1T2EA

Plasmodium falciparum lactate dehydrogenase s245a, a327p mutant complexed with nadh and oxamate
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
317
structure length
317
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHAAPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKPLAHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and Activity of a Series of Azole-based Compounds with Lactate Dehydrogenase-directed Anti-malarial Activity.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
total genus 117
structure length 317
sequence length 317
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1t2eA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1t2eA02
4I5GA 2B5WA 3UN1A 2WTBA 4TZTA 4QFDA 3E9MA 4E2YA 1YVEI 1DRVA 3VKUA 2EHDA 5KKCA 5BNIA 4XRRA 4MVJP 3GEDA 4BO7A 3F5SA 3E03A 4ZRMA 2VWPA 2Q2VA 1BVRA 4FFPA 1GYPA 1YQXA 4OL9A 1YGYA 3ZU4A 2VRCA 4RPHA 1E6EA 3GN2A 1AUPA 1SEPA 2XPCA 4TVOA 1ONPA 2QRKA 3HDHA 4BO2A 1P1JA 4B8WA 1YDEA 2CF5A 4FR5A 3MJ4A 2AMFA 4CQMD 1JVSA 1DAOA 3P2OA 3HDQA 4LRSB 3RWBA 5G4KB 2VOEA 4IQ0A 1RJWA 1ZCJA 2VHYA 2Z5LA 2X9GA 2GZ2A 2P9EA 4RLSA 1P77A 1P1IA 2G82A 4U0JA 2D59A 1QP8A 4RVFA 3VZPA 5AQ1A 1IPEA 5EQFA 1E3SA 2PGJA 2C0CA 5KJ6A 4DLBA 1Q7GA 3I4FA 4R1UA 2VCYA 3E6AA 5JNLA 4D3FA 4CQMA 1BVUA 1PL6A 3N58A 1ORRA 2I6TA 2I9PA 2PNFA 4H3VA 1EZ4A 1ZO8A 4A26A 4UVHA 3JYOA 5BNTA 1I2ZA 3I6QA 4M54A 2NUAA 5JSFA 4XYBA 1YL7A 3BAZA 3FBTA 1E1KA 3KZVA 2HK7A 2W8ZA 3ZHBA 3EHEA 1PWZA 4EDFA 3JQAA 1QG6A 1TVEA 1CWUA 1P1KA 1NFQA 2C7VA 2FSVA 1CETA 1GY8A 3DMYA 3KSUA 4K1LA 3ZV4A 4A03A 3VVCA 2JD2A 1BXZA 4AJIA 1ZBQA 5ES3A 1H9BA 3MJTA 2G76A 1DC3A 4XA8A 1ZXLA 2NLOA 4ND3A 3LZ6A 2XOXA 1NAIA 1NAHA 2CVQA 4OXNA 1E6WA 4TKLA 1XU9A 3OIFA 2QG4A 1LDGA 3EY4A 2NTJA 1D3AA 2VN8A 2G1UA 3AK4A 4CLHA 5HWSA 3HJAA 4CM4A 4BV9A 3PIDA 4GSKA 1X1TA 2Q99A 4BO9A 1B0AA 4R9SA 1B14A 2ZQYA 2H6EA 2DTDA 1X1EA 2WD7B 2Y0EA 3ICCA 4L4XA 5T8KC 3GAZA 2Q2QA 1HSZA 5CP8A 5A4DA 2WE7A 1SCUA 2PZJA 2WMDA 2Y0DA 1V8BA 5AVOA 8LDHA 3ZH2A 4PRKA 4GMFA 4ZQEA 1NXQA 5LDGA 4XR9A 5A06A 3Q2KA 3OEWA 1GQ2A 2LDBA 1P3DA 1T1SA 3UOGA 3QY9A 4J7CA 1RYDA 2VUUA 4N5NA 3K73O 4YBZA 3WGYA 3LYLA 4JJGA 2C82A 2Y68A 3ONFA 4L8VA 4RLHA 3NDJA 1YBAA 4XDZA 1LDBA 2W2LD 1QYDA 2GD1O 3LT1A 3EZYA 4D44A 4W9NA 4NHEA 4OM8A 4CLDA 5DF1A 3R3SA 