3DBHB 3RBXA 1FDSA 2X9NA 1PJBA 2D4AA 2HRZA 3RU7A 1YB4A 4GX1A 4XIYA 3SC4A 4RV9A 1PZEA 3OIFA 3IKVA 5F1KA 1U8XX 3LF1A 1J49A 3SC6A 2UUPA 3WGOA 3L0DA 1ZH8A 1TXGA 1V35A 1YL7A 2ZYGA 4DYDA 2IZZA 1V8BA 3KLMX 3GG2A 1ZMTA 3LT2A 2QRKA 4MKZA 4YYZA 4XQ9A 5DCWA 1WXDA 1P33A 1DB3A 1R0SA 1JN0A 5IZ4A 1GCOA 4TVBA 1C14A 4XEHA 3VPXA 4A7PA 1R0KA 4E2ZA 1DIHA 4WNCA 4J2OA 4EUFA 5JBIA 4O1MA 1QKIA 4BHTA 2BI7A 1ZW1A 1W8DA 1YQGA 4Z0TA 3CUKA 4RF2A 4QFDA 1H6AA 1HKUA 3HB4X 5ENDA 2ZCVA 1XR3A 2DTEA 3JQDA 2VHWA 3JQ7B 3AUAA 5DULA 4BOYA 4FOOA 3C85A 4TZKA 4NBUA 3GUCA 3ZCXA 3WLEA 2YY7A 1KIFA 1BMDA 3BTVA 5TT1A 4J7CA 3C7AA 1WAMA 2HAEA 2Q1SA 4CV2A 1FK8A 4BGEA 4UEJA 4BNGA 1UDCA 3E82A 3G79A 1F06A 1VRWA 2NVUA 3TF5A 4CQLA 1NX6A 2EGHA 3DMYA 4ALJA 4CM8B 3BHIA 1GV1A 4Y8VA 5JMPA 2FZEA 3Q9UA 2AG5A 4D45A 3T4XA 1E7SA 4J4BA 5COAA 1QLHA 1YL5A 1ZXLA 1SNYA 1QP8A 3VC7A 4BNMA 3S1LA 1U4OA 1PGNA 4NJOA 4PLPA 5I9MA 1RM3A 3JYQA 3UCXA 3JQFA 5F5NA 2HQ1A 3OJOA 3TZCA 5TJ9A 4PLHA 3JQ8B 2C5AA 3W6ZA 3GN2A 4J9UE 3AY3A 4QO7A 3DZIA 3WWYA 4WLVA 4PLTA 5A3JA 2FZWA 3ZU5A 4XYBA 1LLCA 3R1IA 3SJ7A 4K28A 1ID1A 3F1LA 1UDBA 4CV0A 3RU9A 3ZV5A 3H8VA 1FMCA 1LSJA 1DO8A 3JSAA 3PZBA 4JJFA 1N2SA 1OBFO 1LC0A 1Y8QA 4RZHA 1AGNA
chains in the Genus database with same CATH superfamily
2G04A 4CMEC 3K53A 4K6FA 5CB6A 2ZRBA 2Q3FA 4BZXA 2NZJA 3LY5A 1UJNA 4E33A 5C7YA 2C4HA 1N6PA 2Y2UA 3WRVA 1AF7A 1EG7A 2HNAA 5DB4A 1W6UA 3K6SB 5FF9A 3WIVA 4Y1FA 1DG1G 3B13B 1LB1B 1AOXA 4YPFA 1CEXA 3T3MB 5U9CA 3NTVA 2H4XA 4U8GA 3ZIDA 1JWBB 2FPMA 1MV5A 1ZHHA 2OD9A 2COKA 2AOUB 4FJ0A 3FH0A 1PDWA 2BMEA 4GSYA 1XDZA 2J08A 3PPXA 5ALQA 3LT1A 4JBWA 1T3GA 2P79A 4NICA 2PUDA 1XXHB 1QFZA 3KWMA 4OCZA 4C6SA 5FYDA 4YRGA 1Y80A 2IP4A 3QMMA 3AVTA 1OZAA 1O57A 5IKMA 4OXYA 4POAA 4AJKA 1RXUA 2W6JD 2QLNA 2ACWA 4Z2YA 1G2IA 3D5QA 4GWKA 4BV3A 3OECA 2HA5A 3L46A 4D2IA 2FQ1A 4HP8A 1GTL1 4B6PA 4XVCA 2ZIXB 5JZSA 1VE1A 5I9TA 2HA4A 4LHVA 3RT1A 3OJWA 5AICA 1O4VA 2XGJA 4KLRA 4UKDA 1W88B 1U3CA 4Q18A 2ZU6A 3CR3C 5LDDC 1H1TA 3CH7A 3H05A 3CX6A 3KVNA 6AT1A 4ZVQA 1IC6A 3U0BA 3PB3A 1WBBA 3KE9A 1T2NA 3IDFA 4B6FA 3NDRA 2VUHB 1ZIOA 4L76A 3EWNA 4Y7CA 5AJVB 4HH3C 3FZGA 2GZ1A 1R4MB 3IBSA 1J8DA 4EL5A 1FBNA 1L3IA 4HXYA 1T5SA 2OOKA 3WRYA 2F9FA 4ZCPA 4D8YA 1CS4C 2JAHA 2DULA 3HL4A 4R1QA 1ZLXA 1WCYA 1W4LA 1TKCA 2OMKA 3ZCUA 1RI1A 4AJ1A 1W0JD 5FQOA 1X7WA 3S70A 3VOBA 5FX2A 2ZG6A 3GJYA 3R2JA 3WWZA 1NN5A 3PHBE 1HYEA 2AFRA 3L93A 4N5HX 2LCQA 3VKVA 3BXGA 1HDCA 2H54A 2VP5A 2ZKIA 4DR4B 2Y1XA 3L01A 4MGZR 3D2AA 4H60A 3QW2A 1Z2NX 5KQRA 3H5TA 1DAKA 2G5CA 4RH3A 3N8KA 4F9GA 