1T2AA

Crystal structure of human gdp-d-mannose 4,6-dehydratase
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
347
structure length
338
Chain Sequence
RNVALITGITGQDGSYLAEFLLEKGYEVHGIVRRSSSFNTGRIEHLYNMKLHYGDLTDSTCLVKIINEVKPTEIYNLGAQSHVKISFDLAEYTADVDGVGTLRLLDAVKTCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYGAAKLYAYWIVVNFREAYNLFAVNGILFNHESPRRGANFVTRKISRSVAKIYLGQLECFSLGNLDAKRDWGHAKDYVEAMWLMLQNDEPEDFVIATGEVHSVREFVEKSFLHIGKTIVWEGKNENEVGRCKETGKVHVTVDLKYYRPTEVDFLQGDCTKAKQKLNWKPRVAFDELVREMVHADVELMRTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Biophysical Characterization of Human GDP-D-mannose 4,6-dehydratase
rcsb
source organism Homo sapiens
molecule tags Structural genomics,lyase
molecule keywords GDP-mannose 4,6 dehydratase
total genus 124
structure length 338
sequence length 347
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.47: GDP-mannose 4,6-dehydratase.
pdb deposition date 2004-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1t2aA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1t2aA02
1WMAA 4UVEA 3IQDB 4YAGA 3JQAB 1LUAA 1JKJA 1YDEA 2QG4A 4JBIA 3KTDA 4BMSA 2P9GA 4CLXA 3FD8A 1PQUA 4QX6A 2WWRA 2IODA 3KSUA 1MUUA 3GG9A 2CDCA 2XXBA 4PRKA 1GD1O 4NJOA 4CUJA 2I3GA 3LT2A 2Q2QA 2HMSA 2OFPA 3GR6A 3QWBA 2IEBA 4B4VA 4J16A 3G49A 3H9GA 2NSDA 1EVJA 4YBZA 5L53A 5THQA 2EWMA 3ZWNA 1BW9B 4UUOA 3WYCA 2ZIZA 5JXWA 3QJ5A 3S2EA 1YE3A 3QWIA 4JGBA 3E48A 3ZW9A 3RJ9A 2C5EA 4CM4A 1DIAA 1DRWA 2PGJA 1E77A 3TPCA 2GN8A 1EDZA 4Q3NA 1R6DA 4IJWA 4RVSA 4UUNA 4Z6KA 3COSA 3UCXA 2AQ8A 4IGFA 1IHXA 5F5NA 4FFPA 1H6AA 3TZQA 4P4GA 4E2XA 4XDYA 4CMIB 1E7QA 3GA0A 3NTRA 2BGMA 4E32A 2X9GA 1BGVA 4HWKA 2Q1TA 4O5OA 4Z3DA 3GPDG 1GY8A 3E6AA 4WPGA 1D7OA 2X9NA 2UYYA 2QZZA 1AXEA 4IIVA 1U4SA 1U1IA 1H9AA 5CDSA 4CM9A 3PYMA 3JV7A 4XYGA 5FF9A 4L4RA 3FHLA 4II2A 5ICSA 3IIEA 4BGEA 3AM3A 3UW3A 1IYZA 1E3EA 5A9SB 4OYRA 5CPBA 5I7FA 1HLDA 3HZZA 3AFNA 3D4PA 2G0TA 4D0RA 1DC6A 1E1MA 4BNTA 1NFFA 5F5LA 1CQIA 1HDGO 4K6FA 1GUYA 2H6EA 1ZEJA 3JQAD 3L77A 3M2PA 1B2LA 4HKTA 4BHTA 5JAMA 5AXDA 4H15A 3EHEA 3ZU4A 3QLJA 1N92A 4ZQEA 1E7WA 3GNTA 5KJFA 1N1GA 2HRBA 1EK6A 1E7SA 1YL5A 1DEHA 3B6ZA 4PVDA 1OC2A 9LDBA 1E1NA 3HNPA 3JD2A 4WCFC 5TS3A 1E7MA 3NKLA 1L1FA 3GHHA 2DM6A 2GNAA 3PQEA 1HRDA 1NVTA 3GQVA 1N7GA 1LC3A 4BNKA 3RFVA 1Y8RB 4XZ3A 4YXFA 5CFZA 5I8WA 1KEPA 2VNAA 4BIIA 4E5KA 5MDHA 1P1KA 1HDYA 1I10A 1ZSNA 1H93A 1N9GA 1K0UA 1DRVA 4D79A 3TZCA 2OGUA 4IZHA 3GNSA 4AJ1A 3E82A 3UKOA 5AQ1A 4RZIA 2VZ9A 3UGKA 1U3UA 3IUSA 5THKA 1C0PA 2VN8A 2B5VA 1NFRA 3KUXA 4WCFA 5U4QA 1XQ1A 1I8TA 1R15A 3EDMA 4RL6A 3RU9A 1QSGA 2RAFA 3PZBA 1E3IA 2GR9A 2XXJA 4DUPA 2GF2A 1ZKMA 1YQGA 2VT3A 2GYYA 2ZCVA 1YH3A 3I1JA 4NZ9A 5T67A 5KJ6A 3UH1A 4WOJA 2HO5A 2YHUA 3PWZA 4IGEA 4IQ8A 3RROA 4XYEA 4PLTA 1G0OA 1LA2A 4HY3A 1ONNA 3MTJA 1GCOA 4YJHA 3TZKA 2WM3A 1GADO 4W4TA 4G65A 2GN9A 1U9JA 4MKXA 3P5SA 4OM8A 5IFLA 3H9UA 4YJFB 1Z82A 2Y1OA 1SBYA 5KIAA 2FMUA 5KVSA 2O7SA 4EW6A 2O3JA 3ZWYA 1NTOA 1Z7EA 4YRAA 4RV9A 3DR3A 1WP4A 2EKQA 3BTOA 1Y8QA 1OZAA 3OETA 4Q3CA 1HDOA 1YGYA 4MVJI 5ICMA 1PJSA 5EERA 1B26A 4CV1A 2VOEA 1QR6A 4L9RA 3ICPA 5IF3A 3M2TA 1E92A 4AFNA 2JCXA 3K92A 4CM8B 4U5QA 4PVCA 1XDWA 4U7WA 5KJEA 4Y6SA 1V0JA 4RF5A 4KWHA 4RVUA 3GLQA 3ZNPA 3TDKA 1OC4A 3C3XA 1KY5A 1XCBA 1HE2A 3LC7O 1LSJA 1K6IA 1KYQA 3JYQA 1NAIA 3CINA 4ND3A 5EQDA 4R01A 2O2SA 1FDWA 1VKOA 2Y1GA 5L4NA 1PEDA 2FRDA 3OIFA 5DF1A 3PDUA 1J0XO 2PLAA 2EP7A 1IY8A 1KOLA 4K26A 3BMNB 3F9IA 1DRUA 3GG2A 1H6DA 3MTGA 1QV6A 4CMKA 3WMXA 5MGBA 3E03A 3UCEA 4TZTA 3ZN2A 4R5HA 3IC5A 1XLTA 2QRJA 4CJXA 4NK5A 1S7CA 4BKUA 4BNIA 2HSDA 2XAAA 3DWFA 3S2FA 2HU2A 3VPXA 1A71A 3GDOA 4AJHA 4ALKA 3RAJA 3HDYA 3D7LA 2QW8A 3GGOA 4PLHA 4DWVA 4U0JA 3WXBA 1U8FO 1T1RA 3ADPA 5T8KA 1H5QA 2DFDA 4XQEA 1QLJA 3A28A 4ZQGA 2HK9A 3GGGA 3EY4A 4GX1A 1UAYA 1WMBA 1UDBA 2GCGA 1PJ4A 2UUPA 3FWNA 3KETA 1C0IA 3KRTA 1A27A 1E3JA 4ROSA 1DHTA 4KZPA 2VWHA 1ZK2A 4CV0A 4XGNA 1YBMA 1VSUA 5L7TA 4W9NC 3ULKA 3CH6A 3FI9A 4R9SA 4ZU3A 1NM5A 3WGOA 4MP3A 1BXZA 1HDCA 5H81A 4DLBA 5B1YA 1B14A 5CAEA 3WSVA 3S2GA 1LLDA 4OMUA 1EE9A 3LLSA 3DZKA 2EGGA 5JPIA 5LCXA 2Y93A 4C7KA 1BHSA 3VZSA 1FDTA 2NTVA 3MEQA 5EESA 1ID1A 1HE3A 4ZGWA 3VPFA 3NEPX 4BNVA 1YQXA 3JQ9A 2EIHA 1HYGA 4YT5A 3ETGA 5A9TA 4UVDA 1RJWA 2HMVA 4H3VA 3UOGA 1JVSA 4TRMA 1LDBA 1IZ9A 2X0NA 4C4OA 3N74A 5HRUA 3W6UA 3CTMA 4WLUA 3ST7A 3FNEA 1XGKA 4K6CA 4RVDA 3DONA 2V65A 3FBGA 4MIEA 2EKPA 2CSUA 3CPSA 1NWHA 2P4HX 3RSHA 4I9UA 1R66A 3L9WA 2H63A 3PHHA 3FNHA 3WSWA 4IQGA 5DDIP 5JCJD 3PIDA 3WLEA 1ENYA 1VPDA 2CMDA 3BA1A 1PWXA 2BRUA 3SJUA 3I23A 4GPD1 1OMOA 5JMWA 2BELA 1EFLA 4OSOA 1ZVMA 2X4GA 4OL9A 5G4KA 3RI3A 2NU6A 3V2GA 1R0KA 1X15A 1GL3A 5T6BA 1ISHA 1WVGA 3HWRA 1R37A 1ZZEA 1L7DA 1TT5A 4N5NA 1YO6A 6ADHA 3VKVA 1XWFA 2C0CA 2V7PA 4ND5A 2BF7A 4CQLA 4CM3A 4ZA2A 3TOXA 3ZWXA 3LK7A 4XX0A 1H9BA 1NR1A 1JKFA 2D5CA 3K2EA 4XIYA 3WQQA 5IAAA 1LDGA 4CV3A 3U49A 4ZICA 2XF8A 2ZCUA 3B70A 4TZKA 4PLGA 4UULA 2JHGA 2JKVA 4CM4B 1PWZA 2GO1A 2X0JA 4Z0HO 3TJRA 3RQSA 4YT8A 1JA9A 2GRAA 2YHIA 3R3SA 1E7RA 2VYND 4Z3KA 3OJ0A 2BH9A 3TF5A 2I99A 4W7HA 1X7GA 1PZEA 4YDRA 2HMTA 4J9UE 3RCBA 1KS9A 1NQOA 2YV3A 