3JYQA 1K0UA 1GYQA 4BMNA 2EEZA 2QQ5A 4D41A 1LC3A 5I9LA 1C1XA 3GLQA 4PG5A 4AG3A 4NFHA 1LBEA 1JA9A 2GDZA 3RJ5A 3GG2A 1ZXBA 1I3MA 1E3LA 1BW9A 1G0NA 5F3RA 3PHJA 3C8MA 5EQDA 1GPJA 5HS4A 1ISMA 4LN1A 2VUSA 3WNQA 4WOKA 3DZFA 1LI4A 3LF1A 4NK5A 3K96A 3VPXA 3WGHA 4BGEA 4F6CA 2R2GA 2ZB3A 4J43A 3ASUA 2YFQA 3CEAA 4AVYA 4BS9A 4MJLA 2HCTA 4CMKA 4NDNE 5B4TA 4IINA 3L0DA 4M89A 3JQEA 3DFUA 1NQ5A 3KSZO 3NV9A 4YXFA 4DIBA 5L40A 3HDJA 4GX2A 4BO5A 1R0KA 1O9BA 1VSUA 3KTDA 1GQQA 4L9RA 1J6UA 1MA0A 1JW9B 4D42A 2FR1A 2Q45A 4ND5A 4ALJA 3PDJA 4RCVA 3U4DA 4D0SA 4BKRA 4HY3A 2GZ3A 5K6AC 1ENYA 1E3JA 2CMDA 2B4RO 1YQGA 2DPGA 4PLFA 4CQMB 4NFYA 1DIRA 1QRRA 4U8GA 4FJ1A 1H6CA 2BELA 3S2GA 3WGZA 3DZIA 4E30A 3ZN2A 3ZWOA 1CF2O 1EUCA 3WIDA 3QWIA 4O0LA 1O0SA 2DTEA 5U9CA 3QWFA 4HUJA 3UXYA 2QZZA 1WDKA 5IZCC 1GEEA 2XXJA 3UCXA 3RUDA 4Y6PA 4BNKA 4CL8A 2RHCA 5CPFA 3BYZA 2BFAA 4FC6A 4JK3A 2ZB4A 3KSDO 1MLDA 3FWNA 1V3UA 4B4OA 1E5LA 5KNLA 1X7DA 3C85A 2YV2A 1KC3A 5G2OA 3ZW9A 4D43A 4PLGA 4B3JA 4IJWA 4IBOA 5C37A 2X4GA 3PEFA 1NWCA 3W6UA 4PGFA 2PKQP 4FS3A 3UHAA 2OBNA 3DHNA 1BXGA 2FRDA 2Y1OA 1EVIA 1M6HA 3S1LA 2A92A 4MVJH 3UAGA 4D3DA 5A9SB 3EGOA 1OC2A 1QSGA 4Z0HO 2AA3A 4DUPA 4GKBA 1SNYA 2WD7A 4ND2A 5CDSA 5DBIA 4YRAA 2YQ5A 2HO5A 5DCUA 1ZEMA 1SBYA 3D3WA 3EC7A 3X2FA 4CV3A 4E0BA 2EKQA 4OXKA 3WMXA 2NVBA 4DA9A 4P4GA 2ZJ0A 4MVJI 3MCVA 3QW2A 4Y6RA 4OKNA 3AUSA 2B37A 3LF2A 3HUDA 3JQGB 4IIVA 4TZKA 1JAYA 2V6BA 3O4RA 5JCJD 3AI2A 1W73A 1GCOA 1DC6A 2E48A 5G0WA 2FHSA 3VH4A 2ZTMA 2VNSA 2Q4BA 4DREA 4PCVA 2AEJA 3QV1A 1XCBA 3TZ6A 3ZWWA 5JAIA 1CERA 1A4UA 1YKFA 3W8FA 4OJNA 4HNGA 3E8XA 5IG2A 3JQ8A 3QQPA 4IJVA 3OICA 1CRWG 2P68A 2HK8A 3G3EA 3GEGA 4DC0A 4ALIA 5HTOA 2V6FA 3CZRA 4R5MA 4RF3A 3ANNA 1ZIDA 4EI2A 3RKUA 4GSLA 1T4BA 2NV6A 1ZH8A 3BA1A 3FNEA 4NQZA 4R3WA 4B7CA 1ZNQO 2OO5A 3F5QA 1ARZA 5FFFA 2DM6A 1ISIA 2P2SA 5F5LA 3DTYA 1KOLA 4AFNA 3JYLA 4IDFA 3I6IA 4IDDA 4XX0A 3DB2A 3DZKA 2ZTUA 2FY8A 1P31A 1PJ2A 1UH5A 3EAGA 4BOYA 1KEVA 4RVDA 3AY7A 2B69A 2FSSA 1N8KA 3I83A 5EPOA 1HDZA 3G1UA 5ILGA 3V2UA 1AE1A 2ZJ1A 4TRJA 3Q0EA 3IUPA 3OHSX 1NM5A 3H9UA 3AOEA 2I76A 4FW8A 4OKIA 4JBHA 4EUFA 2PZLA 2BFPA 2VRBA 2AEMA 4PLYA 1JKJA 2GO1A 4R68A 1Y7TA 2E37A 4BKOA 5L4NA 4WE3A 4BUCA 3RBZA 1LQTA 5I8WA 5KIAA 3RROA 1VE9A 2VHXA 1FF9A 1PZEA 1VJ1A 5FI3A 1XA0A 1HYHA 1S6YA 