2Q4RA 3PD1A 4WZZA 1TCVA 5H70A 4MMZB 1G6KA 3OM1A 5B1IA 2BEUA 2LKDA 3STXA 2XX3A 1XN4A 2AWOA 2JIDA 4BO6A 1WF6A 2AVNA 3PDUA 3X2SA 2I6GA 4DDTA 2AG8A 4G01B 2XDQB 1GLVA 3AP2A 4WSOA 3IIMA 4ZQFA 3LTEA 4LE2A 3V4RA 4V38A 3RB8A 3MMPA 4EFKA 3FW1A 2CBGA 1GNPA 2D7CA 4HDMA 1NF9A 4Q3BA 2ISSD 2FUCA 2DOKA 4HDAA 4RPKA 5C1DA 1D03A 4OHUA 5C1OA 2FN8A 3DEHA 3MEQA 2FDXA 3P9PA 5FFFA 1L5ZA 2ORYA 3IPRA 1EE2A 4CKCA 5K0GA 2CKDA 2O3QA 4NBTA 3SDBA 2BTOA 2Z8ZA 1KFEB 3SJCA 1W4CA 2AG6A 3V4ZA 3ICOA 3BMQA 3NIGB 2QX6A 4W63A 1N57A 3ZHUA 4Z54A 1HNWB 1NU8A 1VJ5A 2A0FA 1A8PA 5HFAA 4AX4A 2O3TA 5TR9A 2GSDA 2PUEA 1QP0A 1IWOA 2E7ZA 4JUDX 3T15A 1U7UA 3CLTD 1YCGA 3ADOA 3KJEA 3IP3A 4R8RA 2NUAB 2AYYA 1M6YA 3NUGA 5B30A 1R8SA 1XTTA 1Y4ZA 2DQSA 4HGNA 5BT9A 3UA3A 3GL9A 5DV9A 4PRYA 2F1KA 3IMCA 3V8QA 4MQMA 1P91A 1Y4AE 4K7JA 1TD9A 1NVMB 4CN9A 2VDVE 1R9GA 5ALOA 4W5QA 3AFMA 1BMQA 1YS9A 5EWMA 1L7OA 4LCBA 1T34A 4F0JA 3I1YA 1HQDA 2KM1A 3VNSA 2HMWA 2R7LA 2J3KA 1VJ1A 3SI7A 2PL9A 1T91A 2FR0A 3N28A 4XB6B 1X8LA 4HX2A 3ZI7A 4BMVA 4K9PA 4N3NA 1SBCA 1Q7TA 5G4KA 3AY6A 4XIGS 1H2HA 3VKFA 1JHOA 2ZJ5A 3HADA 2FEXA 1TUGA 2HEIA 4KMOA 3OU6A 2VA9A 2NYRA 3VH4A 5EIBD 2B99A 1I9GA 1YZQA 3RGWS 1O6ZA 4TTTS 5FV4A 2A2ZA 1H0HA 1XAGA 1CKEA 1UPFA 2A9FA 2RGBA 4L02A 3LCCA 4BVEA 4DDKA 3KM0A 1E9CA 4Z0NA 5IU6A 3WK6A 1ORVA 5F3WB 2IV3A 1KO8A 1SXJB 3B70A 2XUDA 3C87A 5JS7A 4DA7A 1LI5A 1JJ7A 1E58A 2J5RA 3AP3A 1DEAA 2B78A 4OATA 2YYAA 4Y0VA 3K3PA 3W06A 1F8GA 1KJ9A 1A2BA 5JARA 3B85A 1SWVA 3ORQA 2PT9A 1K7SN 3MFYA 3PXGA 1LW7A 2GZ2A 3PWZA 4A8JB 3ACBA 3W9BA 1AKEA 4UAUA 2Y6UA 1LDEA 3PA6A 1DV2A 2OE2A 5HIAA 1J97A 5K8VA 1NQUA 1OD6A 2XTNA 4FFMA 5WRFA 4AZSA 5FI5A 1E9RA 2BGRA 4FI3C 4NCJA 3E7DA 4FR0A 3P0FA 3B9BA 2HA0A 2OHGA 1P9OA 1T6ZA 1E4VA 3TX2A 4CUKA 5DASA 1W19A 1R88A 3T94A 1TJYA 4FZ3A 2H2AA 5EJGA 1GGJA 3NIBA 3P97A 4V02A 4HI0E 3ZQJA 1A76A 4ER7A 2J4CA 2O8FA 3JASA 2CLMB 5DLDA 2XIQA 3B1KA 2OT3B 5I5GA 2HW8A 4R71A 1XX6A 3PUIA 1QTNA 3HJUA 4LRWA 2JFZA 2HIAA 2FR8C 4F45A 4JKYA 2OO3A 1R0XA 3ZGLA 2MR5A 3VI3B 4R2LA 1BN7A 2VWGA 2IYWA 1T29A 4FHEA 5BW8A 1K98A 1LNQA 1W85B 1RQPA 1I94B 6CHYA 3SEQA 3L77A 1T8UA 4JYAB 3PWSA 1NT4A 1Q1NA 4R8SA 4ZOAA 2ZOSA 3PDIB 1PJRA 4TL9A 3KPJA 3R6LA 4TM7A 1JZTA 3G2QA 5ED0A 1S8OA 1O3YA 1BC5A 2F8SA 5TT0A 3VYTB 4COKA 4C2AA 2A0UA 3ZU2A 2QLJA 3CPHA 2YUIA 1FP7A 4G9GA 1QHFA 2JLSA 3V7WA 5LXTA 1X19A 2CDBA 4PAOA 2Y67A 5D01A 1H2YA 2BJHA 4D9CA 1AKVA 3JV7A 1ZYUA 2A1UB 4B9EA 2CLHB 2QL5A 3K7EA 2AF3C 4IEFB 4PWYA 3KRTA 4WDRA 3BSYA 2Q5OA 4DDWA 2HSZA 2YQ4A 5MFPA 4YJHA 3U7QA 4JC5A 1C1DB 1QORA 4LE1A 