4GI2A 2GSDA 1A9ZA 4ND4A 3FSRA 4OO3A 1A4IA 4ALNA 3C8MA 5KKAA 1SMKA 1LBEA 2OP1A 2Y66A 3KV3O 1ZBQA 3VC7A 1BG6A 5IXSA 4AJJA 3T4EA 4W82A 1NQAO 1EEHA 5CPFA 1LRKA 1YL7A 3DZHA 3DZGA 4QT0A 1BXKA 1LLQA 3GUCA 4E31A 4NI5A 3OJOA 4GLLA 4EJMA 1UUFA 2W90A 9LDTA 4J3FA 5T5QA 2JHFA 4LW8A 3OEYA 4BNNA 4CR7A 5JDCA 4BV9A 3OSUA 1HWYA 3ZWPA 5L4LA 1T25A 2O4UX 1W8DA 3ETEA 2XPCA 3WX0A 3GEDA 1UP7A 1LX6A 2ZATA 5JY1A 1D4FA 3QA9A 1QP8A 4KTTE 2WE8A 3T7EA 4BNFA 4Z9FA 1LSSA 2B4QA 4EEXA 1MC4A 1GZ4A 3EK2A 3ROMA 2IZZA 3B20A 1J49A 2WYWA 3I52A 3JQ8B 5A5EA 1LJ8A 5ILOA 4K1LA 2Q4BA 4L8VA 1DDOA 1QYDA 4S1VA 3L6EA 1KERA 4E5NA 4J91A 4ILKA 1X0VA 2O4CA 1R0SA 2AEMA 2WDZA 3C1TA 3U3XA 3WYEA 5IDXA 1T2AA 5U1PA 1C0KA 1Y81A 1XEAA 3PTZA 2F1KA 4WCFB 2PGLA 3JQGB 3OF2A 3AK4A 2ZYAA 4UEOA 4G81A 4YAJA 3WR5A 2I5PO 4JNKA 4FSHA 4ALJA 1ADFA 1I3NA 2AW5A 4TVBA 4BNGA 1P1FA 1GEGA 1TA4A 3O8QA 5FI3A 5BSEA 4BNWA 5F1PA 4BOYA 1B7GO 2G1UA 4JK3A 3W1VA 4GGPA 5JFOA 2DBVO 4MKRA 3UAGA 1HZZA 4Q9NA 4DIOA 3WTCA 2H1SA 3PJGA 3MJCA 5BT9A 4WUVA 4BNJA 3JQBA 2ZTVA 4ZQHA 1YOVB 5DOVA 2WYUA 3K8ZA 1XKQA 4RF2A 5L40A 2AE1A 4ZHSA 3ZCXA 3LT0A 4IJVA 3PHIA 2AQHA 3ICCA 2AA3A 4HXYA 2NNLD 2Q1SA 3FWZA 3S8MA 1QLHA 4DPLA 1YJ8A 4FFRA 1JKIA 3OA2A 4J0FA 1U5CA 4J1SA 2D4AA 3QP9A 5G2OA 1A7KA 2CUKA 4RVFA 5JAQA 2DPHA 1MFPA 4PG8A 2PD3A 2AEFA 1MG5A 3LT1A 2V6GA 1Q7GA 3I9JA 3A06A 2X6TA 3H3JA 2W2KA 1A5ZA 3OP4A 3PWSA 4YACA 2J5QA 4TMFA 3RWBA 2JD2A 4IQ0A 4P4LA 4FFNA 1EMDA 5DT9A 1T2CA 3KB6A 3VPSA 3WTBA 3O4RA 2BHLA 3FPLA 2A9FA 3NJ8A 1T2FA 3GGPA 3WJAA 5G4KB 4D7AA 4HFNA 1N1EA 4YEDA 3WQRA 5EIOA 4GWKA 2C59A 2HUNA 4NBTA 4GVXA 1RYDA 4I9HA 4EJ0A 3M6IA 3RFXA 1MXHA 2FHSA 5JE8A 4IS2A 1PS8A 3LC2O 2VHYA 2CNBA 3O9ZA 3KYBA 1G1AA 1HDXA 1RM5A 4PG6A 4EITA 4Z9XA 2YDXA 4R68A 2BGKA 4AJ2A 4XYBA 1ZK1A 1XSEA 1I01A 4NK4A 3BMOB 3UFXA 5JYEA 1GV0A 5IN4A 3JYNA 2CF5A 3EUWA 4CM8A 2PGDA 3JQFA 2BD0A 3HFSA 2SCUA 1J5PA 3GOHA 6LDHA 3S55A 1EUZA 2EERA 3EAGA 3LYLA 1F17A 2VRCD 3LT4A 3WG9A 1PZFA 4GSKA 4Y67A 1DSSG 3ZV5A 4NFYA 4MP6A 4PIVA 2Y0DA 4UVIA 1WWKA 3V5NA 1P1RA 4CR8A 4DL9A 4CUKA 3AUSA 1IPFA 3BZUA 3WWZA 4O1MA 2Y67A 2IYPA 3T7CA 3VH2A 3F1KA 2UAGA 4U6QA 3F5SA 1HKUA 4MINA 3GH3A 1UZLA 3Q11A 1GYPA 3WBBA 5HA5A 4E4YA 2D0IA 4GKVA 1Y9AA 3U09A 2P2SA 2JL1A 3HDJA 2XOXA 3QY9A 1UJMA 1NQ5A 3H8VA 4PZEA 3RKRA 4BQRA 1B15A 1YL6A 4RQUA 1ZO8A 1ONPA 1N7HA 4O6VA 4B8WA 4EUFA 5CDYA 5AOVA 4XYLA 5DOZA 2JFFA 3KYDA 2DBZA 1EVIA 2IXAA 3ASUA 4B7UA 4CQLB 2J3HA 3H5AA 4ONEA 5TF4A 5HWSA 1YVEI 2WTBA 3DHYA 3F5QA 3GC6A 4P38A 2I9PA 4CL8A 2HK8A 3QWHA 1U3VA 5JDIA 1D1SA 1I2CA 4O0LA 3LLVA 2AQIA 3L9XA 3L6OO 5IDYA 4IDEA 2Q2VA 4BUCA 1KIFA 2OP0A 5A5FA 4LCJA 4OIMA 5FYDA 5BNFA 2YW9A 1M6HA 2G76A 1ZJYA 2X7HA 2DTEA 4ID9A 2C82A 4BO4A 5I7EA 2D59A 1ORRA 1Q7CA 1PZGA 1YQDA 5JS6A 3AUTA 3INTA 3KVOA 4M87A 4J49A 4DTIA 4E13A 3LDHA 3G3EA 2BKAA 1BSVA 1G6KA 2EW2A 4CQMD 4W9NA 3Q9NA 1JAXA 1JLLA 4RZHA 3WYBA 4AL4A 3PLRA 1U8XX 4ITUA 5JDCC 3JD4A 3F47A 1U7TA 2F00A 2GUGA 1UXIA 2W4QA 3FNFA 3FPCA 1Z73A 4L0QA 3H65A 1DLIA 5L9AA 4GL4A 1J4AA 1HT0A 1X1EA 1XA0A 2VQ3A 3U0BA 1ULUA 2DLDA 4KQXA 4XDZA 3UHAA 3QHAA 2V6BA 2DAPA 3IUPA 4PLPA 5IZCA 5TQVA 1GYRA 4N7RA 5GZ3A 1N2SA 5LC1A 4BNLA 2NTJA 1T4DA 1UAGA 4INAA 4WKGA 5TRTA 4RLHA 2VUUA 3CSDA 4CM5A 3EZLA 5CDGA 1NPYA 1GQ2A 1QXSA 4OXYA 3UXYA 3W4IA 3E5MA 3K9QO 4ND1A 4PG7A 1VC2A 1LXCA 3GF4A 3UCFA 4IJKA 4ZRNA 2G82A 2RCYA 2X86A 4I5DA 4WLVA 3VKUA 3WGIA 1NX6A 3K2BA 3SJ7A 5ADHA 3DC2A 3HDQA 4AJ4A 4CMHA 2J3KA 1YB4A 3L4BC 4D45A 1OFGA 4RQTA 1N8KA 1P9LA 4FOSA 1DXYA 2J3IA 3SXPA 4WNCA 3VH4A 4DMLA 1K3TA 1U2GA 3FTNA 3OICA 3ENNA 5C37A 3QIVA 1UR5A 1PJ3A 2X23A 1IPEA 3SLGA 2D2IA 1F14A 4DRYA 3H2SA 5ENDA 5EINA 2VRBA 5C7LO 3VZRA 3NT2A 5TSDA 1M76A 1VJTA 4FJ0A 3CIFA 1GCUA 4LGVA 4WECA 1WNTA 1W73A 2NLOA 4QO7A 5KWEA 4F46A 5G0SA 3KYCA 1CWUA 2D5AA 3EC7A 1KEUA 5KCZA 5EMHA 4AJKA 4CMIA 4RPKA 2Q46A 1P44A 4FR5A 3SC4A 3ROKA 3A14A 4JROA 5COBA 2D3TA 2WYVA 4PLFA 2W2LA 1LDYA 1Y5MA 5A06A 4IY1A 3QQPA 1GR0A 1RM4A 1QYWA 1I0ZA 4J7XA 5FWNA 5I7VA 1MV8A 2D1YA 2DBQA 1BXGB 3C7AA 3WGGA 1TT5B 3V2UA 4Z0PA 5L3ZA 4DYVA 1BVUA 1X7HA 5G0TA 1E6EA 1XHLA 3QVXA 1ZK4A 4JBGA 4O63O 3BMQB 3KEOA 2FPGA 4TWRA 1UXGA 1ADCA 3QV1A 2VWPA 2V6MA 4RPHA 3OQBA 4CODB 3U4DA 2BFPA 3VVCA 4BGUA 1GPDG 4LISA 3I9KA 1MP0A 4OOEA 3PK0A 4J1QA 4W6ZA 3AFMA 1P45A 2NTNA 2WE7A 5DULA 2GD1O 2DUWA 3AUUA 4PRLA 2Q45A 2FR0A 4GMFA 5K9ZA 1Z45A 3ZWCA 4G5HA 3DDNA 5BSHA 3G1UA 2Y05A 1LTHR 3GY0A 2YDYA 3PJEA 1CEQA 2Q99A 3E9QA 3ZWBA 1PL7A 3ZWWA 4B4OA 3QVTA 2CFCA 1PL6A 4DQXA 3W6ZA 1UXHA 1J6UA 1H2BA 3OECA 3R0IA 5I9MA 2EJWA 3P19A 2B83A 3JQ8A 4J2HA 1YDWA 5B4VA 3NTOA 2VTEA 2Z1MA 5CG1A 3ZHXA 4Y98A 3ZV4A 3VDQA 1QV7A 1WDMA 2ZYDA 1P3DA 3KSZO 4OH1A 5JNLA 3BMQA 4XYMA 4I9NA 5T8KC 3RC9A 3AY6A 4XQCA 4BKQA 2NU8A 4BO5A 4DYDA 1FJHA 1A9YA 4W7IA 5JDIC 1PGQA 4U0KA 4R1SA 1C1DA 3BTSA 3INRA 2YQ5A 1SC6A 3ZI0A 5DCUA 5JAZA 2PH3A 5JYDA 1O6ZA 5A3VA 3JQ6A 2ZKLA 1PSDA 3ONDA 3JQGA 3DAFA 3PXXA 1LNQA 4IIUA 1H94A 1K6JA 2P68A 4A03A 4BO8A 3PQDA 3PYXA 2X9VA 3ASVA 3PGJA 1EBFA 2HDHA 2I67A 3CEAA 4J1NA 3F1LA 4UEJA 1MB4A 4YB8A 2GGSA 4E0BA 3QW2A 1LDNA 4DC0A 2E48A 1K6XA 3BYZA 4D3DA 4E5YA 4NBVA 4L73A 1BXGA 4KQWA 2X22A 1E1LA 2ZQZA 4TROA 4N5MA 