1SAYA 4CLOB 4WOJA 4YQZA 4GKVA 3SXPA 2AQIA 4L4SA 1K5HA 4L73A 5DNAA 4J4HA 1L1FA 3K31A 3A4VA 4K6FA 3WB9A 4IIUA 2GPTA 4FIZA 4RDHA 2V7PA 3H5NA 3SJ7A 4AL4A 3IC5A 4LMPA 3TNLA 4Q3CA 3WOHA 3K8ZA 5G0UA 4ZVVA 3UGKA 1BW9B 4AICA 3ROMA 4WGGA 3VC7A 2O7SA 3U4IA 4UEOA 2V6GA 3B20A 1SOWA 2NWQA 4Q3NA 5ER6A 1A5ZA 1VKNA 3GC6A 1T2DA 3RC1A 3JD1A 1HDXA 4CM8B 1R4NA 3RQSA 1LX6A 3Q6IA 3EK2A 3NEPX 4FFLA 4NBVA 5KTKA 5KJCA 4WPGA 1NQTA 3X2EA 5JW6A 1DHTA 4N5MA 5EN4A 1DIBA 2J5RA 4FFMA 4BHTA 3ASVA 4IZIA 5MDHA 2H1SA 4IMPA 4JBGA 2ZYAA 4AJJA 3D7LA 1PZFA 4CR8A 3HSKA 1K89A 1Y1PA 3ZU5A 3HN7A 2VZ0A 3KHUA 1TT5A 1DBVO 1ZMTA 1NBOA 3LLSA 2CUKA 4YA6A 1PJ3A 2NVUA 2D3TA 4URFA 1Z45A 1EUDA 2H63A 1NVGA 3O8QA 1JWBB 1TT7A 3CPSA 4WCFB 1Y8QA 2Y1GA 3PJGA 1M2WA 5EL0A 4RF2A 3TQHA 3RC9A 3GRPA 2PD3A 4R1SA 5BR7A 4WEOA 3JQGA 2NACA 1BSVA 4MPDA 4YAJA 3IS3A 2VWQA 2I65A 3Q1LA 5U4QA 4M86A 4OSOA 1ZVMA 3H6KA 1MC4A 3ZNPA 4WECA 5EINA 1I24A 1LDNA 3MTJA 3AOEC 1BRMA 3D5QA 3IMFA 3MZ0A 5JCJA 3TFQA 3F47A 4GWKA 3AU9A 4PIVA 1A9ZA 4WK6A 3LU1A 4FC7A 1XDWA 1YB1A 4CM9A 3E9QA 5JDIA 2IDZA 3PHHA 5AXCA 3UW3A 1HKUA 3QWAA 1ENPA 2B0JA 4Q3BA 3QA9A 3JD3A 3PJFA 2DBQA 4XQGA 5JXWA 2D5CA 2X1HA 3F46A 3Q2IA 4TKMA 5JPIA 3FHLA 3A28A 3C3XA 4TRNA 3SVTA 1T26A 1IYZA 1R0LA 2WE8A 2DUWA 1HE3A 1OBFO 4BKPA 2VQ3A 4E21A 4E33A 1JAXA 4B7XA 1LEHA 3WWYA 4OQYA 4IGFA 4AJNA 2VHVA 2HK9A 3D4NA 2JFGA 3GHHA 4Z0PA 5I7EA 2BMAA 4UREA 1OI7A 3CINA 4BNXA 1QYVA 3V5NA 2I3GA 1GDHA 4DXHA 3OA2A 2VTEA 1A7KA 1GV0A 1KY4A 3PYLA 3LLVA 3Q11A 4L0QA 4RV9A 2JHFA 2BFMA 1CEQA 2W2KB 5CDUA 4HNHA 5IFLA 4JJIA 3JQ9C 2GN4A 1Y5RA 4D3SA 2HSDA 2HMSA 1MXFA 2WJPA 1NHGA 4YDRA 1Z75A 2VWHA 2CVZA 1AHHA 1O89A 2Q1SA 5BSGA 5IN4A 3RBXA 3A9WA 1J0XO 4ZHSA 5A03A 4O5OA 5JE8A 5DBFA 3QWHA 4F6LA 3GDFA 4OQZA 4PVDA 4NR0A 3UCEA 3DOJA 1VJ0A 5A02A 4CLRB 1N2SA 4FOOA 1PJ4A 2W2LA 5JO9A 1YBMA 1N5DA 2IYPA 3CXRA 1F17A 3U3XA 5L51A 2C7GA 3SX2A 1QORA 9LDTA 3AFNA 1B16A 3FD8A 1RKXA 2J3KA 1LQUA 4U6QA 1U5AA 1T25A 3PJEA 3DR3A 3H9EO 1I10A 2OORA 3KVOA 4EITA 1WW8A 1IULA 2PWZA 2RCYA 4EYEA 4Y9DA 1HSOA 2PZKA 4HKTA 4OIMA 3VH2A 4CM8A 3HADA 3QVXA 1X0XA 2C2XA 1CQIA 2VUTA 2RH8A 4CODB 3KLMX 5FEUA 1JVBA 4JP3A 4XEHA 3IDSA 4QO7A 5CAEA 1A9YA 4YCAA 2NU7A 3DHYA 4WNCA 4DQVA 4BO4A 4QX6A 4FN4A 4R69A 2C5EA 2O3QA 2C59A 1TT5B 2Y1DA 1U7TA 1E0DA 2FPIA 3BXXA 3LT4A 