1KEZA 3GMSA 3IPCA 3ZGNA 5F76A 1VDZA 1NDHA 3G5AA 5KYVA 5BVHB 1GPJA 1AGRA 1JR4A 3PGVA 3WMGA 1GVNB 1SUSA 3O7MA 2ZZKA 4LN1A 4ZK6A 3COVA 2AV6A 2W2NA 5DVZA 1M2FA 2IYXA 1R16A 4HPXB 4DMGA 5BMVA 2P77A 1RIIA 4R2KA 3IUJA 3RG8A 2ALJA 3RSLA 2DWOA 1EAYA 1FXWF 4JQYA 4AK9A 1CJCA 3B5JA 4WEQA 4RDCA 4C2TA 3NDIA 2FPPA 3PC7A 1J2YA 2LUOA 4QOFA 3Q7IA 1P44A 4F5WA 1UAYA 1PGOA 2EVWX 2B0CA 3EXEB 1GP2A 3LX8A 4QTZA 3T7CA 2ZQ5A 4ESOA 3HCOA 5KNBH 3TX6A 1V7ZA 1P0CA 1XZ8A 3I6YA 1BQ3A 1JEDA 3WAJA 2CHFA 1GZ5A 2HDWA 1PW5A 2WE7A 3ZR4B 1EFKA 2C3PA 1TW3A 4QU9A 4DZTA 4GPEA 1PWXA 4LZAA 1AA9A 1ZGCA 2X9LA 3NNSA 1P2TA 1U7PA 1ZNWA 3TZHA 4EHKA 4PQEA 2JEYA 4O8ZA 1RHKA 4DG8A 3KYDB 4MR7B 1VJDA 3C45A 3DW1X 1ZN2A 3ZG6A 1RYYA 4LDQA 1ORWA 3FTFA 2CLOB 3G2MA 2V6MA 2O7RA 3MWFA 3Q0EA 1VSUA 1A7AA 1OU4A 2JHAA 4TWBA 1YDEA 2QTGA 3A7DA 3W6PA 3JWGA 3WP1B 4O4LA 5CFNA 3VJRA 3ZNOA 1BGVA 5ICSA 3TAXA 1JHAA 5JZ9A 5DPMA 3LKVA 2LZ0A 4MWDA 4B40A 1R0LA 3FPBA 3MN1A 1THZA 2FY8A 5L3RA 2ZSJA 3BZUA 2C0QA 1G98A 1CF2O 3EZLA 4CLEA 3RJZA 2NOAA 1X13A 1YR1A 3TGPA 1JA0A 1MQAA 2GASA 3ECAA 4LJ4A 5TGDA 1X80B 1WNTA 3GPBA 5TQ0A 3RVPA 1PR4A 5HBGA 3EASA 3HYRA 5HJ2A 2AZMA 4ZJUA 3FOFC 2M98A 1P6UA 2BJVA 3QUTA 1DRJA 4CIWA 3WQBA 2J33A 4G5HA 3KTOA 1KYVA 2VYCA 3VGJA 4RTPA 3QVTA 2D06A 4J0GA 3SMVA 2DR2A 3A2KA 1UDAA 4NNOA 1QZZA 3UGKA 1GZHB 1SQ6A 2P8SA 4FFVA 4M9QA 2BKLA 1KSJA 2GN0A 2UYOA 5GONB 1TTQB 3ZDEA 4MV7A 4FXPA 3PNPA 4YT5A 1RAFA 5FXMA 1PCXA 5M29A 1NQVA 3RJ9A 3T1VA 2CLSA 1CULC 2FRDC 4OO3A 4LAFA 3FYTA 2CSXA 3IBFA 4QOHA 3T0IA 4RD3A 1XGKA 4BVJA 2OXTA 2DCUA 4TS1A 4D3DA 3H8SA 1T10A 2G5GX 3O7WA 2C7VA 3S2FA 3TEFA 1U2GA 1PLLA 2DHRA 1XWWA 1VL2A 2MSEB 4RVHA 5E1MA 5CK4A 1F8XA 5B1SA 2W6CX 5FUQA 1BXRA 2XXAB 4CF5A 4N0QA 2VDOB 3OKFA 1LPNA 3C3XA 4V24A 2BOVA 2C61A 4Q7EA 4R5MA 2R7NA 3U9SA 1TM5E 1NJFA 3CW8X 5AKYA 3J81A 3ED5A 4LBZA 1HDRA 3LY9A 2ZM5A 3DH0A 4JL8A 4FYPA 4UZSA 3ZHSA 1E9AA 3IUQA 3HBLA 1NRWA 2RCNA 1GTSA 1T9GR 3WMRA 1YQXA 4CQMB 4F84A 4D9NA 3GIDA 4GVLA 1CE8B 3DDNA 4A6XA 5DGDA 4J94A 1VGVA 3GIWA 3L9XA 3WGKA 4NV0A 3OLCX 1VM6A 3NASA 3O3NB 2G3YA 1Z4NA 2C82A 3CSSA 2ZUUA 3C3YA 1CF4A 5K03A 3NFYA 4ZOCA 2WUDA 3C1AA 1PR5A 1XF1A 2WB4A 1JSRA 3WQRA 4EIWA 5I7VA 4TUYB 1KTIA 1Y6GA 2FFRA 4PSUA 3KDSE 4YIHA 3I0ZA 3DTYA 3LL7A 4YPOA 4D96A 1Q57A 2GN9A 4N0EA 3MJSA 4H0FA 4PPFA 1P6XA 4ZAGA 4A82A 2P9CA 2EZ9A 4EFLA 5DTMA 1DRVA 2AT1A 2OSVA 3I9NA 3ZV6A 4B3JA 4PG8A 5CA0B 1I7NA 2HBRA 3EJWA 1NP7A 2JFWA 4FS3A 4RK0A 2C84A 4YRAA 1C0PA 2FWPA 3OOYA 4QUKA 4INPA 5D00A 5B12A 2I66A 2PS9A 4EYGA 2DUMA 3ND5A 2ZRJA 4IXWA 4XGKA 4YRMA 4PBTA 