1O95A 3Q2KA 1PS0A 4EDFA 4LSWA 4BQPA 4EGFA 4ZJUA 1O8CA 2LDBA 3WIEA 2YUTA 3E5RA 4BNYA 4JN6B 1GEEA 3SC6A 3CMMA 4FDAA 1PZHA 1W6UA 1IHYA 1XU9A 2GZ1A 5JBIA 4R69A 1PJBA 1VJ1A 4JIGA 4CMCA 1WDKA 1I5RA 1NVGA 1PJQA 4KDEA 4YT2A 3B1FA 4CLOB 4BMNA 4TKMA 1C14A 3WNQA 4YTEA 3KM0A 4FN4A 1JDJA 2O3QA 5DN9A 3PDJA 1LSUA 3DBHA 4NQZA 3BMNA 4HFJA 1HYEA 2PWZA 4EBFA 3ZNOA 4DPMA 1TT7A 4NDNE 2I3AA 3H5RA 1YONA 5CDUA 2NADA 1DOHA 4YAEA 3ZNQA 4IXTA 1KVRA 1ZK3A 1S6YA 3ROQA 3HADA 1XYGA 3WFIA 1DFIA 1DJQA 4GLOA 4A27A 3MOIA 1Y8RA 2VNSA 3PI7A 1DPGA 1NP3A 1VI2A 4AJEA 1QYVA 2DC1A 1BTOA 4M49A 3VAZA 4XA8A 3CE6A 3K30A 2DKNA 4MKZA 4Q3AA 3S1LA 1MA0A 2VYVA 1HDZA 2PKRA 4CMGA 5A04A 4BGIA 1SPXA 3W8EA 3BAZA 4E33A 3AOGA 3NGLA 1EBUA 2YZ7A 4IS3A 2P4QA 3MWDB 4DXHA 1Z74A 2CVZA 1JTVA 3R1IA 3RASA 3VZQA 4DIFA 3TN7A 4YT4A 1NWCA 1WPQA 4D43A 4HNGA 4DQUA 5A05A 1QKIA 3C7CB 4NBUA 2W98A 3ZHZA 1NPTO 2B4TO 4I08A 2Q50A 5F3RA 3VHRA 3D0OA 3GEGA 1D3AA 3QWAA 3ZZNA 5K0ZA 1P33A 1NAHA 3AI3A 3BMCA 3DBRA 3Q9UA 3UUWA 2B5WA 1XIVA 4GWGA 2FP4A 3HN7A 2VUSA 1NASA 3HB4X 4PLCA 4MVJG 3HSKA 3V8BA 4GBJA 2CF6A 5DBGA 5L95A 2PY6A 2AG5A 3VTFA 3GRPA 3F4BA 4E5MA 1DAPA 1M75A 2PK3A 4QXMA 4IMPA 4JP3A 1SEVA 3H9EO 2BI8A 1DLJA 2Y99A 4R5MA 3RUHA 1IB6A 4HFMA 4KUGA 1TVEA 2GLXA 4II3A 3PJFA 3ZU3A 1O0SA 4HADA 3IJPA 1EUDA 7ADHA 2R00C 1ZNQO 2FWMX 1CRWG 2OOSA 3KYDB 3MJVA 5ITVA 4WLOA 5CP8A 3IKVA 3OA0A 5A9RA 3UVEA 4WNIA 5DBIA 1U5AA 2RH4A 3F46A 3JD1A 2W2LD 4E12A 3HE3A 2H5LA 4Q3BA 1WDLA 1CF2O 4YCAA 4BNMA 4B3IA 2GERA 3HJAA 5KTKA 1WW8A 1E6UA 1PX0A 4FGWA 4R1NA 3OIDA 1DIHA 1DC3A 3ZNNA 4FBGA 1NR7A 2UUOA 1I3MA 4JQCA 2ZQYA 4DVJA 1D1TA 4CLRA 3JQCA 1I30A 5GZ1A 1M66A 1PJLA 2IRWA 1IL0A 3ANMA 2YV2A 3PHJA 4XR4A 5KVVA 1A7AA 3PZRA 1C3VA 2CVQA 2O23A 2FPIA 5EJ2A 2RBEA 2ZB4A 2WJPA 2W8ZA 3GDFA 3DL2A 5KJCA 2B37A 2DVMA 4WOKA 3LU1A 4M8SA 4BO0A 5IJZA 4FCCA 1NFQA 4FOOA 3DEYX 8ADHA 3KBOA 1IUKA 1B3RA 5C7OO 5EN4A 4J4TA 4PN3A 4DLAA 3KYCB 3GVCA 2HK7A 3BTUA 3I3OA 3L0DA 5ILGA 1YJQA 1VSVA 3WICA 3C1AA 2E4AA 2Y1CA 1GDHA 3ZWVA 3HB5X 1I36A 3EZYA 3KLPX 5ER9A 4BNZA 4N5LA 1X7DA 3H9QA 2ZYGA 5CEJA 1SOVA 2NWQA 3AY3A 3DZFA 1U3WA 1E5LA 3OJEA 4LN1A 4M86A 4PG4A 1JQBA 4A73A 1MX3A 2ZK7A 5T64A 4NPCA 2J6IA 3UF0A 1DAOA 2LDXA 3LF2A 1LU9A 3OQ6A 5B4UA 3TZ6A 1DIBA 4OSPA 1MLDA 3IP1A 4O59O 1T24A 3R6DA 4R16A 3AM5A 3E18A 3GVIA 4EYEA 2BI7A 2EXXA 2PNFA 1FDSA 5TJHA 4CLOA 3RUDA 4AJLA 3BHMA 3DZIA 3O03A 3RC7A 3MJTA 1ULSA 4JXKA 1ZMTA 1Y5RA 4CMAA 3NGXA 1E3WA 1WLYA 3GN1A 2J8ZA 1PL8A 3G0OA 1ADGA 1ZK0A 5DCWA 3ONFA 1QRRA 3TZHA 2VHWA 4JX8A 3V2HA 4FJ1A 1XU7A 1KEWA 1VRWA 2NU7A 4F6LA 4AG3A 4PLWA 2NUAA 4XIJA 3LSYA 3EMKA 4CM1A 4IDGA 4OAQA 1LLUA 2P91A 5I9NA 2WD7B 2IE0A 4IUYA 4NJMB 1TXGA 5F1KA 3RBZA 4WLEA 4BNUA 5JSFA 1O94A 1EUCA 1LSOA 4PCVA 5DP2A 5GMOA 3I9OA 5COQA 3OJLA 4J4BA 1NXQA 1YBAA 5C7IO 2HJRA 4WJZA 5JCXA 2Z95A 1ENZA 4RVHA 1RM0A 4YQYA 4A26A 4GH5A 4BKOA 2Z5LA 1KC1A 3DMTC 2O48X 2PTGA 4LMPA 4GKBA 3PQFA 3TRIA 3PLNA 4MVJE 4ESOA 4MDHA 4BO2A 5C5IA 4MVJH 3I4CA 1DFHA 3TOZA 2YYYA 1RYEA 1ADBA 3NAQA 1GAEO 1RM3A 4F6CA 2X8LA 2WEKA 4D0SA 2EEZA 5I7SA 3W8FA 2HMUA 1E3SA 3B1JA 5ER6A 1H2HA 2X5JO 1EE2A 1WZIA 2FSVA 1H6CA 1SAYA 1EDOA 5TT1A 2HQ1A 1K5HA 2B35A 4JJGA 5TT0A 4CUZA 5B37A 1TB4A 2J5RA 4E5PA 1LRLA 3PIIA 3HG7A 1EK5A 1VKNA 2DFVA 4MVJF 4P22A 3KO8A 3RUFA 2GASA 1ISIA 4PG5A 4LVCA 5AXCA 2VRCA 1T2EA 3MJ4A 1NPDA 4D46A 2JFGA 2AMFA 2WSBA 1Q2XA 1IE3A 2EF1A 4BVAA 3ZWAA 3DHNA 3DO5A 2DTXA 4E30A 1R0LA 2NV6A 1DIRA 5L7WA 4CLHA 3TL2A 4OGWA 3JD3A 2C7GA 4E2WA 1BW9A 3W4JA 2P9CA 3GAFA 1JAYA 2JJYA 4KWIA 4CMEC 3KLMX 4LRTB 1M67A 4ALLA 1O9BA 1Q0HA 2X1HA 3O8QB 3ZWOA 4DPKA 4J7UA 4PLYA 4YJHB 3OM9A 3EVNA 3JQDA 3ON5A 4J7CA 2FR8A 3A1NA 2WD7A 5JC8A 3PJDA 1JU9A 1B8UA 3BXXA 1YWGO 3SEFA 3RBXA 3UN1A 3GNQA 3SBOA 1X14A 2J3JA 2VUTA 1LQUA 1VL8A 2B0JA 4BO7A 1B8VA 3GT0A 2EGHA 2VHXA 4K28A 3HHPA 4MOWA 3JSAA 5CDTA 4NHEA 1Q1NA 1YS4A 2RHRA 5KKCA 4YQZA 2EJVA 1IULA 1KVQA 1R16A 3PHGA 1UZMA 1AE1A 3RFTA 3DTYA 3E9MA 3I4FA 3QVSA 4A10A 1ZSVA 8LDHA 1SEPA 1PQWA 2YFHA 4I8XA 4R54A 2P5UA 3STHA 4LRSB 1MC5A 4FJ2A 1GYQA 3AM4A 5ES3A 2J5KA 3DZBA 3I9LA 1Q7BA 4AVYA 3U5TA 5TX7A 1O89A 1U2DA 2PZJA 1KVSA 2I76A 4R3NA 4I5EA 3GZNA 4XKJA 4YJGB 4A2CA 3VH3A 1GZ3A 2VTDA 1NNUA 4M1QA 2E37A 1R4NB 5LDHA 3GRKA 3DFZA 4MO2A 4YAIA 4KDFA 1PS9A 1UZNA 4CL3A 4R3WA 1KC3A 3D5TA 2BLLA 1ISFA 2FZEA 3W8DA 3IKTA 2A35A 3K73O 1I24A 3DOOA 3UICA 4DC1A 5IZCC 2VYVD 5F1OA 3I9NA 3LVFO 3AU8A 1V6AA 4OQZA 5A1TA 1F06A 1MG0A 2RH8A 4JLWA 4HV4A 3TSCA 4WE3A 4J6FA 4ZRMA 1KY4A 1P1HA 3DBVO 4AICA 5KVQA 5G4LA 4LCEA 1PTJA 4PLZA 1PJ2A 2PD4A 3MZ0A 4FFLA 4L76A 5G0VA 2JAPA 1QMGA 2YV1A 5CG2A 2NM0A 3K96A 3WGTA 3ZV3A 3DTTA 2YQ4A 4B7CA 3IAHA 4DGSA 2CVOA 3QVWA 5C3MA 2B69A 4FPXA 4IMRA 1FF9A 1ZH8A 3VPGA 3GN2A 3U9LA 1I2BA 1ZEMA 5FFFA 1LLCA 5BNIA 4XEHA 5I9LA 4NIMA 2UDPA 2UV8A 1U7HA 5DCYA 5HS4A 3MOGA 2Q1UA 5KNLA 3WGYA 3B1KA 3GZNB 4YJGA 2YJZA 2POQX 3DFUA 4BMVA 1F12A 3ENKA 4DMMA 4LK3A 2C2XA 1JN0A 3E1KA 4BNXA 1FDUA 2IZ0A 3DAGA 2O3TA 3DQPA 4J2OA 3RU7A 5JC1A 3BTVA 5CEEA 3LF1A 2Y1DA 1ZCJA 2DT5A 2O3RA 3QSGA 4R4JA 1ISGA 4CLRB 1YB1A 4ND2A 1SCUA 2Q3EA 1HEUA 3OIGA 2JFHA 3QRWA 4XCVA 2BMAA 3I5MA 5BNTA 4HP8A 1FDVA 4ZVVA 2WMDA 2FSSA 