4II3A 4Q39A 2YHIA 3TOZA 2OMEA 3WSVA 2PK3A 2P4QA 3KXDA 3FR7A 1UZLA 3H2SA 2UYYA 4DQXA 3WSWA 2Q4EA 5CDTA 4DTIA 2CDCA 3VZSA 3M2TA 1ML3A 4XB1A 3N74A 4I5EA 2Q1WA 4JQCA 4YT2A 1LSOA 3MOGA 4QECA 1UR5A 5T64A 1PQWA 2XXBA 4UUPA 2NU8A 3VTZA 1QXSA 3VZRA 4EGFA 5I7FA 2FN7A 5JYEA 1Q7BA 3FWZA 3DEYX 2Q1TA 1YWGO 2R00C 4XIJA 4QT0A 4JN6B 1O5IA 3AI1A 1HYEA 2FMUA 1WMAA 4DIFA 1Q2XA 3LT0A 3R3JA 3DC2A 3ZHYA 4CM3A 2AE2A 3GN1A 1EVZA 1ZK3A 3D4PA 1EEHA 5KVCA 3R1IA 1PR9A 1A7AA 4DIOA 4JLWA 3ZWPA 5TC4A 3M1AA 3G79A 1UZMA 1V9LA 2HAEA 4R51A 3ST7A 4HFMA 3PYXA 4BNVA 4W82A 3WLFA 1DIAA 4ROSA 3GZNB 4QEDA 2UUOA 1HXHA 3V1TC 3R0IA 3ULKA 3L4BC 2AQHA 2AXQA 1C1DB 4H7PA 4XWYA 1B3BA 4HFJA 1DXYA 1LRLA 2RBEA 5GY7A 2PR2A 4J4TA 4RVHA 5TLSA 3I9LA 1BMDA 2OHXA 3W8DA 4NBUA 1CJCA 3DWFA 2R6JA 3KYDB 4XQ9A 5COQA 3VPSA 3VZQA 3WQSB 3W8EA 4DVJA 3WGOA 5DP1A 3RUEA 1P1FA 2WD8A 4Z0TA 4BNGA 2X9NA 4UAGA 1VL0A 1WLYA 6LDHA 1UXJA 1DJQA 1TXGA 2YV1A 3FTPA 3H9GA 3VPHA 2GN6A 4P38A 3JQ9A 4LSMA 1MG5A 1V0JA 1WDLA 3A06A 4AJOA 2F1KA 5GZ1A 1FDWA 3HNPA 2PKRA 3MOIA 4J16A 2Y1CA 4O6VA 2JKVA 3TSCA 4CLOA 1PU2A 5KJFA 2NU6A 1W6UA 1SO8A 1ZSVA 1B7GO 3M1LA 4RF4A 4MO2A 2IZZA 3DL2A 1IHXA 4ZU3A 1LDMA 2Z1MA 4NJMA 3ZV5A 4GQAA 3RUHA 3F4LA 3IOYA 3OJLA 1CIVA 1F8GA 2D2IA 3MWDB 5CDGA 1YOVB 4NPCA 4F3YA 4PG8A 5C5IA 4KQWA 2XAAA 4Z9YA 4YAIA 3Q9UA 3U0BA 3OJEA 3ZGYA 5T5QA 4DPLA 4GI2A 4YJHB 3RUAA 4WASA 1SPXA 1PGNA 3V2GA 1E3EA 1PL7A 2DPHA 3S2EA 3WGGA 4RPGA 3PVZA 3HFGA 4TVBA 3NJ4A 4RORA 1U8FO 1XKQA 5IN5A 2QHXA 1E92A 3S2FA 2HUNA 3CSDA 3NTOA 4EZBA 5L7TA 4UUOA 2WYWA 2BRUA 3KYCB 2JCXA 5AXDA 3OBBA 4GVXA 3NUGA 5KJ1A 1XQ6A 3C7AA 1NPDA 2O3UA 3EDMA 4ZGWA 5L3ZA 1I32A 4HXYA 4E3ZA 3KO8A 1UXKA 1I2BA 3GH3A 5BNFA 5ADHA 4LCEA 5JCXA 3VHRA 1GR0A 3WMWA 2HMUA 3GNTA 3IQDB 3JQBA 4UVIA 1E7WA 1ZKMA 3Q9NA 5L9AA 4FBGA 2P5YA 4Z3DA 4HX5A 3DZGA 5AOVA 1O95A 4I5FA 1V3VA 1Z7BA 4OGWA 4CLRA 3UUWA 1OC4A 4TQGA 4DL9A 1ZW1A 3M6IA 4E6PA 2EJWA 2B83A 4OAQA 3CE6A 2PD6A 1T24A 3SLGA 2VZ8A 3OJFA 2RIRA 2J5QA 2EP7A 3L6EA 4IY1A 5KVQA 1U5CA 2EW8A 4KWIA 4Q3EA 1PQPA 3I23A 4QSMA 4UULA 3AOGA 3C1TA 3JQFA 5A5FA 3JQ6A 3TZCA 4YR9A 4IQ8A 2C54A 4J91A 3MJEA 4ALMA 2OUIA 3OIDA 1C1DA 4BGUA 1C0IA 3QVSA 1GAEO 2OL4A 3FTNA 2IEDA 5F1PA 3PQEA 1P9LA 3RFVA 3RUCA 1KVRA 2NSDA 2V65A 1N9GA 1I8TA 2CNBA 4XYGA 1YDWA 2GN9A 2IRWA 3KOUA 