1ISHA 3LVFO 4Q00A 1QX3A 5ER9A 2B7LA 2SECE 1K3TA 3MJHA 4RLHA 3Q2KA 3T3DA 1QFJA 3EVFA 3TLGA 4MQFB 3UNXA 4OPMA 4ENUA 2G63A 3I0MA 3K0SA 1WM1A 3WG9A 2ZDQA 1M2KA 4LNUA 5JCJD 3GX1A 4GL2A 3AW9A 3KALA 2F1HA 1KIAA 3OZSA 4FZRA 4OXIA 2HJ9A 3QMVA 3BMCB 1ESMA 1MP0A 1RTKA 2VT7A 4B44A 4DV5B 1RMYA 3EULA 2YOGA 4MRMB 3VZSA 3UH1A 2B69A 5AVUA 3ZE1B 5E9JA 4IH9A 4Q1EA 2I7CA 1F5NA 4W99A 3K05A 1T15A 3K9BA 2MYUA 4XD7D 1OT3A 1RWNA 2FNAA 3SM9A 3V2GA 4DDVA 4KYUA 1WW2A 3LW8A 1ZM4A 1QB7A 2VZEA 2CV1A 5K8JB 5G02A 1F2TB 5FBRB 1JR3D 1QCCA 3AF1A 5FTJA 4EMTA 4N76A 2V3WA 2A3NA 2WYIA 1E7WA 5TQ2B 5K51A 4DAEA 3UHOA 5I48A 1ZBDA 2I7VA 4D4IA 1NQTA 3F1KA 4KO8A 4JQSA 2ZE7A 1K88A 3K9FC 2LCIA 3EVAA 3KFVA 1UMCB 3CONA 4YROA 1QG4A 3NGLA 5K0BA 1G20B 3VPHA 1W87A 1W29A 2AI1A 4ZFNA 4XWWA 3SXUA 1YQUA 4HTFA 3A6LA 3BWDD 8MHTA 2VNIA 5AKGA 3TZ6A 1UDXA 3BERA 4LF5B 3HBNA 1UMBB 5J43A 3PQ8A 1U0OC 4IOKA 5CK5A 3AZQA 5DBEX 4D6PA 4YJGB 1G16A 3H9BA 1BQEA 1Z4OA 3COSA 4TKMA 3VKHA 2WKQA 3MINB 4JJEA 2VT6A 1K9VF 3R5HA 5BRNA 4GQBA 3N8NA 4C14A 3K71B 4UM7A 1UANA 1RM0A 2RKBA 3WBFA 2H5LA 3TTYA 1HFEL 3ABSB 2WV9A 2NPOA 1DQSA 4JP1A 4NFLA 1V7QA 2XV1A 1E32A 1N2ZA 3NJ8A 2NVUB 5BVGA 1K0UA 4L0MA 3N8DA 4KR3A 2OD7A 3PUWA 5ALGA 4QPDA 3THXA 2ETVA 2QQGA 5EQJB 1XNGA 3E53A 3HI4A 3H2JA 5FPKA 1KZ4A 3K8YA 4LYYA 3KQWA 3FFAA 3HN6A 3WHIA 3NBAA 4MUMA 1P5FA 1G38A 2VQSA 1UJCA 1M1NB 1TLTA 3KUCA 2FPKA 4KQ9A 1IZ8A 4L78A 3R20A 3CHYA 2C04A 2EKQA 2HTFA 3BMOB 2UYGA 5B6PA 5DLQC 1XCOA 3E23A 1KJYA 3LBNA 2J0UA 1PWZA 5GJVC 3DV0A 3ZDZB 1E5DA 3DFZA 4W8HA 3ZOZA 3D31A 1AGPA 1DCTA 1BXKA 1Z2AA 4M0UA 2R0QC 3T7KA 1V11A 3OCJA 1P2DA 4UHEA 1QAOA 4CNQA 3EAFA 4Q3NA 1PK8A 2J6IA 5A6SA 4CQNA 4BFSA 3DHWC 3N05A 1SRRA 2C3YA 3EVZA 2O54A 3EYWA 1H2AS 1DQZA 3A36A 3ODGA 3FDJA 1QCDA 1XLVA 4J1TA 2QTVA 1VCMA 4WOPA 1QOPB 1Z28A 2GNOA 3IO3A 2IV2X 1G3QA 2IXEA 2AI2A 2BJWA 3HH8A 4E12A 3W7AA 1RAEA 1HEUA 4UU0A 3C3DA 3ZX5A 4YLYA 4CHTA 2HCFA 3QWHA 4PHFA 4FDAA 4I8IA 4JCCA 4KQJA 4N40A 4HOYA 1GZ3A 1K2WA 5GQSA 5GV7A 3U81A 1UKEA 3A6EA 2EL7A 3G1UA 4BGIA 4LDJA 1OGIA 1MIOB 2R6FA 3MUNA 3WL8A 1XYYA 2JIOA 2PL1A 1ZK1A 3HY4A 5KNCD 4ZU6X 4A23A 2Q3EA 2GK3A 3BUSA 2DT5A 3DOFA 1XIVA 4YO8A 1BHO1 1TJ5A 2H00A 2JA2A 2OBLA 3OMLA 4OQXA 1W0KD 1I1HA 2X2FA 1U99A 4GLLA 1CNEA 1XZKA 2YY5A 2R44A 3AB3A 3HNOA 3UG7A 3GROA 4B82A 3D6AA 4LW8A 2CEAA 3R3XA 1BE6A 1RYZA 2G40A 4OXXA 3DL7A 3CVUA 1IVYA 1GWNA 5TPWA 1RR6A 2ZIFA 1G64A 2GYWA 3CTMA 4HAWA 4PIPA 4V0NA 5DNDA 4ZCQA 5B2EA 4IIEA 1O4WA 4MHOA 1E99A 1U8YA 3LM8A 3RIYA 1JHPA 3SSAA 1UEXC 1FW6A 3EEFA 3EXG1 2J9GA 4OJQA 9MHTA 