1BVRA 4HBGA 4RCVA 3JTMA 4QTZA 4BS9A 3ZWMA 4S3MA 2B4RO 1T1SA 3FNGA 2IZ1A 1WZEA 3C1OA 4LSMA 3TL3A 4YAKA 5AYVA 4CLDA 3CMCO 1HTBA 2FPPA 4R1UA 3GPIA 2JD0A 4NFHA 4TRNA 3JQFC 4CV2A 3HUDA 4E6PA 4N18A 3U62A 3SVTA 4XRRA 2FY8A 5J23A 3OQ1A 3P7MA 4H16A 1X0XA 3D3EA 3NT5A 3RJ5A 3ZU5A 1AN9A 4AJOA 2I65A 4ZN6A 1LC0A 3WLFA 2ILTA 4WEOA 1GQQA 4EI2A 1I33A 3N58A 3NYWA 4D3FA 2BGLA 4AJNA 5IG2A 3BMCB 3DBRB 2EV9A 2NU9A 3HN2A 3X2FA 4CR6A 1YRLA 2GN4A 1O5IA 4GX2A 2E6UX 3H2ZA 4ZQBA 2HRZA 1E3LA 2Q4EA 3JQAA 3DHEA 7MDHA 1GU7A 1OBFO 3V1TC 3FF4A 4U6SA 4RPLA 1XQ6A 3TFOA 3HDHA 4C7JA 1C1DB 3DOCA 4CQMB 3PHLA 4YPOA 2HAEA 4XJTA 1KVUA 1T4BA 1P74A 3K5PA 3PFWO 4B4WA 1TI7A 1PGPA 4BO1A 4XR9A 4K9DA 4NR0A 1VL0A 4KUHA 2FN7A 1ZXLA 4CMJA 4CM7A 1YKFA 1ZUD1 3G17A 3ZU2A 1ENPA 3JCZA 2VT2A 3F6YA 3H3FA 4KOAA 4NU6A 4UVHA 3AU9A 5L4SA 3ITKA 3AOEC 1GQYA 1ARZA 4UUPA 5JO0A 2PKQO 3RUIA 1EZ4A 4OHUA 5L51A 3A4VA 4RO0A 1LRJA 1OI7A 2GZ2A 4TKLA 1IZ0A 4DA9A 1LI4A 3Q6IA 4J0EA 4GQAA 4QEDA 4YR9A 5DNAA 5G0WA 4DLLA 2PZLA 1HSOA 4B4UA 1V9LA 3ORFA 3GHYA 3BIOA 1V8BA 1WAMA 2OXIA 2YFQA 4XGKA 5B12A 1FK8A 1CQJA 1EQUA 4GX0A 5BSGA 2DU8A 4FIZA 1TLTA 1Z7BA 1HLPA 5K6AA 3PWKA 4RJTA 4U8GA 3HQ4O 2HMWA 5BQFA 2YY7A 1YXMA 2B36A 3TFQA 3RUEA 4PZCA 1EVZA 1N5DA 3LZ6A 2Y68A 4OOFA 4NMHA 3NX4A 3E8XA 2NVBA 1HE4A 1Q0LA 4NBRA 2ZTLA 4XQ9A 5AVOA 3ONEA 3FN4A 4XB1A 2OORA 3F4LA 2X5KO 4Y8VA 3MCVA 1C1XA 5TJ9A 4F45A 1Y9EA 3V1YA 2Y1EA 4IDDA 3U4HA 1E1KA 3ZHBA 4B3HA 3MJSA 1NYTA 2TMDA 5ENVA 2X5OA 1DHRA 1W0CA 3DBLB 5EL0A 4WLFA 4CLEA 1E5QA 4IM7A 4E2ZA 2ET6A 3WDSA 1B8PA 2GZ3A 2EP5A 1NVMB 2QYSA 4PZDA 3I6QA 3RUAA 1JW9B 3WGQA 2R00A 4Z9YA 2IYOA 1PIWA 2RHCA 3ETDA 1E6WA 2NQ8A 4XGIA 1CJCA 3JYLA 4BNHA 2ZTMA 1RPNA 1UP4A 4J1TA 4RORA 3GK3A 5TGDA 1QG6A 5DZSA 4DREA 4NFSA 3PP8A 2E49A 2FR1A 1MXFA 4IBOA 4TSKA 1TEHA 1PGNA 2O3UA 3EW7A 2BFAA 1RKXA 1GZ6A 3BHJA 4IZIA 1PQPA 3D4NA 4IXWA 4GGOA 1C0LA 2I6TA 2IXBA 4GSLA 4OXNA 3RVDA 1BDBA 1VE9A 3D64A 4I1IA 2E82A 2EW8A 4UVGA 1HYHA 1Y6JA 1K2WA 3RIHA 2HLPA 4QUKA 4J43A 4WASA 4B3JA 3GEMA 4YVFA 1CERA 3VDRA 3KHUA 3FCOA 1KVTA 3CUKA 1I2ZA 3K31A 5LDGA 4OXKA 1DJNA 4R9RA 2PR2A 3DBLA 5GY7A 1OOEA 2FOIA 2P5YA 1MGOA 5AXBA 3L6DA 3AI2A 3OJFA 1GPJA 4YA6A 3IS3A 4Q3DA 4RPJA 1VL6A 3SLKA 3WQSB 4GAEA 2ZB7A 4HFRA 1CYDA 1P31A 3KZVA 3NDIA 3OMLA 3AUAA 3PEFA 1UXJA 2A92A 4M89A 4QFCA 2O2YA 1ZXBA 4YWJA 1HETA 4L4SA 1ISMA 2VYNA 1ML3A 2PFGA 3IMFA 2EKLA 3N7UA 2QX7A 3I9MA 4DQVA 4I5GA 4L4XA 5H83A 3VH1A 1A72A 4HUJA 3EGOA 4MP8A 5ITWA 4FQ8A 5K6AC 2JD1A 1U28A 2R2GA 2JCYA 4R41A 1T2DA 4YYZA 3PRJA 1PR9A 3NTQA 4BB5A 4XQGA 4D3SA 1DIGA 4M55A 1LEHA 4X54A 2DBRA 4JP2A 3H6KA 2FZWA 3PVZA 4B8ZA 2QYTA 4CM9D 3JQBC 1EVYA 5KOIA 3G79A 2WD8A 3F3SA 3L4SO 2NVUB 3ADOA 4MVJD 4QO8A 3TQHA 3WJ7A 5B4TA 1BRMA 4DBVO 4NG5A 1HF3A 3ANNA 4D44A 3C7DB 1P0FA 3DMYA 1X13A 4EZBA 1ONOA 4RPGA 4WEQA 3Q0EA 5KVCA 3IJRA 4PFJA 4XJSA 5BR7A 1SNYA 2Y0CA 2AHRA 2AEJA 3H7AA 5I8ZA 4URFA 5IZ4A 3IP3A 3NDRA 3O38A 3I83A 1A4UA 3V1UA 1SOWA 1UDCA 4AJPA 4BO3A 2X58A 3TNLA 3BMOA 4IDFA 1P1IA 1HXHA 2JCVA 2QRKA 2AQKA 3JD0A 3M1AA 5COAA 2R6JA 4KP7A 1V3UA 3JQ7B 3GVPA 2PH5A 5JW6A 2C7VA 1B3BA 3FBTA 1YBVA 3EYWA 1I3KA 2PA3A 3GMSA 1XR3A 4OQYA 1DBVO 2C54A 3AOEA 3H4VA 2VCYA 5IN5A 1LQTA 3RUCA 1B16A 3E9NA 3GMDA 1SZJG 2OUIA 3LC1O 1HL3A 4RGBA 2VZ8A 1P77A 4N54A 3U4IA 3FR8A 1GFSA 1CIVA 5T57A 2QHXA 2O50A 2GPTA 2HCTA 1CDOA 4LMRA 5EQFA 4DIBA 3RC1A 4IINA 1DB3A 4TRRA 3QWFA 1PJTA 1ZFNA 2OBNA 4XRGA 5TC4A 5HBRA 2VHZA 2OBYA 1U4OA 3JYPA 4UEKA 3P2YA 2AE2A 4A5OA 1HZJA 3VOSA 4BO6A 1NHGA 1Y8QB 1ZW1A 3WFJA 1BMDA 2Q49A 5DBFA 3ZV6A 4HX5A 5CHEA 4JJFA 4BO9A 3PFFA 2D8AA 1Y7TA 3A9WA 3ABIA 1E7YA 4FC6A 3RKUA 4A0SA 4FB5A 5JY6A 1SB9A 3G1TA 4J9VA 4FGSA 4CPDA 4FFMA 1AUPA 1BWSA 4Y6PA 1P0CA 5HTOA 2QRLA 4PGFA 1ZIDA 1FMCA 4EUEA 5HS6A 3RD5A 1F8GA 5JCJA 3H9JA 5CEFA 4EUHA 3U4CA 3LQFA 4UREA 3OHSX 4NU5A 2OMEA 2NVWA 3IDSA 4ZD6A 4XWYA 1ZMOA 4R1TA 1AHHA 1L7EA 2QZ9A 2VOJA 3L07A 4MVJM 1GUZA 4YJDA 1B0AA 1UDAA 3VTZA 3AW9A 2CY0A 3NUGA 2C07A 2IDZA 3NRCA 1H0KA 3KEQA 4E2YA 2I66A 1K89A 1KBZA 1Q0QA 2BFOA 4MJLA 5JMPA 5FI5A 2TMGA 4H7PA 1EQ2A 2C20A 3HFGA 1NBOA 1YB5A 4IDAA 2NACA 3INGA 1GTMA 5AXAA 2G17A 4IJUA 4Y9DA 4CQMA 1Z6ZA 4CMEA 3FTPA 1CETA 3WS7A 4B79A 2VWQA 4Q39A 4UAGA 4EEZA 5IDQA 2ZJ1A 3D3WA 3PYLA 5H82A 5TNXA 4B7XA 3ZH2A 3OBBA 4TQGA 2PZMA 1FXSA 2BFMA 4DBZA 4TRJA 2CDBA 3PGXA 2PV7A 2NQTA 1LDMA 3JQEA 1V35A 3WIDA 2OHXA 5IDWA 4KMSA 3DOJA 3W4KA 3DXFA 2YHIB 2X0RA 1PR3A 2CDAA 4Y6RA 4LVUA 1PJCA 1GV1A 2OO5A 1QYXA 4GX5A 3PPIA 4ZQFA 4WLNA 4ALIA 1C1XB 4A7PA 5JLAA 4CMBA 1W4ZA 2VZ0A 4UUMA 3CKYA 3CZRA 4E3ZA 1VLLA 2ZTUA 4YJFA 4MVJA 4TVOA 4G2NA 4BV8A 3D4OA 3DB2A 3QVOA 2G5CA 1Z75A 3KOUA 2RIRA 1N9GB 5HM8A 3ZHYA 1M6WA 4JCOA 1F8FA 1X1TA 4MIYA 3VPHA 3VVBA 3CXRA 3H5NA 4D42A 1JVBA 4P8RA 3JYOA 2V6FA 2VHVA 4GMGA 4W99A 4L75A 5A03A 5A3JA 5JAIA 2OL4A 3IOYA 3DMTA 5TIIA 1E3WB 3RC2A 3NJ4A 3D5QA 1KETA 2O7QA 4FFOA 4IDBA 1VM6A 2NVUA 1D8AA 2QQ5A 4RDIA 3AJRA 1DC5A 5KJ1A 2ZJ0A 4NNJA 4QECA 3DBHB 3GVXA 1R4NA 1ZJZA 3WB9A 4E21A 3O26A 4JJIA 3OEWA 1SB8A 4GVLA 4RF3A 2DUUA 1Y1PA 1IOLA 3SX2A 4KUEA 1PGOA 1R4MA 4BKRA 3FRJA 2QIOA 1QORA 4KTVE 5EPOA 1AXGA 4I5FA 5IXYA 3OH8A 2OZPA 3MJEA 3Q3CA 4FC7A 3C24A 