1W4ZA 5ENDA 4RGBA 4FGSA 1E5QA 4PLWA 2EWMA 3ANLA 3JD2A 1LDEA 1TI7A 3ZU3A 4N7RA 2X0RA 3T4EA 5JAMA 1HRDA 4MVJA 2O3JA 5DN9A 5ER9A 1IY8A 1U2DA 3NDRA 3RSHA 3TWOA 2IYOA 3ORFA 5IXSA 3GF4A 4Z3KA 1C0KA 3CUKA 4MIYA 2HU2A 4BNLA 1FJHA 2Y67A 4GMGA 3DO5A 5TF4A 1A4IA 2X6TA 4N5LA 2UV8A 4NBTA 3EYWA 2UVDA 1HDCA 5H83A 2JHGA 2OOSA 3PTZA 4LVCA 4YT8A 3NJ8A 4KQXA 1P0CA 1M76A 1Z82A 2DBZA 4GX1A 3AW9A 5JY1A 2W90A 3BMQA 4XJSA 5CG1A 4QQRA 4IS3A 2HRZA 1I5RA 1U7HA 1ONNA 4YT4A 3ROPA 1YL5A 3IJRA 1U28A 2D5AA 3VPFA 2O23A 3O38A 4A5OA 1F12A 3I9KA 4BNYA 2X5JO 4ZN6A 1UDCA 2QX7A 4PN3A 4ZQHA 3DOOA 2JAPA 1VPDA 3P2YA 1E7YA 1PWXA 3AUAA 1ZK1A 2WYUA 4XD2A 4CUJA 1EDZA 2TMDA 1SZJG 3VPGA 5A5EA 2J6IA 1OMOA 2EGGA 3PHGA 4ITUA 4KUGA 1E7QA 3VKVA 2I67A 2Y1EA 1JQBA 5DULA 3ENKA 3H3FA 3T7CA 5HS6A 1B8UA 5JAQA 1AXGA 4Z6KA 3D3EA 3JQAD 4PLCA 4R54A 1XHLA 4FCCA 2A9FA 1MUUA 4KDFA 4GLOA 3KEQA 3GFGA 2IZ1A 3GK3A 3RBVA 4G5HA 5J23A 5CG2A 3KYDA 2CFCA 1EMDA 1C0LA 1WXDA 4TSKA 4YTEA 3RIHA 4U0KA 2VHWA 1GCUA 3U4CA 1BDBA 1E3WA 5KVSA 4S3MA 2ZK7A 1BHSA 4NIMA 3PGXA 3RCBA 1P74A 2EV9A 1CQJA 4MOWA 1K6XA 1PIWA 2GLXA 2EG9A 5JMWA 4BNJA 2DVMA 3G1TA 4INAA 4OOEA 4ZRNA 3PHLA 1CDOA 2ZB7A 3ZI0A 1ISGA 2HMTA 1U8XX 2VRCD 3PYMA 1QV7A 3OIGA 1B15A 1QV6A 4ALLA 4CMIB 1CYDA 5A04A 2D8AA 1WNTA 1NR7A 4MP3A 3PWSA 7MDHA 4PFJA 2Q1UA 3TN7A 1X13A 2YDXA 4NG5A 2QYTA 5JDCC 4JNKA 2Z95A 1ZK4A 3P5SA 4NU6A 4FPXA 4RZHA 3ZZNA 4CR6A 2GRAA 1YOVA 3L6DA 5B12A 5BQFA 5TIIA 1QYXA 1BWSA 2HMVA 3D4OA 1RM3A 4PLHA 2O2YA 1DFGA 3GHYA 3I9NA 5DBGA 2AHRA 3UFXA 4NK4A 1BG6A 1E6UA 2ZIZA 4QFCA 2CDAA 3LT2A 4CMCA 3D64A 3H9JA 4ALKA 1R4MA 5T67A 1K6JA 4KMSA 3PWKA 3SC6A 2FP4A 3FR8A 1FK8A 4A7PA 1LLQA 3PRJA 4E5MA 4B7UA 4IUYA 1LRKA 2A35A 1ZSNA 1Q0LA 5IDWA 4OSPA 1HL3A 3GDGA 4X54A 1V3TA 4W4TA 4YEDA 1V35A 1I01A 3K30A 3SEFA 1D4FA 1QYCA 1E1LA 1LTHR 1GZ6A 5ICMA 2O3RA 3ZV6A 5AXAA 3H8VA 1DAPA 4W9NC 3DBHB 5IDXA 2A4KA 4E5YA 4RL6A 4CM5A 2PH5A 4IGEA 1JN0A 3RU7A 3ENNA 3ZNQA 4W99A 4GVLA 3ANMA 1LC0A 4FOSA 3MJCA 3QP9A 1EVJA 4CPDA 1ADCA 3IP3A 2VZ9A 4K28A 4PZEA 1Y81A 3GUYA 1LXCA 1XWFA 1NPTO 3PQFA 4U7WA 4YRBA 1EBUA 3MWEB 3ZWCA 2EF1A 1NTOA 3U4HA 2E49A 1XYGA 2IE0A 2J3IA 3BMNA 4HV4A 1HE4A 3ZHZA 5T8KA 2P4HX 3F9IA 4D45A 3OA0A 3KBOA 1IHYA 3CKYA 4GX0A 1XQ1A 1DSSG 4BO3A 1IZ9A 5TRTA 1LLCA 3GDOA 3E5MA 2G5CA 4CMEA 4EUEA 2OXIA 