4CMHA 2ZVQX 4XFJA 4Z4QA 4CEJB 3FWPA 1UMDA 4BEBA 3SFTA 1GA6A 1HH4A 4CU2A 1CK4A 1Z0IA 2Y4NA 4OHOA 4IIFA 4W1RA 1W76A 2VWQA 1RRGA 1RKXA 1OZFA 4JB3A 1JQDA 1TZMA 4FEEA 5IH7A 1KK3A 4JL6A 5HGXA 4MWCA 5IK2A 5JG7A 4BNXA 3AUXA 5IDXA 1KQPA 1QGOA 4P3XA 1XRPA 1SUPA 4CCYA 2ZROA 3TJRA 5K01A 3WKDA 4PZDA 3QXXA 2CFIA 4WCFA 1KAEA 4GMDA 1XQXA 1CZOA 2W2OA 3SN6A 2JGDA 1X6VA 1OFIA 1G8MA 2Q6OA 4GL4A 4UQLA 2A0WA 4RIFA 3K6RA 1QIFA 1LX6A 5JZOA 2Q5LA 3TMAA 3UAZA 3FUWA 5EIEA 2EFHB 1AN0A 4RAOA 4R83A 3EDCA 2Z95A 1QMGA 4NV1A 5T6BA 3MBKA 3Q7RA 3ZEAA 1M6EX 1WO8A 2V6IA 4M9UA 4RACA 4UCFA 2FMXA 1JECA 1SKAA 5EPUA 1VGRA 1S5PA 1KBOA 4IQ4A 3TH5A 3ABQB 3P8ZA 1A9YA 3GFGA 5JS2A 3O8QB 5FWDA 4PBSA 1POWA 2IQ5A 4TWIA 3RK4A 5H5JA 4GYJA 2YBDA 3SYNA 4EI9A 3BC1A 1FIUA 4XGRA 1W2GA 1EA7A 1JXMA 2J3LA 2YXEA 4R2JA 5FYQA 1S1MA 2R8ZA 1OLUA 5IPFA 3M7IA 5A2QA 5KPJA 1TT5A 1RLJA 2AJDA 5IJZA 1SVNA 4FKBA 4PX3A 2QR3A 3H17A 3ZE9A 1UFRA 1FP4B 4UCXA 3B8EA 4H35A 1LRJA 1S3SA 1EGHA 3GRRA 4OYRA 5A1JA 5TVGA 3ZDAA 2X23A 5EUMA 5EEHA 1YO6A 4JYPA 4YXWA 1O8BA 2MOKA 4ZHSA 3NTOA 4WN9A 4R3NA 2WMNB 3ONWA 1ICIA 4CM4B 4F9EA 5LBIA 5BV2P 1M34B 1VB5A 1V5IA 3D54D 2CZGA 2HHJA 4KQFA 4PO8A 3C5WP 6REQB 4AT1A 5KB3A 3T7IA 2XZDA 3FHLA 3PVCA 4X5OA 3KVRA 3CEHA 3U4QB 4ZDJA 2V5UA 3D0KA 4RXUA 2M1XA 2O8DA 4X3OA 1ISJA 4R51A 1A2OA 4LI3X 3GRCA 3HG7A 2VCEA 5KO2A 1TIBA 3GJ5A 3BMOA 621PA 4CMAA 4GM4A 4TUYF 1WMAA 1NPDA 4WCVA 3NT5A 1OLUB 1P1KA 1ECLA 3OZFA 4GXRA 3T1QA 3VH3A 4AP6A 4DEVA 3SWWA 2G7MC 4II2A 4QBFA 5KQLA 3UJCA 4O25A 3OMWA 3O38A 3NLLA 4ZMRA 1CQZA 1GPMA 1OQAA 2X4IA 1RKUA 3BE6A 4HN9A 4O5OA 4PAGA 1TIKA 2NYAA 3NBYC 3URMA 3TW6A 3FNIA 3AM1A 3DYIA 4ZVOA 4ZV7A 1XDUA 1FSSA 3GLFE 1FS4A 5JQGA 3N2GB 2R66A 1VPDA 2MSKA 1N6NA 2REQA 4W9NA 1NJSA 2J0VA 2GXSA 4MZXA 2DH5A 3LBAA 3PFWO 4Q1BA 5AM0A 4E07A 3BRWD 4P1ZA 4HYEA 3R4VA 5DH9A 3FG9A 4EG6A 3KJNA 1D9XA 4H1HA 1K6JA 2WEKA 1OYVA 5HWSA 1P29A 4X7MA 1KSHA 4I1SA 1WPQA 2WVJA 2B21A 2WU4A 3H9CA 3QTTA 4UFNA 4L6IA 4N7BA 2JZOA 1JG4A 3VU0A 3HCPA 3PQDA 2JFQA 1GG8A 1UK8A 1WIWA 2GK6A 3JATB 3MRXA 2NO9A 1NHWA 4R84A 3CVVA 4QRHA 4FINA 4X97A 4UUAA 4LF9B 3L1IA 2OV1A 1KQFA 1G66A 3IAM6 4I19A 5EZYA 4NJEA 3H99A 4FGZA 4W1PA 4N8SA 3RANA 4ANFA 3U1TA 4WGGA 3JQ9C 3USCS 2W6ID 3ZVMA 5FBQB 5JVDF 4BWGA 3MMZA 2RHBA 3B2NA 2C3OA 2ZBFA 4O5AA 3H11A 4XCQA 4Y6SA 4LWQA 3I45A 4FGWA 3I04A 3NETA 1KARA 1VLMA 3EXFB 2BE9A 1H0RA 1P1JA 4TVSA 1KZ6A 3LKDA 4YAWA 3VSCA 3AXTA 1U0JA 2I2CA 3SQDA 3CF4G 1FQJA 2WU3A 2HZ7A 1RYMA 3PXUA 4TTQA 5K3SA 5EIWA 4YRFA 1DBSA 3UMMA 3DT6A 2UZAA 1QYVA 1VL5A 2I8CA 1RC8A 1YGYA 4MTCA 