3I6IA 3KSDO 5DP1A 1V3VA 1QYCA 3M1LA 1UXKA 3AI1A 1MFZA 1H6BA 3GZ4A 4RDHA 4AJIA 4FS3A 4BGVA 2CZCA 2C5AA 5TLSA 3BHIA 1I3LA 4FW8A 3GUYA 4BB6A 3P2OA 4J4HA 3KXDA 4PLVA 2Y0EA 3D3WB 5U9CA 4OJNA 2IEDA 2UVDA 3WBFA 4IPTA 4MPDA 1I32A 1AGNA 1HDRA 3RBVA 1AHIA 4M54A 3ZGYA 1SO8A 2VWGA 4NH4A 5A02A 1UH5A 5F21A 2HJSA 1ZSYA 3ZW8A 2C29D 2HKIA 3ITDA 4WK6A 4JBHA 2ZB8A 3NV9A 1XG5A 3TWOA 2AG8A 3NT4A 4MVJP 3S2IA 1NHWA 2W2KB 3D1LA 3ROPA 5A4DA 4P4NA 4RF4A 3C85A 5BSFA 3WGHA 1BDMA 4R51A 3GFBA 1DFGA 2X0IA 4QSMA 1WXDA 3R3JA 5L7YA 4RVGA 1YOVA 1ISJA 3CZMA 1JWBB 1EFKA 2DTDA 4J90A 2AXQA 4RLSA 1T26A 3K6JA 2PKQP 4WCDA 2EG9A 4XD2A 2Q2WA 1RWBA 4MIOA 1F0YA 5L45A 2Z1NA 3QE3A 3OFSA 1U3TA 2H9IA 2DPGA 3NDJA 3WWYA 4YRDA 4NBWA 1GUFA 1DC4A 2PD6A 4ALMA 5GZ6A 1G0NA 3GVHA 3Q2IA 4HNHA 3JQ9C 1VJ0A 3AWDA 3X2EA 1R12A 3ANLA 4XB2A 4OKIA 4CM6A 2P9EA 2Q1WA 3L4BA 3EVTA 4F3YA 1E0DA 1XELA 3JQ7A 4FD3A 3ZDFA 4QQRA 3FR7A 3Q1LA 4L74A 1HSZA 2A94A 2CD9A 3VZPA 1KEVA 1V3TA 3GFGA 2JAHA 4IDCA 5A9SA 4BL5A 3GDGA 1NQTA 1LDEA 4YRBA 2GDZA 1UP6A 4Z0TA 1ENOA 1R4MB 3WNVA 3DAPA 3MWEB 2PZKA 2O3SA 4EJ6A 3WMWA 1PU2A 3WOHA 4QFDA 3IL2A 2EHDA 1P1JA 2Y1FA 4BKPA 3T4XA 4OKNA 1OAAA 2C2YA 1PGJA 2DQ4A 1HE5A 2A4KA 5G0UA 2GN6A 2ZB3A 3WGZA 4D41A 3GAZA 3AY7A 4NJMA 4Q3EA 1DO8A 3DZJA 4WGGA 5FEUA 1JWAB 1M2WA 5JO9A
chains in the Genus database with same CATH superfamily
3T3EA 4UVEA 5JJ5A 4LTDA 3E1GA 5TPZA 2WSYB 2FZKA 1SRQA 2ZRJA 3O4HA 4S0XA 1S5PA 1YDEA 3O4VA 1OQAA 1UODA 3KTDA 1SUBA 3A0RB 4UJ3A 2ZYIA 4DAOA 8LDHA 1PQUA 5GADl 3QXSA 4QX6A 2ZBRA 5I6DA 3INYA 4RTRA 1G5IA 1HPLA 2A0XA 1OV6A 2O0LA 4LMBA 4UMVA 2XB9A 4C03A 3EY9A 3WRWA 2D7DA 4JNGA 1RTTA 1CUEA 4KAJA 4PRKA 1TCBA 4NY1A 1FVFA 1XVTA 1YVRA 3CRQA 3P9KA 2RIPA 2I3GA 3LT2A 2YZNA 5AW9A 3SIRA 5EJAA 4MGEA 4R1OA 5REQB 4E51A 5LOVB 3FNIA 1N0IA 1QH1A 4TYYA 1SM4A 2IEBA 5BMOA 3KIPA 3C5WP 1NR5A 3H9GA 4YBZA 3GLUA 5L53A 1K4YA 1B2RA 2AXPA 4MQEA 1GG9A 1IOVA 3H6GA 2ENWA 5FBQB 3S2EA 1YE3A 1ZU5A 3QWIA 3E48A 3IBTA 4JGBA 3RJ9A 2C5EA 2F7SA 4CM4A 1N5LA 4RVSA 3K6RA 4IJWA 5DO9A 4DR7B 3COSA 1EFRD 4TV8B 1THGA 2H07A 5EKUA 3KJHA 5E0OA 4O8ZA 2WAMA 5F5NA 1ZC3A 1ZLYA 4FFPA 2D2EA 4KQEA 4AWXA 1P60A 2RK3A 4KQIA 3SG0A 2NU7B 4DAEA 3QU9A 5BQXA 3NBZC 3KDSE 2BGMA 3DP9A 4I3FA 3IQWA 4YBRA 1UMBB 2BONA 4HWKA 4N1AA 2ZBFA 3TW8B 1EWVA 1R88A 3IR6A 4O5OA 4X71A 1W88A 3GPDG 4C0LA 2D0PB 2WWYA 1IUOA 2WTXA 1V47A 1MR3F 4BX3A 3WWOA 1D7OA 4P5DA 1TTQB 5H7XA 1BJRE 4CIYA 1NXVA 1ZCAA 3TG8A 5J2TA 2CK3D 3C3EA 1TMOA 4EHJA 4EFDA 2QE7D 1E5TA 4U00A 5CDSA 2BEUA 3JV7A 5LA6F 1Z06A 2R3SA 4L4RA 3FHLA 4RYDA 4TMXA 4LE0A 1NMZA 4U63A 3RIYA 5ICSA 2O05A 3QBDA 1OT5A 4WNAB 5KQGA 4PX9A 4X62B 4Q1CA 3R8CA 3OOYA 5CPBA 1AXRA 3Q6MA 4GI7A 4Q66C 5HDBB 1TD1A 4D0RA 1E1MA 4XIIA 1MOZA 4R1MA 3GCZA 3PI6A 3QU5A 1G7SA 3M2PA 1ZEJA 1C30A 3CZ5A 2EOAA 1B2LA 2EQAA 4HKTA 5E95A 3UAXA 5JQGF 1TAGA 4KLRA 2VLIA 4HAIA 3W3AA 4OKSA 3AR9A 4D0LB 3G2KA 1QHYA 3UY4A 4HNVA 1XUOA 3FUWA 1E2HA 2PDAA 2GETA 3GXOA 1GQFA 2WSIA 1TQ4A 4QIHA 5B3JC 2HRBA 1EK6A 4PVDA 1X3LA 4WXPA 1KWKA 2CWWA 3F98A 4WCFC 5TS3A 4BFWA 4RL4A 3U19A 3ERCA 1PT8A 4IV5A 1SG9A 1E69A 5AJXA 4EUSA 1T1IA 4FD2A 5A4IS 1HRDA 1NJ6A 3U7JA 2NO1A 1HV8A 1TF2A 2GZSA 3G88A 1V4VA 1Y8RB 3LBIA 5FFMA 1QK3A 3RKSA 4BNKA 3ADCA 1E2BA 3MSXA 2I9KA 3T9BA 4YXFA 1L1QA 1CE8B 2VNAA 4U2GA 4E5KA 2XSZD 4L7QA 5IYZB 2LUOA 1J5XA 1H5NA 3CRZA 1N9GA 2HNBA 1H2RS 1IN8A 4MMYB 2CKDA 1HE1C 4G0ZA 1DWUA 1ODLA 3OQPA 3E82A 4RZIA 3UGKA 4HEA1 3IUSA 4MQLA 4LFBB 5KNBH 5THKA 1ID8A 3MYYA 2VN8A 4OHCA 2PKXA 4ZDIA 3HNOA 4GD3Q 4WCFA 1MJFA 2XZPA 1MTOA 1WIWA 1R15A 1XQ1A 1XEXA 1ZLXA 2RGNC 4BP3A 3IAXA 3PZBA 3ZCQA 1HR0B 1R10A 1PBNA 4A36A 1R0WA 2VT3A 2ZCVA 5B3JA 4PS0A 1ZONA 4Q5IA 4KXNA 4LOHA 4RFVA 5G3ZA 5T67A 5TE9A 3TMAA 2H2HA 3KOMA 2KYRA 3TNYA 3ZY3A 4JJKA 4ON9A 3B6IA 4JXJA 5FBHA 1EHYA 5K0GA 1ORTA 3GQBB 4AP6A 4KLNA 4WACA 3IUQA 5EQJB 1MKYA 2O5RA 3E0QA 3F7MA 3SHQA 4R7GA 4GUDA 5HIKA 1V39A 3DUFB 3JZMA 4U3JA 1NW9B 4TTPA 3AF5A 3GJ5A 3JPYA 3Q5EA 1ZVJA 3TJZA 2GN9A 1U9JA 4OM8A 3P5SA 1U7PA 1HZZC 3QKUA 4OXIA 4EPWA 5KQLA 3RK4A 4HGRA 2O7SA 1NU6A 2YOHA 6CHYA 2CJWB 1FB5A 3T5PA 2WHPB 5D00A 2LTAA 1T13A 5HYVA 1WP4A 4OV6B 3BTOA 4Q3CA 4MUYA 2HY7A 3M4JA 3NXSA 4CV1A 3N75A 3RS8A 4M88A 1WUTA 3ICPA 2CHFA 3HM9A 1ZP6A 2H1VA 2Z83A 3M2TA 2JCXA 3GUHA 3WK8A 5I7OA 1XDWA 4RFSB 2JHCA 4WX2B 1GVNB 1QMPA 1V0JA 2FI1A 2W42A 1XMXA 2HSJA 3S3TA 3U48A 2VJNA 1JFRA 1OC4A 1ZI9A 2PRSA 3E2PA 1COWD 2YRXA 3QYFA 3R5XA 4FYMA 4JLAA 4Z2YA 3R7AA 3RABA 1HE2A 5KO2A 1LSJA 2DUMA 3JYQA 1NVEA 1WO8A 1NAIA 1P2DA 3IQEA 4GIBA 4ND3A 4R01A 2Y1GA 2HK6A 4JLNA 5LQAA 2R1TA 4DWJA 1PEDA 1MQAA 2FRDA 3V8VA 1V1RA 3NLLA 3ZIAA 2VNJA 4ZCPA 3R3YA 5IT9A 1XZNA 2YWDA 5CVUA 1IY8A 4HGQA 1Y3AA 1KOLA 2IYQA 2YIMA 5ALVA 1ZBDA 2FE1A 4R9NA 1XPJA 1GTZA 2OB2A 4TV8A 4RSRA 1XZQA 1DRUA 2OKCA 3GG2A 3MTGA 4E1BA 2I2BA 1SOAA 2WHYA 5EWLA 1UK6A 1WRBA 1IFXA 4GI5A 2ZRFA 3UAOA 2FSUA 5FAKA 3ZN2A 4TZTA 1TQ2A 1H1LA 4K87A 1VBNA 3LT5A 3IC5A 1J1ZA 1IQPA 1F5SA 2WT9A 2D3WA 2JFOA 5IS2A 1SXHA 3DLTA 4IO1A 3S2FA 4EBBA 2ZS7A 3CSSA 2V6JA 5J2TB 2WAOA 1HMPA 2QW8A 3GGOA 4PLHA 1W2GA 2RMKA 1QF9A 3FOAA 1EGHA 4X6LA 3ZK9A 2JLRA 1T1RA 3ADPA 4LE2A 1SVIA 1PAUA 4Q9JA 3F6EX 3HUFA 