3NT5A 4RZIA 1DEHA 3GVIA 3FF4A 3TL2A 5THKA 4MP8A 3IJPA 4XQCA 4PG7A 4ZQGA 1GPDG 2PZMA 4J4BA 1HDYA 4MKZA 4IS2A 3L4SO 4TRRA 4Y98A 3D0OA 1BDMA 1KC1A 4DC1A 4OOFA 3B1JA 3BIOA 2JD1A 4GBJA 5T6BA 1O6ZA 1QKIA 3ABIA 3FNHA 4H16A 5FI5A 4CLEA 4A10A 1C0PA 1GQYA 4YT5A 3PFFA 5KJEA 4J3FA 1I3LA 1U3UA 3NTRA 3WGTA 3JQDA 3DZBA 4R9RA 4RPLA 2YZ7A 5I9MA 2BI7A 3RKRA 1DO8A 1DOHA 3GAFA 4IDCA 4L75A 1WVGA 4R4JA 2DLDA 4ALNA 2DC1A 5JY6A 4IPTA 4E2XA 1X7GA 3FPCA 2PY6A 3DZJA 2B4QA 3NGLA 3GGPA 3KUXA 3LK7A 2DUUA 4XGIA 5COAA 1HEUA 3JSAA 4J7UA 1PSDA 2O7QA 2WEKA 4Q9NA 3U49A 3HZZA 3WICA 2GCGA 4E5KA 2Q49A 2JL1A 3MTGA 1Z6ZA 3HB4X 4JBIA 1R37A 5BSHA 4PZDA 4DGSA 2AG5A 4B79A 1GUFA 3OEYA 1GTMA 1VJTA 4HWKA 3PK0A 4J0EA 5DT9A 4BB5A 3TDKA 3I9JA 4NBRA 4KTTE 5ILOA 1EQUA 3V8BA 4HFRA 5TJ9A 3UH1A 4K26A 4MKRA 4BO1A 3GOHA 4BNUA 1OAAA 2FPGA 2Q46A 4DMLA 4TROA 1LLUA 3LC1O 3AM4A 3RC7A 1YB5A 4PVCA 2X86A 5L45A 4W7HA 3INGA 2Y99A 3JQBC 4ND1A 3V1UA 1K6IA 4QO8A 3O03A 4AJ1A 2XF8A 5TJHA 3TZKA 3V1YA 4B3IA 3NDIA 4CMBA 2BI8A 1LUAA 5F5NA 4CR7A 3ON5A 1DRWA 3WYBA 2J8ZA 1GV1A 4I9UA 1YL6A 1Q0HA 4TWRA 5L4LA 5CPBA 3U5TA 1H6BA 1DJNA 3VH1A 1RPNA 1K3TA 3VTFA 3O8QB 3DDNA 4DPMA 2HQ1A 2QRJA 1UDBA 2PH3A 1I3KA 4RVGA 2PFGA 1T1RA 1KVUA 3GR6A 4WLFA 4C7JA 4PLTA 1FXSA 5B4VA 1O8CA 3COSA 5HBRA 7ADHA 4I5DA 1H0KA 3HDYA 1HF3A 3WNVA 4HBGA 4OYRA 3WJAA 4BV8A 5L7WA 4M87A 2YHUA 2WM3A 1VKOA 3BHIA 2IXAA 2VT3A 3ZWYA 4WUVA 1HLDA 4PRLA 4FJ0A 4XB2A 2X5KO 5JC8A 3HG7A 1ONOA 5ITWA 3L77A 5CFZA 1GADO 5IAAA 2OBYA 1C1XB 1ZJZA 4J6FA 4CQLA 4CV0A 3GNQA 5EESA 5K9ZA 1A71A 2O4UX 2PV7A 3C7CB 5DZSA 4O63O 1HWYA 3S2IA 3OECA 1PJQA 1PJBA 3NYWA 5CEFA 4GLLA 1E7RA 1P1RA 2Y66A 1P1HA 3I4CA 1U4OA 3JYPA 1OFGA 2HMWA 2O2SA 4YB8A 2B36A 1M66A 4PG4A 1ZEJA 1W0CA 3T7EA 1MXHA 5TX7A 1ZUD1 1I33A 4Q3AA 5F21A 4NJOA 5IZ4A 1BXKA 3CMMA 1ADFA 3EUWA 1XSEA 1D1SA 5B37A 3H5RA 3KLPX 5DOVA 4K9DA 1J4AA 1EK6A 1R0SA 3ZDFA 2VTDA 4FGWA 3O26A 3VOSA 4JX8A 4OHUA 1KY5A 1FDSA 1ISHA 4WLVA 3BTUA 4D0RA 1HETA 5U1PA 1I36A 4R41A 2IZ0A 4UEJA 4YPOA 4NU5A 1GFSA 4BNHA 1GL3A 1F14A 2UAGA 5F1KA 3RUFA 4CUZA 4LVUA 4MDHA 2PTGA 5L95A 3UICA 5C7IO 4EJMA 1DLIA 1S7CA 2H5LA 1X7HA 1XR3A 1EE2A 1Z74A 1FDTA 2WSBA 1NASA 2EP5A 2ZYDA 4MINA 4YYZA 4KZPA 3QVWA 5FWNA 3JQ7B 1UP6A 4BL5A 1PQUA 3H2ZA 1IE3A 4NZ9A 3ZWBA 4WLEA 2X7HA 2DBRA 4IDAA 4RDIA 3PZBA 