4LRUA 1N2OA 1D6JA 2GTIA 3OZWA 4MIEA 2J3JA 3TCXB 5EJ9A 2D2IA 2FQYA 2WJAA 4D81A 2P6MA 2C1ZA 2B8NA 4M8LA 2Q2QA 1WXHA 1VL6A 2J9RA 3E9NA 2G9NA 2B5WA 2H2FA 4CLDA 3VDRA 4UQPA 1I14A 3TQFA 4JJIA 2RGUA 3EFOB 2D3WA 3AY7A 1SVLA 4LNUB 4RZ2A 4ME6A 3K0CA 1WDWB 2QG9A 1P62B 4ZI5A 2OZKA 2GZSA 3H3FA 4BP8A 3KYJB 3IT0A 5JSUA 4DUZB 1ORTA 4YYEA 3RUPA 2GYVA 3FNEA 4E94A 1CUJA 1L5VA 2XUGA 1M83A 3SR3A 1E89A 4ZZ3A 3X1XA 1GZUA 1FNBA 1H2WA 1TGVA 1PS8A 2DY1A 4HDNA 4X20A 5DP1A 3ZJVA 1J4AA 2CGEA 4UQOA 1VLHA 2H29A 2VHXA 2ZBDA 1IOLA 4R98A 4Y30A 1HDOA 3UTDA 3P45A 1F2DA 1WCXA 2UVPA 3ETNA 2ZB3A 1NASA 1VLLA 3WGUA 1XG5A 2O2HA 4IDNA 3SKXA 5LIRA 2O8FB 2DU8A 1OXTA 1CJKC 3L6EA 5DGXA 5CVTA 4CDNA 4ZARA 3K70C 1Y3AA 5J5AA 3ZWMA 3VUEA 2DHDA 2OEPA 2ZXFA 4O2AF 1NOKA 2HF2A 1HORA 5A0VA 2WB2A 5JD6A 2PQ2A 1C1YA 1XI2A 2FQQA 3HACA 4TXJA 4AJEA 4H3HB 3PC4A 4BNLA 2PG3A 4PPQA 1F3OA 2QK4A 1JLMA 2H16A 3ONVA 5P21A 1CR2A 4I1OA 3TB4A 2YXLA 1OE0A 1ZW6A 3DPSA 3KC2A 5ICCA 5IULC 4D1YA 3HYTA 5CP8A 1G6Q1 4CBVA 5BN4A 4IDAA 1RAGA 2ZRKA 3MJEA 3MS2A 4DCMA 3SQWA 1XNJA 2B2NA 4DSTA 3NANA 2P41A 2ZR0A 1CXZA 2ZRCA 3LXXA 3LYHA 3M3HA 4KUHA 1J5EB 2DLCX 2ID9A 2Z98A 3PFIA 5LXTB 3VR6A 2JI6A 1KU0A 1EXWA 3TLXA 2RH8A 4DLPA 3KZNA 4QVIA 3GT7A 3ICWA 1GXSB 2DE0X 4FUQA 4LVNA 1EJBA 2R6DA 4BNUA 3KEQA 2FZGA 2XMRA 1KORA 3SZ3A 2UAGA 3ULKA 1Z5PA 3OQOA 4A26A 2AMYA 3CY6A 1J21A 4N0MA 2AOXA 3H8JA 4DIUA 3VSEA 5LKAA 1ZSYA 3IQDB 3E05A 4HQ0A 1QU3A 1UK7A 3N76A 3DMDA 1JG3A 1FDUA 3KEFA 4HLQB 3P2OA 4Y2TA 1Z29A 3OPYB 5JJ5A 3UYLA 1CVIA 4QGAA 3CB4A 2ORIA 5I01A 2NP7A 4AROA 2FFHA 1C2YA 1E8MA 1T35A 4AU1A 3KEGA 1V48A 3OIYA 4LY9A 2RH4A 5IYZA 2QU7A 2QLLA 3TINA 2A1IA 3ECCA 2YFHA 1JVBA 5IABA 1I8TA 1JTEA 3ZH2A 1Q15A 3IHLA 3PU6A 4QOJA 2ENWA 4X95A 4GWGA 2PZFA 4Z7OB 1VP9A 1SXQA 1EQAA 3T3NA 5L3VA 3BKWA 1KOJA 1JE0A 4FT2A 2WLSA 1PR1A 4Y67A 1DJPA 3NP7A 3WZLA 4XUEA 2JFXA 3EMVA 3OP4A 4C1BA 4ARSA 4EPXA 1IN6A 1TJ4A 4HGRA 2JRLA 2I8LA 2O3SA 2O3UA 4WK2B 3TLMA 2YJTD 3RV4A 2OZLB 4IOJA 2H31A 2IDZA 3A1CA 5L7YA 3WGQA 1S1CA 4HAIA 4C0JA 3MD0A 1X7ZA 2G4CA 3IPLA 4OYLA 1CEYA 2X22A 4UHDA 4O08A 3ZJ5A 5HQTA 3EFEA 1MRSA 1NSYA 2P5SA 3DV2A 4GR5A 3H1GA 4MR7A 5JYEA 2L2QA 2P7HA 2WWRA 1BE1A 3F3YA 4YN3A 3FVVA 1A50B 1KP2A 1QO7A 1GO2A 2F3UA 2JATA 2WSYB 4A36A 1XZHA 2XGGA 2NYVA 3EDOA 1ADBA 2ZE8A 1Z0SA 2CLEB 2O6HA 2XGSA 1COWD 3WGVA 3FSGD 4DS3A 3M3DA 4DCOA 1B3RA 1DLIA 4L4ZA 4ZI7A 3LO5A 2IZ0A 1NUQA 4AG6A 4X00A 3I0NA 4ARCA 4DLXA 1FUKA 2OXCA 2QORA 3DM5A 4XCVA 3VZPA 2ZYDA 3M6IA 5LZ7A 1QUEA 2NZWA 3LW7A 4DBLC 3TRFA 3LVQE 3QEOA 5JROA 4ZMBA 2XB2A 5ICEA 