1JBEA 1QJ4A 4PAMA 3VYVA 2WTEA 2HK9A 4QKQA 5CB4A 1WMBA 3AP2A 1HFWA 3IA7A 4QBFA 3KXIA 4KACA 4L4ZA 4LJLA 4URXR 1SFRA 1PZXA 3K0KA 1JFTA 2QLJA 1UDBA 2GCGA 3G23A 3L8FA 4CIAA 1ZOLA 4LWPA 1NVKA 1UJ2A 4UTPA 3PX7A 5B7GA 3AYZB 1QWOA 2XUZA 1X7YB 5AVRA 1FTGA 3K9LA 4RWZA 2C4UA 4XGNA 4A6PA 5L7TA 1PFWA 3CH6A 4ZU3A 2J7PD 1YHZA 1OROA 3L8YA 4MP3A 5J2UF 1E2DA 3G2JA 3OT4A 2B34A 3FMFA 1HDCA 2W6MA 5DHAA 4DLBA 3F7NA 5B3AA 1MJGM 3AFOA 2G0AA 2OO3A 1SU6A 5F78A 4B6FA 5K03A 4KFCA 3C6MA 4OMUA 2P9TA 3DZKA 2CCKA 2J46A 2WIFA 5AJZA 1QH9A 4LV8B 4UU0A 3ZWNA 2EGGA 1JDBB 1Q12A 1H8HD 2ZSBA 3AIOA 4DM4A 3JVVA 1BOFA 5CH3A 4D9KA 3V9AA 2NTVA 3MEQA 1J33A 1P8JA 1HE3A 2IFTA 2ZDGA 3EGCA 4UM7A 1L5QA 2VJYA 3PE3A 5ALJA 3VPFA 5A4JA 1KO7A 3B9QA 1YQXA 4BLUA 3R8FA 3A0UA 1PVVA 4J0JA 1JWLA 1T6NA 1RJWA 1U8ZA 3HA2A 1E98A 1ZA2A 3EGDA 3L3BA 2DKOA 4H3VA 1LDBA 2YWRA 4JUCA 4RTMA 4QEKA 1OPXA 3TTUA 3K5IA 2XRFA 3KJIA 4BIMA 3W6UA 3PQ7A 1D2MA 1CNEA 1XT6A 1N5JA 2VDUE 3FNEA 4JA0A 1KK2A 5ECWA 3SDZA 4RVDA 3P9CA 5EP3A 2QM7A 3QPVA 1CB7A 3UJBA 5KNCD 2J9FA 1ZH4A 1Z0AA 3BAFA 1VPLA 2CSUA 3FRIA 1NWHA 4KQCA 3MHPA 4Q82A 1KDVA 3W1WA 3L9WA 4UD6A 4WN9B 3PHHA 4IVPA 3FNHA 4IQGA 1T3ZA 3PIDA 3WLEA 5ESDA 4W9RA 1NRIA 1AQLA 2KSQA 2CMDA 3BORA 1FLAA 2W2QA 3C98A 3GO4A 4M1MA 1CB0A 1SWWA 3EJWA 2W6OA 5I8PA 1Z6AA 4CF6A 1XZBA 2OGSA 5MHTA 1OMOA 2H8GA 2ZAGA 2JI7A 2BELA 4N01A 4X7RA 5JMWA 4P4SA 4RJLA 3IOCA 3NHMA 3O94A 1PLLA 4EHHA 3AKEA 1Q0ZA 2X4GA 2QJTA 4LXQA 3ZXSA 1CR4A 3UPTA 1ZOIA 4G3XA 2NYVA 4QFBA 3T5CA 5I7RA 4IOKA 5EG5A 1WTAA 1FXWF 2G06A 3EWIA 5B3LA 5EJ4A 1JIKA 3CRRA 3LSTA 2B21A 3QI7A 4Q4AA 5AWFC 3WLMA 1HG1A 5AW7A 1RQPA 1W9MA 1JV2B 2W37A 4WBXC 1ZZEA 1L7DA 1FS5A 2HQSA 1CULC 2CUNA 3W9YA 3G8DA 2G9QA 4L15A 1AD2A 1VIDA 2P0EA 5JBNA 2IQIA 1BN7A 4YAWA 3BDVA 1CUIA 4YASA 1F0NA 2OCLA 3OPQA 1GGFA 3TOXA 3ZWXA 4DV2B 2XNDD 1S3IA 1H9BA 3D8TA 2IXGA 3ZGLA 3ZDQA 1EP3B 2OGTA 3EIFA 4XCXA 5IAAA 1ULAA 2HU8A 3O3CA 4DDWA 4CV3A 3U49A 1U28C 2XF8A 3DVAB 4IFIA 4MHSA 4MI3A 4PLGA 2P3LA 2CBGA 4OB6A 2XQVA 4TKZA 1MH9A 3SHWA 3IHKA 2ZCJA 5GOZA 3HABA 2PCLA 1WXIA 3R3SA 3W2TA 3DDCA 3WKAA 2VYND 5C51B 4JT2A 3SKVA 3PNSA 4K6GA 2HCJB 3BKWA 3UAVA 1COZA 1U0RA 3OFKA 4HVLA 2I99A 1RFLA 4W7HA 1X7GA 4DCCA 4MS4B 4YDRA 2XMSA 2O2ZA 4DSAA 2XKJE 2IS2A 2HWXA 1A9ZA 4ZAYA 5MN5A 3FSRA 4QJ5A 1VMEA 2Q41A 3GRAA 1A4IA 5FBWB 3LTNC 4YWHA 3WRVA 5KKAA 2GYWA 1WDWB 2YZGA 2OP1A 3K4QA 5DNEA 2PWYA 2R1ZA 2X8AA 3KV3O 3P4XA 1BG6A 2IOQA 3LVQE 3T4EA 1LK7A 4W82A 1NQAO 1W34A 2P79A 4EM6A 2CVPA 2QQ0A 2DPLA 1EEHA 2ONCA 2B7BA 1LRKA 1YL7A 2XIQA 1R6VA 4TSFA 5C4IA 3JZIA 5K0NA 1BXKA 2AL7A 1LLQA 1WHSA 3IBGA 1HFKA 5JTTA 2JLVA 2P9ZA 3OJOA 3I05A 3LVBA 1UUFA 2G77B 2W90A 2QR3A 3IB6A 4XVUA 3S81A 2VNHA 5D3ZA 5T5QA 2O0MA 4Z7OB 4DR1B 2O19A 1FP1D 4C7MA 4CKWA 1PVDA 1SOUA 2TMKA 3GLHB 3JAKB 1QH1B 1U0SY 3TIXB 3SYKA 1QGUB 5LUAA 2A9JA 2NVOA 1T25A 2XCOA 5JG7A 2VJPA 3VJMA 4X7PA 3ETEA 5B6IA 4ZAVA 1ZA1A 3DV0B 2XPCA 3L1JA 1GFWA 3AVOA 2VJDA 4P4SB 3RS2A 5CUQA 3E9CA 2ZATA 5JY1A 3WMEA 3AETA 1H8EA 4JBNA 5J47A 4BNFA 1VHLA 3ASZA 3U81A 5LP6F 4K2AA 4DR3B 4DQLA 1VHJA 2JIPA 2XCRB 5AJUA 1TK2A 2OORC 5EJGA 3B20A 3BCUA 4O3FA 2WYIA 2WYWA 3I52A 3WRXC 5F3WB 1LJ8A 3BS4A 2E87A 5FTKA 3UPUA 4IH9A 1JQAA 5K0TA 5ILOA 5TXGA 3TW6A 4K1LA 4TWBA 3AJEA 3Q98A 3GWZA 1DDOA 4J16C 1OX4A 2OC9A 4GE0A 4Y6GB 5FL3A 3RGGA 3FXAA 1AZSC 2Z30A 2J7PA 3Q12A 1KERA 2GFHA 3G5LA 5C1DA 1G3UA 3AQ4A 4LXTA 2OZKA 4M0MA 4QXRA 5LA6A 3NZEA 1O8BA 1NL3A 2O4CA 2XW6A 3CXUA 1C4WA 1QTIA 2WDZA 4ZREA 3U3XA 4KR3A 3A3NA 3R20A 3DOFA 1XZJA 1L3CA 1XEAA 2OSBA 3PTZA 1TVCA 1IXKA 5ALRA 2IU0A 4WDRA 1YR6A 3JQGB 1CRLA 3AK4A 1HL7A 2ZYAA 4UEOA 3HRKA 3V7YA 2P78A 3VISA 5AVJA 4FSHA 5L3RA 1MVLA 2AW5A 3C5EA 1GR1A 3NTUA 4TVBA 1P1FA 4BNGA 4EOGA 2FR8C 1R4ZA 5IABA 4RY8A 4QDJA 3ETHA 1CUYA 1L4FA 4KI7A 1RJDA 4CHTA 1B7GO 3VTKA 4GGPA 4ZAWA 6YASA 2UZ1B 4MKRA 4C7OB 3DJYA 1MF7A 3NS7A 3P32A 4DG5A 2VJMB 2ZSAA 4URHA 1LW7A 1K8QA 1G7CA 3FLMA 4PPGA 2WP0A 4WUVA 3JQBA 3RARA 4DJJA 3MC1A 1C9NA 1H2ZA 1U0HC 3M1YA 4KQKA 1BGXT 3L93A 5DOVA 1PJ8A 1QP0A 4NBLA 1T0BA 2MR6A 5L40A 5JQGB 221PA 1EB8A 2Z8YA 3SHOA 3SIXA 1OGJA 1ACMA 3ICCA 4HO1X 5I9TA 2B20A 1U2QA 2AA3A 3FBWA 4LBZA 1MO2A 5ALSA 1GCIA 4EY7A 1AQIA 2KHZA 4IGIA 4X0EA 1L5LA 4EECA 1INLA 2XUAA 1ABEA 3S8MA 1D1PA 3KR0A 4MUBA 3MSCA 3S5JA 4OXXA 4J0FA 2B5OA 5DGDA 4J1SA 3L7LA 1MTZA 1L7MA 1A7KA 4RVFA 1GNQA 5HP4A 2J4DA 4HSGA 1US8B 4HVCA 3GA5A 3J80A 3CRNA 4FK8A 4FMCB 2PG3A 2Y92A 3ND7A 3A06A 1TGVA 2BMDA 4YI5A 3AZOA 2X6TA 5KX5A 1J9GA 3E3LA 4KXVA 1ACJA 4DGQA 1YMVA 2J5QA 4TMFA 3T8YA 3KQYA 1THTA 5CNMA 4P4LA 5C4GB 3N1UA 5DT9A 1EMDA 2WWVD 1KIMA 2C4HA 3O4RA 1WD5A 3VUEA 3H1GA 2A9FA 3QFRA 4XLTA 1WLSA 4TL9A 3GGPA 3BH0A 3WJAA 1YR8A 3LZDA 3ZKWA 3C41J 5JZ9A 1WMFA 5KC8A 4IIJA 2P27A 1N1EA 3LRTA 1GGKA 3OE7A 4LNUB 2EL7A 2AJCA 2C59A 2HUNA 1UOQA 1RYDA 1NN3A 4JT4A 3M6IA 3RFXA 1B0UA 4C21A 5BOVA 1LBQA 3W0LB 3CJQA 3I53A 2EKBA 1MORA 2FHSA 5LP1A 3ISVA 1LGYA 1PS8A 2IHVA 3L92A 4OUDB 3KS9A 5C1BA 1VA4A 3W2HA 1KZ6A 4TV9A 1PR0A 1IN6A 1HDXA 5B2FA 1FQOA 2HBYA 2YDXA 1F1JA 3S8EA 1SXIA 4ZYVA 2P90A 3B5EA 3BMOB 4Y9UA 2YY5A 1ZHFA 1H23A 2FUCA 1OV4A 2R8RA 3EDCA 3F6CA 1S1CA 3JVIA 4XM1A 4U2KA 3OTWA 4MWOA 2BHSA 