1MG0A 2J5KA 5FF9A 3GA0A 5C7OO 1ZJYA 3MJSA 2DFDA 4XYLA 1YE3A 2PGDA 1J5PA 5A9TA 3TZHA 3VH3A 3CMCO 1B3RA 5TSDA 1BXGB 4D46A 2B5VA 1XLTA 2FR8A 4FDAA 4YJFA 4JXKA 1C14A 4DYDA 1VM6A 4UUMA 1SB8A 3GZNA 4LW8A 2CVOA 4U5QA 1WP4A 1RWBA 1M67A 1EE9A 4XYEA 4TMFA 2DKNA 2VYVA 4DPKA 5C3MA 3TRIA 4K6CA 3KEOA 1A27A 1FDVA 2VHZA 3FNGA 3FNFA 4PZCA 4YAKA 5KVVA 4J9UE 2YFHA 1HLPA 3NRCA 4M8SA 3W4JA 4BGVA 1Y5MA 1ZK0A 2D4AA 3HQ4O 1AXEA 1DPGA 2NTNA 1ZMOA 3E1KA 3LC7O 2Y93A 1W8DA 4O59O 1KIFA 3P7MA 4UVGA 5G0TA 3STHA 2FZEA 4J2OA 5I8ZA 1YJ8A 3I3OA 3OJOA 4XQEA 4ZICA 4Y6SA 1P0FA 1YB4A 1GD1O 3C7DB 4CM7A 4CM9D 5ICSA 1JKFA 1QLJA 1U1IA 2IXBA 5A3JA 1PTJA 3B6ZA 3D1LA 4RVUA 3WYCA 1MX3A 1DC4A 2BD0A 2FR0A 4J90A 3W6ZA 3NT4A 2J3HA 4UVEA 3WYEA 3I5MA 5JO0A 1IB6A 3GUCA 3RUIA 4NJMB 3WQRA 3DTTA 5I9NA 1Z73A 3H65A 1SMKA 3JQ8B 1I2CA 4IDGA 5AXBA 2BGKA 2OZPA 1PS8A 3OJ0A 4Z9XA 4YRDA 3ICPA 3QWBA 6ADHA 5JS6A 1WZEA 1T4DA 5TT1A 5DCYA 4KDEA 4UVDA 2PD4A 4NMHA 4IJUA 1WAMA 4XKJA 3BTVA 1PGOA 3GMSA 3PP8A 4MVJM 2NNLD 2O3SA 3QE3A 4JROA 3TOXA 1VSVA 5IZCA 1FMCA 3INRA 5MGBA 3HN2A 4BKQA 1T2AA 1UDAA 1HDRA 1B8PA 3I52A 4U6SA 2NM0A 5K0ZA 2E4AA 2HLPA 3U62A 1GEGA 1H5QA 3BMCA 3G0OA 2NTVA 3AUUA 4JP2A 3PZRA 4PLPA 1KBZA 4BO0A 1H6DA 4CV1A 3AY6A 1PGJA 4D7AA 2YYYA 2HRBA 4BMVA 1DB3A 4ESOA 1SB9A 3AI3A 1F8FA 4G65A 2QZ9A 2EIHA 4JIGA 4LGVA 2ZTLA 2OFPA 4IJKA 4NH4A 3GG9A 1E77A 2JJYA 4KUHA 1HDOA 2Y1FA 1YBVA 5IF3A 2PA3A 1P33A 4MIEA 3QLJA 4BIIA 1KERA 5CDYA 1E3IA 1I0ZA 5G0VA 1X0VA 1SEVA 2VNAA 4A73A 4CQLB 3FPLA 5JYDA 1ADBA 1UAGA 2ZCUA 4LMRA 3WXBA 1H2HA 2X23A 3ADPA 5LDHA 4YJHA 4XGNA 3UF0A 2QW8A 1NPYA 1NFFA 5TT0A 1YONA 4NFSA 5EIOA 1OZAA 4P22A 1GZ3A 1JTVA 3LDHA 1XELA 3WJ7A 1AGNA 3L4BA 4PG6A 3IAHA 1EQ2A 4J0FA 1DFHA 1H9AA 1HYGA 3FBGA 2GNAA 4YJFB 5G4KA 1ID1A 3KV3O 5GZ6A 5KKAA 4DBZA 1HT0A 4FFRA 1MGOA 3IKTA 3PI7A 1RM0A 3FRJA 2I99A 5HM8A 4J2HA 2VWGA 4YJDA 1VI2A 3KYCA 4NBWA 5JFOA 4EEZA 5IJZA 2PGLA 2CF6A 5TNXA 1KEUA 3PWZA 4RVSA 2DU8A 4C7KA 5HA5A 3LQFA 4BNMA 1EVYA 1EK5A 1IPFA 2BLLA 4M49A 2HJSA 3VVBA 4BNWA 8ADHA 3RC2A 1IL0A 5C7LO 3JQFC 3IIEA 2F00A 4ZJUA 4LCJA 3GVHA 3ONEA 1BTOA 3DBVO 4YQYA 3GGGA 2IODA 3WWZA 4AJHA 1QR6A 4YAGA 4BQPA 1NR1A 4OMUA 5IDYA 1MB4A 2OP0A 4E31A 1ZZEA 3CTMA 1GUYA 1B2LA 4CMIA 1ULSA 2Y05A 3HB5X 1KVQA 5AYVA 2I3AA 3ROQA 2VOJA 1RM4A 1XGKA 2P91A 