3B9QA 1DXYA 5FUXA 1KS9A 2WUGA 4C4OA 4M86A 4LVUA 2GAFA 3EGOA 2XI4A 1ZONA 4OEHA 2EG5A 3M2TA 1QGUA 3CZRA 1VBNA 5ILOA 4P4UA 3UAVA 2JH8A 4F6CA 2O23A 5ITZA 4N41A 1BRMA 4ZGWA 5FEUA 3AF2A 1TVEA 2WF9A 4FOSA 2VJAA 4QUBA 3W34A 1MC4A 5DSZA 2HO5A 2G06A 3HV0A 5A6VA 1CZRA 1SULA 3H5VA 2XHZA 1HTTA 2FPGA 2RGYA 1OTXA 2Y1WA 3H19A 3IELA 1WD5A 3A1EA 3HI6A 1DEHA 1MV8A 1EE9A 2ZUBA 4IX9A 2V7UA 1JJFA 3EPRA 4Q3EA 4MYDA 3AH8A 3FMOB 3H42B 3VOAA 4QZVA 1NV8A 1WXXA 4L5CA 2RHTA 3K96A 5IAAA 1X1EA 3UXEA 4EKIA 3MWEB 2IYPA 1NUAA 3WIDA 2B1QA 3O8BA 2ZK7A 4FNAA 2FZKA 1SOUA 1VHQA 1KKUA 1PR9A 4PG6A 1ZHOA 2WW8A 1MEJA 4H7IA 4UREA 3PIIA 5L40A 3Q3EA 5BQOA 2C0PA 3U4DA 1W25A 1FMFA 3UW3A 1KBZA 5KMGB 3W3AH 1XEWY 2C7PA 5F51A 4AF7A 3VNUA 1JKJA 1R0ZA 4RTSA 2YIDA 4EAQA 3AXSA 3B36A 3IUBA 4JX8A 2RIRA 3BRWA 4O3FA 3K9CA 1C0EA 3CRRA 3K9QO 2ZJ1A 4UTZA 1M0SA 4ZVRA 5LP6F 3S3TA 1DCKA 1I13A 3NKLA 3PK0A 2MSCB 4QEDA 5G4KB 3RD5A 3KE8A 1DAIA 4PC1A 4URYR 2JGFA 4ZV4A 1Q1QA 4P4TA 3QIVA 4U1RA 2QQEA 2Z5GA 4V2UA 2AEMA 3CN7A 2YN0A 4GDFA 2HCTA 2HOQA 2M9MA 3ZWVA 2PK3A 3L5OA 3TMKA 4AN1A 1K08A 4NU0A 5K05A 1DBQA 2VH1A 3DZHA 3O5AA 4EJSA 4I9NA 4QBTA 4W1QA 3RARA 4NPAA 1SCNE 1TF7A 4HMOA 4MKRA 2FR1A 2GFIA 1AURA 1WCV1 3K20A 4OFXA 3TTUA 4FYVA 5H16A 1I3LA 3IJEB 3QJGA 1UZNA 1NW5A 4LWZA 4LWOA 4BQRA 4C03A 4C9BA 4UTPA 3GFQA 5F52A 3A1FA 4FPXA 7MDHA 5K4HA 1YIOA 1MW9X 2YASA 3RBVA 4MPRA 4L8WB 5AH0A 4QNNA 4B6RA 1DOHA 4DZRA 2FAXA 4I1YA 2OBMA 1WU7A 5A7FA 3IA2A 4HLCA 3A10A 3H4VA 4F9TA 2P78A 2R8YA 3KU4A 4L8VA 4TKUB 3UUGA 3WNZA 3NIDB 2KQUA 2V5VA 4HMQA 1QVAA 4QPPA 1ODTC 5DCUA 3CCBA 3U7QB 4FR5A 3CE9A 1T36B 4TLMB 4OI4A 2NW6A 1GLGA 3S1SA 2A1UA 4N03A 2ATCA 3NWJA 5IWAB 2GETA 4JGBA 5A0FA 4QGSA 2ZXUA 4OQEA 1BFKA 2W37A 4Q34A 3S99A 4PNEA 4E4YA 1RLOA 3LNCA 3DA8A 3P0HA 4RA6B 4LHZA 4U2CA 1UBSB 3QFFA 1IG0A 5JADA 3P9SA 2P2GA 4YRSA 2Q2OA 1OT5A 1JKMA 4HLDA 3TQCA 1QHGA 4A3SA 4OGGA 3IV9A 1TKBA 2V7GA 2DUNA 1QZTA 3MXOA 1QDEA 4UHFA 2BFMA 3KVVA 4X8OA 1Y6FA 4PIMA 1ZGHA 2IBTA 4PLZA 3OG9A 1M10A 5BN5A 3AYXB 2M6KA 4KO3S 3V97A 1DHTA 1NRIA 2RHWA 1RRCA 4ZDIA 2GWHA 4O59O 3FI0A 4L3VA 4YHBA 4CF6A 4YCNA 4K40A 1ZI8A 3ZDDA 1OZ0A 4OUKX 3SR4A 1U8UA 1X77A 4EAAA 3CG4A 1RLUA 4EYQA 4H2DA 1P17A 2GTPA 4IJ6A 1U28C 4CM3A 4DL9A 4DOMA 5I7HA 2OUIA 1AUPA 1YCDA 2OZLA 2R60A 1TI7A 3CLRC 4DLLA 4CL0A 2QYTA 4BB5A 1K4YA 4JT9A 2OPHA 1C3LA 4C0KA 1APBA 1E79D 2X5XA 1OKKD 4DM7A 1QQBA 2GERA 3M5PA 1I24A 4DLWA 4RTRA 1EK0A 1L8QA 3E4DA 4N82A 5BWCA 3GLIE 5A9RA 3ANNA 4NU5A 1QX4A 1VFNA 4E6EA 4N6NA 1XK7A 1PT6A 3V7UA 1QYDA 3AF5A 3KTFA 4PGHA 1B41A 5LOVF 