1U6KA 2YR0A 5F64A 5HZHA 1CCWA 3LYLA 1NLFA 3LT4A 3QLVC 1WV1A 2GFIA 3SI7A 3BGSA 4HMQA 4Y67A 1CQXA 1FTQA 2VBIA 3PQ5A 4G07A 4NFYA 4O4IA 4PIVA 2Y0DA 3RH0A 1BGWA 5BV0A 2BGWA 1W4RA 3KJEA 3JQQA 4QGAA 4CUKA 3CLRC 1GIAA 2QX9A 2Q7OE 5DXAA 3JAWB 4URYR 5IAOA 2WTUA 2WABA 1NKVA 1OBOA 2XF2A 3EBOA 2HWUA 3LPNA 3T7CA 4G0UA 2VG8A 1D7AA 3F1KA 1C9DB 4LX0A 4XGQA 2F3QA 4MINA 1DJMA 3GH3A 3ESDA 1UZLA 1R5NA 2Q6VA 5JD5A 3FX2A 3HKDA 2GPSA 3CURA 1GYPA 2X4LA 3DAOA 4MDEA 4PO1A 4UUQA 4G5QA 2ZUWA 4MQ6A 1Y7HA 1Y9AA 3U09A 4AKEA 4JKOA 4DCVA 4EB3A 4NYIQ 1TAQA 1U4NA 2WU4A 2O06A 3QY9A 1CHNA 1SHZA 3ZWDA 3H8VA 3RKRA 2CLLB 4N4AA 3T5GA 1ZYUA 1KSGA 2NUTB 3MCUA 4RQUA 5CW1A 4B09A 3QEAZ 4EUFA 1G4UR 1TM5E 3BB3A 2QL9A 5AOVA 4JYMA 2EYUA 4N0MA 3S40A 1QCCA 2CUTA 4PTLA 3EJ6A 3NW9A 2W4MA 3QEOA 1EVIA 2FPSA 1XTSA 2QD1A 4KFUA 3OP1A 3PNMA 4QUBA 2KX7A 4CQLB 5BV8A 3D8UA 4RK6A 3ROGA 4HQFA 4DLSA 1UJ4A 1X38A 2B8JA 4IG4A 2UUBB 3VA7A 1DXHA 1QKJA 4QGBA 4R6WA 4ZVMA 3ZY6A 3O9MA 1QOPB 4P38A 2I9PA 3AW8A 4GPTA 2PS3A 3WI7A 2HK8A 3QWHA 3RJTA 2ZIVB 1D1SA 5E8JA 1I2CA 2BFBB 4IIEA 3LLVA 3L9XA 4N39A 4IDEA 1BJTA 2AFIB 3S4YA 3UC9A 4OIMA 3U3RA 4MV6A 1GN8A 2IYSA 5DNVA 4N3GA 4RA6A 5AW8A 4MHOA 2RJ3A 2X7HA 1KEZA 3LGAA 2DTEA 3U17A 2C82A 1ABBA 2C31A 3TOCA 4M60A 4NAHA 3ZEIA 1BOOA 1MNQA 1P4SA 4RKQA 3X1WA 4BO4A 2QUKA 4I1UA 4FQ7A 3INTA 3A6GA 4IOLA 4M87A 5JHHB 2VJAA 3G3EA 1NTRA 5BSUA 1P4HA 5JQWA 3HXMA 3ZVNA 2QRNA 5HE9A 3L8GA 3KQUA 4ZJPA 4W9NA 1RRFA 4HPXB 3RFFA 3V8MA 4ZDWA 2WIGA 2O8VA 3OPNA 1MMFB 3PLRA 1FNDA 1D09A 1FUYB 1ODIA 2XV1A 3P97A 2VP6A 3DW1X 1NQWA 4FOLA 4HYEA 5JDCC 1UPCA 3QU2A 1RBZA 1QVAA 1CJMA 1AS0A 1QOZA 2GUGA 3SM9A 5ICMA 1UXIA 3HSYA 1EUQA 4EWLA 3FNFA 4YRCA 5IUKC 1FSPA 3X1ZA 1JIQA 2WZDA 4DMRA 3WHIA 4HI0E 2REOA 4L0QA 3H65A 5L9AA 4KREA 4QOIA 3SX0A 1XA0A 3HWWA 1V1JA 3QK7A 2C5GA 2VNKA 4XDZA 1USVA 2BFEB 3AI7A 3VSCA 3K32A 4FB4A 3VNVA 3K9FC 2C0PA 2ZBPA 3G8YA 3IUPA 2JKYA 5FOWA 4AD8A 3CG0A 3MXOA 4KO4S 3O4JA 4K88A 4DW8A 1GYRA 5AM5A 5IBQA 4QRDA 1N2SA 3ZDZB 5C8DA 2VATA 5KIAA 1UAGA 2BTQB 4OYHA 2AIRA 1Y5LA 3T3PB 4CDRA 2HWKA 5B1DA 5K45A 3B7WA 3CT6A 1D4AA 1TAHA 1CRQA 1U8AA 3GCXA 3RREA 1KXJA 3BXEA 1NPYA 3A9RA 1F3OA 3T4PA 3IEXA 3NJRA 2J9ZB 4OXYA 4Q1FA 1ODTC 3UXYA 5IRCD 4NAVA 4AQYB 2NZWA 9MHTA 1U81A 3EXFA 1V16A 3FJ1A 4ND1A 1U8UA 1VC2A 4PG7A 1TD9A 3WNDA 3WWDA 3B3FA 3X1YA 2PUDA 2XUHA 2HOQA 4PW0A 1UQRA 2QSUA 1XCMA 3UZUA 5CB6A 3QA3E 4PSUA 2XOEA 1EK1A 3WL4A 1EM8A 1B8OA 2NAPA 1UKYA 5ADHA 3DC2A 3ZQ4A 2C5LA 2D13A 2J3KA 3THYA 1LNZA 1XRJA 4RQTA 1P9LA 3ZIDA 1D2AA 4DMLA 2EU8A 1K3TA 1U2GA 5DNUA 3ENNA 4TMWA 1GILA 3N8GA 4ZT4A 1C7QA 1EU1A 3HP4A 2W6NA 3QIVA 5KI6A 3PF9A 2X23A 1F2TA 2BEWA 2O8CA 2OXTA 1DTSA 2D2IA 1F14A 3Q85A 3MS2A 1TQ8A 2QTTA 5ENDA 3HYTA 4BFUA 3DT6A 4WZBA 1GL6A 3VZRA 4YPFA 4BMDA 5ALTA 3THOA 3QELA 2G9VA 2HMAA 5TSDA 3T5MA 4DIMA 3U1BA 1Z39A 3QNMA 1FIUA 1RACA 2RAVA 4LC9A 3DNMA 2N0SA 4LGVA 1WNTA 5BVHA 3HJBA 2NLOA 4QO7A 4WN3A 5KQMA 3UQYS 2HJWA 5DGTA 5HRCA 1CWUA 2HB6A 1Q0RA 3KQLA 1QM5A 3ZLAA 3CWQA 4BJ3A 4RPKA 4YCBA 5DM60 4FR5A 2P3SA 2F8MA 2DJIA 4LVOA 1HNXB 4CG3A 1YRQA 4FE3A 1P2GA 1ZQ9A 4J0DA 4HLUA 1XTZA 1EKXA 2PBLA 1O9HA 1QQAA 1RM4A 1WSBA 4M1SA 1QYWA 1M2GA 1I0ZA 5EMJA 1QU3A 2G72A 1QHHB 4TXHA 2QTBA 4YHBA 3TL6A 1CUAA 1JFFA 1VPEA 2DBQA 4ZYZA 1BXGB 3R77A 1G17A 3D6UA 1W4AA 3V2UA 1RC8A 2XDQB 3GU3A 4ZU1X 2ZVJA 4HQ0A 2GS9A 2YICA 1T0UA 1E6EA 1XHLA 4Z5XA 2PX5A 4TWRA 1P4GA 3VYTB 1YZUA 1UXGA 2RB4A 4PQGA 4D8TA 1RFGE 4RPHA 1XTKA 3EVEA 2O2XA 1FU7A 4CODB 2BFPA 1DUVG 1O96B 1OLSB 4O4HA 2B82A 2AI2A 3I9KA 2QTHA 3RYFA 1MP0A 2PGOA 4I55A 3SJCA 3SE7A 1P72A 1FNSA 1GTJ1 1AURA 1BYIA 1L7PA 2NTNA 4FBMA 1BVHA 2GD1O 3RHSA 3ZE2B 2VPIA 3EVAA 1XTTA 3CLUD 3CH4B 5CNIA 5DLDA 2EX0A 2B1IA 1RDFA 2Q45A 2QRQA 2ZRDA 2IBTA 1M0WA 1EFAA 3T35A 3LQ2A 4YIHA 2FR0A 2OBFA 4GMFA 4PC2A 4ZP1A 3UXEA 2ZBUA 3OZGA 4F97A 4LYDA 5BSHA 1V16B 1XMPA 3QHPA 2LGJA 2YDYA 3PJEA 1CEQA 3V4LA 1IBKB 3ZD6A 2GBLC 3MD9A 4YMUA 4DHWA 3D8SA 4ZI5A 1L5MA 1YUNA 2BJHA 4EZIA 1PL7A 3ZWWA 3I6ZA 4H60A 4MUHA 5F73A 1KYIA 5EKXA 4EG0A 1JEAA 2JH3A 3S2UA 3LKVA 4ZXFA 4Q19A 1ZNXA 4QYWA 3ZBPA 1FMLA 1PL6A 1E9FA 3OECA 4XFJA 2FWJA 1P3JA 2B83A 4XJXA 4C06A 4N5IX 4J2HA 4BLVA 2YWFA 5D3MA 2PSSA 1NBHA 1X7WB 4R83A 3SSMA 5F52A 2IH4A 3AUXA 5CG1A 2Z1MA 3NYIA 4QGSA 1XZLA 3MUFA 5HCIA 3IBSA 4CG2A 4BY9E 4Y18A 3CUTA 2ZYDA 3NXKA 1I6KA 4G1FA 3IDFA 2C95A 3R9WA 3GZTB 1NI3A 2I29A 3FKJA 3FVQA 3O95A 2GEDA 4I9NA 4XQCA 2P1RA 3IBYA 2JBAA 4KFTA 4BO5A 1A9YA 4QARA 1AKEA 1AOXA 1C1DA 1RJGA 2FN9A 2O1SA 3BTSA 1EJ6A 3JQRA 3ZI0A 4Z7JA 2PH3A 3DF7A 4PZYA 4GZ6A 2OAP1 1O6ZA 2AKYA 5G40A 2PKCA 3KT0A 4KE9A 3PD0A 2ZRIA 4ZV7A 2VSOA 5LXTF 2YXBA 3R7LA 1GU1A 3K8YA 5E1BA 3OCUA 1W5TA 3PQDA 3WL7A 2V7QA 2D2XA 4CT5A 5C81A 3PYXA 4KPGA 3VR2A 1LTQA 2JAQA 3ASVA 4UTOA 4BPRA 5AW0A 2FB9A 3ESYA 3N07A 1T1JA 1T9BA 2F55A 1MOSA 4QVIA 4GU5A 4IUDS 3PVCA 1II8B 1NNI1 2GGSA 4E0BA 2ONZA 1OFVA 1TUIA 3DVRX 1OJLA 4OUKX 4X20B 4C14A 4ZT6A 4W1QA 3UG7A 1FYFA 1NF8A 1SC9A 3OX2A 1JDVA 3PQ8A 2ZJ2A 4NBVA 3CX7A 2Q5HA 1TJPB 3CH5A 3G59A 1QVVA 4UOEA 1CZRA 2FSPA 2XIJA 1PS0A 5IKOA 1CJBA 3EIEA 1AGPA 5BWMA 5K20A 2AOVA 1MRNA 2ODNA 4LBVA 4BQPA 4AULA 5AK6A 1V48A 2YUTA 1G291 1NVWQ 1UDWA 