2PIDA 2Q7XA 2A67A 3TLEA 3Q2IA 1LK7A 2Y05A 4C6HA 4AJJA 4ML3A 1MAVA 1SEVA 4ZT7A 3H16A 2IH5A 3P9ZA 2NTJA 4BP1A 4JXZA 1T3TA 1I5RA 5K8UA 4M22A 1SPXA 2QW1A 2X3YA 3LDGA 4U7HA 2F3PA 3KP1A 5T8KC 4CMIA 3GZNA 2ZJZA 3V9PA 2BMAA 3KZCA 1L7EA 4KXXA 2FSUA 2BMWA 1E2JA 3LDFA 4GT1A 1XP5A 4H7PA 4HMPA 3IQWA 3QU2A 4MUKA 2VRCD 2FUG6 1EP2B 4A2WA 2VPPA 5AYVA 2ZUEA 5BXQC 3W9SA 4BLOA 5HUHA 5F12A 4DCJA 1KI6B 1EUDB 5KOJB 1VE3A 3A58B 4EI7A 4L3OA 1A71A 1M72A 4WN3A 4ALLA 1R6TA 4C5BA 3M81A 1COZA 3UJ7A 4RLSA 4EZIA 4EW1A 1C5KA 2YDYA 4S04A 3T52A 1LK0A 1ZLYA 2B25A 2A0XA 3KHTA 3G9TA 4L1KA 1QK3A 4L57A 4Y2UA 3RC9A 1I2CA 4D8XA 3LBIA 3OD5A 3WC4A 1ZD5A 2RE8A 2XUFA 4JT2A 2V4MA 3AONB 3OLZA 3NHLA 1PNTA 4MYUA 5E2BA 4EMBA 1YCHA 1X74A 4TV8F 1UC9A 2OO5C 4U2GA 1LTHR 4DIBA 2QWXA 1DAFA 1SXJE 4ND3A 2IZ1A 2G9QA 2OLKA 3IP1A 4D44A 5ICFA 1M6WA 1UEJA 3RRXA 5BNWA 4DRZA 4RK7A 1U63A 2MYPA 2NZYA 3BL5A 4RIEA 3GEMA 3SYMA 5AVQA 3THWA 2I4MA 3NBXX 3MHPA 3AUUA 3GUVA 1R4AA 3N70A 5K0CA 3GNSA 4KQ2A 4B3CA 1RHRA 3PE4A 2EJBA 3OIUA 1ZJJA 2AFHE 4EJ6A 2PO5A 4NTZA 5NLLA 1T4MA 1I4DD 2BVNA 5AVRA 4YJ2F 4DBZA 2PQ6A 1J5PA 1R0YA 2YHAA 1LDBA 3ZY6A 3O3CA 2FPGB 2NZXA 3BWBA 4BZQA 4C7KA 2GCGA 4LJ6A 5AXAA 1SXJA 4MYSA 4V0ME 4YVFA 1PG5A 4UPEA 4YJFB 1JR2A 3BWVA 4HAYA 4NZPA 5CB4A 4YDHB 1XRRA 2IIBA 4Z1OA 5ES4B 3PG5A 5ERYA 1UXIA 2HPVA 1GUFA 1HOTA 4HVAA 3BCRA 1YVDA 4H59A 2EARA 4MW9A 3IJ5A 4UFPA 1ULBA 3EA4A 4B85A 3L40A 4R1UA 4YQEA 3QPWA 1MKYA 2BGUA 2C94A 3M4XA 1TA0A 4ITVA 1ZU5A 3A4YA 1JA9A 2MJLA 2OO7A 4R0NA 4CIVA 1IQUA 2NUBA 4HDRB 5HOQA 1A9SA 1XWFA 4K6HA 3AKCA 4CKWB 1VI6A 3BN3A 5AO9A 1KYTA 2EBHX 2XTJA 1U31A 4CT0A 3HTXA 1UDRA 4J0HA 3WBKA 3F5MA 3MT9A 5DISB 1YFJA 3WL5A 3OSZA 4CEHA 3GZTB 2A0YA 1EZZA 4IVPA 2LKCA 1B43A 2JFBA 2ZDGA 3HV2A 1C7IA 5GVSA 4X45A 4YWJA 2BSXA 5TMBA 5CVCA 3VHXB 3PDCA 4JDUA 4YUWA 5K3EA 1IM5A 1KP3A 1Q0PA 4NG4A 2IX3A 1D0SA 5M7EA 5J4HA 1V1JA 3EQZA 3GLHB 3QE9Y 4M1OA 2MYTA 1EQ2A 2CD7A 1U0FA 3GJ4A 3OTIA 3E7FA 3RI3A 1RJ9B 4XD2A 5G3ZA 1YS6A 3VYUB 3WIEA 3GAMA 4YRCA 3ZBPA 4BQFA 3LP5A 1Z5GA 1FYEA 2GUWA 2A7QA 4KMRA 4CMJA 4DLYA 5J2TA 3WK7A 3IKMB 1VKHA 3WR5A 1L6IA 1ZESA 4NQZA 1QIMA 4B2PA 2HBQA 4JUIA 4DJDC 1FJHA 5CUQA 5AJYA 2RI1A 2GF0A 1SGWA 2Q8PA 1RWPA 1YWGO 2R6AA 4Z86A 3U40A 1Y7LA 2G4VA 3PEVA 1RI2A 4HFJA 1DZ3A 4EATA 2IXAA 4X44A 2DP4E 3U5ZB 4R69A 4YBRA 4XR9A 4PYKA 4Z3DA 3BXXA 3NVAA 2QP3A 1TYDE 1TEVA 2W2TA 3PI7A 1XLTA 5LWHA 2WSSD 2D1SA 3QNUA 2E21A 1T2DA 1CNMA 2YHIA 4NENB 1B8UA 1DOAA 2WNHA 5EFZA 3RNLA 4BAUA 1OBOA 3C3EA 3PE3A 4HATA 1A95A 4C4PA 1U7XA 1TEHA 5JLJA 1UJ5A 5DU2A 4JP2A 4QUAA