1UDXA 4I6EA 1AZLA 1PZHA 1W6UA 3L7OA 3MJDA 3QEMB 3ANXA 5CVDA 5JBIA 5JU6A 3TR0A 5EVCA 1C1HA 4MUFA 3TTTA 1VKJA 2AFHA 1WDKA 3GX1A 2JH9A 3ILVA 2BR3A 3M0EA 4K3UA 2GCEA 3DV2A 3DL0A 2EBUA 1NVGA 1U02A 4REOA 4DA0A 3K6SA 3BGWA 1IM8A 1PJQA 2HO4A 3QV2A 4HEQA 1WDTA 1HLGA 1BFDA 1NMXA 2JB9A 2YX1A 3B1FA 1RJFA 1C14A 1SUAA 1UBFA 2I80A 4K9RA 2Q6IA 3B8HA 4M0FA 4YTEA 3VJKA 1YK0A 5E7JA 2Q2NA 3DE6X 3LL4A 3OJXA 4JQSA 4MJXA 1XEXB 5CITA 2FPRA 3K0HA 1DUSA 5AOAA 4NQZA 3KP1A 4LF5B 1HYEA 3WP0A 3ZNOA 3TQIA 2VYQA 1GLVA 5JVDA 4JC8A 1M7BA 2P2GA 2I3AA 4Y2VA 2NADA 2QORA 1DOHA 3BULA 4GOND 3H2BA 5I4BA 5I45A 1ZW6A 4F3CA 4Z3OA 1XNQB 3PNQA 3Q3GE 4Q02A 1S6YA 2B4YA 5CXQA 1CUFA 2HFKA 3RRJA 4O4JF 2FQYA 3CO5A 2XVAA 1RHJA 2F62A 4DZZA 4RULA 1DJQA 1DUIA 1VMKA 2ZAYA 1Y8RA 3A7DA 4BCDA 5JYDA 1FU8A 1NP3A 2O2DA 3LWDA 3MWLA 1E6MA 1VHWA 4IF6A 5CJ2A 4WBNB 5KYGA 1XX6A 1X70A 2HA2A 4KZKA 2VEDA 3R8XA 1GUDA 4G4JA 4M46A 1I4EB 3VAZA 5JS8A 2Z58A 4J0QA 3K30A 4EQ6B 2XX3A 1PEAA 1O97D 1D5WA 2ZRMA 1VG9B 2HLDD 3QXJA 4WWHA 1HDZA 1MHPA 1MAHA 1DRKA 2PKRA 3KKLA 5ALYA 3PRYA 5A04A 3AVUA 3EWSA 1QVZA 1SPXA 3IUNA 3RTDA 2J09A 1XNJA 5EPEA 3BAZA 4AP5A 3L4KA 4GOOD 4C7VA 3H1BA 3AOGA 3NGLA 4GP6A 2YZ7A 3F49S 4DXHA 1Z74A 3LG2A 2O1XA 3RASA 4IV8A 4DT1A 3KVRA 1NWCA 1U2PA 4D43A 5JTUA 1W4BA 4HNGA 3FYHA 3U3JA 2FMIA 3CZ9A 2WF8A 4PWZA 2BI4A 1I80A 3C7CB 3GAMA 3OQJA 3ZHZA 1T9GS 5DGCA 4NZYA 4I08A 2OA0A 2WJGA 3LX8A 3VHRA 4EFNA 4BCCA 5JZSA 4BQOA 4FYIA 4HB0A 1D3AA 1G20B 3Q3VA 3L41A 3ZZNA 4GYJA 4BU0A 3AONB 1HNNA 1A9RA 1KJWA 4X1YB 1OWLA 2Q3JA 5KTSA 2O6HA 2J07A 2WSSA 2XI4A 5C1PA 3TQTA 2I2WA 1NAHA 4AKGA 3OX4A 3DBRA 5LZ2A 3NETA 3CCCA 4GWGA 3AL2A 3HN7A 3DEFA 1NASA 3HB4X 3NO4A 4TZ6A 3AIMA 3COYA 5EVJA 3A1FA 3RTBA 4DDVA 4U7DA 1PK8A 2BCGY 4C4SA 1U2GC 1IWOA 2NXCA 2PY6A 4ARAA 1Y1TA 4CCSA 3VR4H 1NVBA 4D0GA 4EP1A 3QOYA 5E6RA 1M75A 2PS1A 1SEVA 2QVZX 1PYOA 2RB5A 2BI8A 4G0NA 5AT1A 1MQ9A 1ZL2A 3KT3A 4HNAA 4R5MA 1IB6A 3ZZUA 4ZVQA 4J76A 4RS4A 1R9MA 4Q7KA 1M2EA 2FPLA 4IH4A 4BFTA 2NXNA 1EUDA 1DZIA 2R00C 1ZM9A 2FWMX 1Z36A 3DWGA 3ESRA 3IJEB 3ITEA 4TV8F 2QR2A 3U6BA 2A1UB 4EG5A 3IALA 3UVEA 1QDUA 2O6LA 4WNIA 5DBIA 4F5DA 1U5AA 3RTEA 4G5RA 1GZUA 4COOA 1DQZA 2BM9A 4E12A 4OCZA 2Z0MA 4IIJF 4Q3BA 3BICA 4QSHA 1W8IA 1L1EA 1DBPA 4ZAGA 1AKVA 2HPVA 2LZ0A 1WW8A 2HHLA 4WIAA 3UFBA 3F2IA 4E4TA 3L7IA 3OCCA 4FGWA 1DIHA 1L5HA 4Y2QA 4XUGB 3ZNNA 2WJWA 5HKKD 4X97A 2GCIA 1BWRA 4PYLA 1NR7A 2UUOA 2FAXA 1MJ5A 3HCWA 4OQDA 1K8YB 2ZQYA 4QU0A 3AVWA 4CLRA 4PWYA 3JQCA 4NYMR 2YJGA 1QAOA 1AMUA 3OBIA 3HCNA 1KSJA 5K99A 5F9MA 1EBBA 1YQEA 3FFXA 4PNHA 4XR4A 3KB2A 1IL0A 1KP9A 4Q9HA 3RHZA 2IPMA 4B6SA 6AT1A 4EG8A 1IEWA 1C3VA 2O23A 1XLTC 2FPIA 2RE8A 3THXA 4R1PA 5DIFA 4D81A 4NE7A 3HN6A 2WJPA 2ZE7A 1RU3A 1FMJA 2FCAA 2B37A 1S02A 4B46A 3PDIB 1DELA 2W00A 3EMBA 3LU1A 4PEVA 4RVOA 4GL2A 2O0KA 4POOA 2BDEA 3AHJA 5E7IA 1Y80A 3BK7A 2BE9A 2HBRA 2J0EA 3UKJA 3HKCB 1WOYA 4O5AA 4BO0A 2ERCA 4Q34A 4CQJA 4K1XA 8ADHA 3GFVA 3KBOA 4B6RA 3GYBA 1M74A 3KEFA 1CG6A 2WWTA 4Q47A 4PIPA 1IUKA 2WMYA 3K9WA 3USCS 3ZHCA 5K3FA 4CUJA 3S1AB 4J4TA 1IBLB 4XOIA 1PFGA 3GVCA 2W2NA 3BTUA 4W6QA 1Z4PX 1YJQA 3QUQA 4K5QA 5NLLA 3WICA 4G0VA 1E89A 4IRXA 4TTRA 1JHPA 1WSAA 2B1RA 3I42A 4KXWA 1G6HA 2IU4A 1G9SA 4MVXA 3TRDA 3VHXB 3DYIA 1I36A 3HB5X 4L02A 3EZYA 5ER9A 2QBYB 4IAOA 4PSAA 1HEIA 1IDN1 5EGNA 2WQ6A 2XB6A 4GE3A 1PUXA 1J2RA 2NWQA 3AY3A 3I5UA 1PFVA 3ILYA 3EIQA 1U3WA 3DXYA 1E5LA 1CVIA 1EA5A 1EWYA 2P0YA 2OG1A 3OJEA 4AN0A 4F92B 1FY2A 2IBSA 4ZVNA 3JU3A 1AS3A 4PYMA 1X7XA 4H31A 4KBGA 4YCJA 4NPCA 4ZZIA 1K63A 3HA7A 4PZZA 2IXDA 3DMGA 3GROA 4TUYA 1YCGA 5FOSA 1DS6A 2LDXA 3LF2A 2ZJ4A 2RI1A 3R6WA 4KJXA 5EZYB 4DA8A 1WZ2A 4JIMA 2GD2A 1MLDA 4OI0A 4MCAA 2QF7A 4O2AF 1JXOA 3E18A 1EAYA 1GQSA 4HX2A 2BI7A 1PT5A 2EXXA 4EYEA 5TJHA 5BYKA 3BGOS 1P17A 2FOLA 3I0NA 1LPMA 2CJFA 2XOKD 3H4TA 1NNSA 4ZVKA 4JXXA 3CS3A 2ACWA 4TQUS 3KKKA 1WXWA 3TAXA 4HTFB 4CMAA 2YN2A 1JDBC 5FPPA 2BFDB 4N8DA 2FPWA 2EATA 1T15A 4ICIA 4IFEA 5A7GA 2J8ZA 3JZDA 2PZFA 2DCMA 3ONFA 4HPWA 4ARUA 2XTNA 3SMQA 1PW5A 4JX8A 4OSEA 2YVKA 3T52A 3DL4A 1FDRA 1KEWA 1VRWA 1ESNA 3C2QA 3WYGA 5LLTA 3IT1A 4EHKA 4FOPA 2NUAA 3IPCA 2VP3A 4XIJA 4I4TA 3OF5A 3EVFA 1DKOA 4HGZA 2P67A 2I03A 2ZE5A 4TLEA 4CM1A 2JLUA 3A4MA 3NDPA 1T29A 1LLUA 5I9NA 2IE0A 2ASVA 1HTTA 3MMSA 4UDNA 4XSGA 4WLEA 5F1KA 1M2JA 3WMFA 4MW6A 1E2KA 1T5IA 2IYVA 3WRYA 5DX0A 2VDPB 2Q5FA 1ZGBA 5CD1A 5GMOA 1C29B 4EQ6A 2FPIB 1DBRA 4I8DA 1U0BB 3I9OA 2VTBA 5COQA 3OJLA 1XBTA 1JB1A 3LX5A 3OHPA 3QPWA 1ENZA 1UC4B 2ZB2A 3UUFA 4LRQA 3KHSA 4LOJA 1L1RA 2O20A 3IILA 2PT6A 2H7CA 3OTIA 1UKAA 2CLOB 2JC3A 2MHCA 1JMKC 4H4DA 4K9MA 4LYEA 1S4MA 3SY8A 5G1OA 5CXSA 2R6GA 3MWYW 1B8NA 4D9GA 2DULA 3FKQA 3PLNA 2QN2A 2EZ8A 2YS7A 1G5TA 3BUSA 1JFVA 5JMTA 1WB9A 4N41A 4UCQA 2XT0A 1ADBA 4FUQA 1RM3A 1QDLB 5ICFA 3FAKA 2WEKA 3S29A 2NUPB 5I7SA 2OM6A 2P2ZA 1U0OC 4R1LA 3RVOA 2FSVA 2CLHB 2JFBA 5K2OA 3HJUA 4KBYA 2IU6A 2B35A 2I55A 5JSQA 2J5RA 4E5PA 5JISA 2PIDA 2JI6A 2J08A 4EH1A 2MSCB 1RQ2A 4ZAFA 1T3LA 3AC0A 4EB6A 4JOQA 1EK5A 4WW0A 1W5AA 1W52X 2BKXA 3G85A 4RDXA 1YFJA 3EEQA 4W8HA 3D81A 2DFVA 4MVJF 1U65A 3KO8A 3KOWA 3RRNA 3RUFA 3H5LA 3JARB 2GASA 4PG5A 3GLFE 5AXCA 2VRCA 1HX7A 2C2ZA