3AUTA 4FB5A 2X5OA 5EMHA 1KETA 1PZGA 1YH3A 2ZATA 4CLXA 4HFNA 3TZQA 2QRLA 2C2YA 1EDOA 3NKLA 4TRMA 3RI3A 1UXHA 3QRWA 3WG9A 1DLJA 1EFLA 1HZZA 4RPKA 5TGDA 3IKVA 4RJTA 4MVJD 4BB6A 1NYTA 3JQCA 4YACA 5BSFA 3WTBA 1KYQA 1M75A 2EERA 2J3JA 3WX0A 3RU9A 3AFMA 1XU7A 3PLNA 2JFFA 3ADOA 1GZ4A 5A05A 3S8MA 3ZWVA 1DIHA 5G0SA 2UUPA 1ADGA 4CUKA 1BGVA 1H93A 1SC6A 4ILKA 5H81A 4GGPA 2CDBA 2WYVA 2D1YA 2DBVO 4ZD6A 3WQQA 2DFVA 2EKLA 3TPCA 3FSRA 2WDZA 5ENVA 5CEEA 2YDYA 1N92A 2X22A 2W98A 1H6AA 1WWKA 4IZHA 4EUHA 3U09A 1ENZA 4MVJG 1NP3A 1WMBA 3JD4A 1QMGA 1N1GA 1LDYA 4S1VA 4BQRA 3ZNOA 4RO0A 3DAPA 2X0NA 4O1MA 4CMGA 3JV7A 1I30A 3FN4A 5EJ2A 3ZCXA 4A2CA 3WDSA 3AU8A 3BMQB 1A72A 1IZ0A 4GPD1 2HKIA 5I7VA 1NQAO 4AJ2A 5T57A 3IUSA 3TFOA 4F45A 3ETGA 3VDRA 1Y6JA 3ZW8A 1YS4A 2DT5A 2ZB8A 1V6AA 4GGOA 1KVSA 3O9ZA 3ZHXA 4R01A 4QTZA 3OETA 2V6MA 5JMPA 2Y0CA 4MVJF 4RQTA 3WTCA 5A1TA 3RASA 2AG8A 3NTQA 4CM4B 3QHAA 4DLLA 2I66A 4J9VA 3ZWMA 5A9RA 3D5TA 2X0IA 3SJUA 2AQ8A 3GVPA 2ILTA 4QXMA 3WFIA 4CM1A 1NQOA 4GX5A 1WDMA 4ONEA 3ITKA 3E18A 3K9QO 4OH1A 2C20A 4AJKA 3SLKA 5L53A 2JCVA 1TEHA 2O48X 4KP7A 2GYYA 4UEKA 1JU9A 1NVMB 3ZV3A 5B1YA 1MFZA 4YAEA 4L4RA 3DBLB 1DHRA 3GRKA 2AW5A 3I9OA 1AN9A 2RAFA 2ZKLA 3GVXA 1GYRA 4FFNA 3B70A 4LRTB 1XEAA 3OP4A 1Q1NA 3BMCB 5JDIC 2B35A 2I5PO 1YJQA 1KVTA 4B4VA 3PDUA 3QSGA 1Y8RA 2VYNA 4MP6A 2RHRA 3VAZA 3DBHA 1G6KA 1NWHA 3UKOA 3WGIA 4FJ2A 3RFTA 1EUZA 3K2EA 5B4UA 4WLNA 4A0SA 3OQBA 4KTVE 1LLDA 1LA2A 3EVNA 4AJ4A 3SBOA 1PR3A 1PS9A 3GNSA 2P9CA 2FPPA 5L4SA 2CD9A 3INTA 1ISJA 1O94A 2POQX 4RPJA 3HE3A 3L6OO 4XGKA 4RF5A 1N1EA 2DTXA 4AJPA 2GR9A 4YWJA 3GVCA 4XCVA 4Z9FA 3ROKA 3DHEA 3ETEA 2JAHA 1RM5A 4I9HA 1JLLA 3RD5A 4GWGA 1UP7A 3F3SA 4DRYA 2BKAA 2GGSA 4XIYA 3WBFA 1MV8A 2P9GA 2YV3A 1T2CA 2Z1NA 1HZJA 1LSJA 3NGXA 5DCWA 4P8RA 1PGQA 3OSUA 1PZHA 1Q7CA 4PLZA 2BFOA 4KOAA 3E48A 3GPDG 1YQDA 3I1JA 2EGHA 2X0JA 3WS7A 1WPQA 4M55A 4W7IA 4AJLA 3UCFA 3TL3A 2QYSA 1G1AA 1MP0A 3JYNA 3K5PA 3PHIA 4KWHA 3OMLA 4ZA2A 5COBA 4CV2A 1KS9A 5KOIA 2YQ4A 4QUKA 4BNZA 3A14A 4I9NA 1XIVA 4FSHA 3G17A 4WCDA 3WIEA 1D1TA 5K6AA 4XRGA 4FD3A 4YJGA 4WCFC 2CSUA 2JFHA 4BVAA 2BGMA 3PJDA 1YXMA 3OH8A 3R6DA 1UP4A 3PGJA 2DAPA 5EERA 4C4OA 3RJ9A 3ZNNA 4E12A 4FFOA 4GL4A 4BNTA 4LK3A 3ZWXA 2JCYA 3WBBA 2ET6A 5CEJA 1PJTA 5DOZA 3DZHA 3C24A 3F4BA 3OFSA 2W4QA 3EMKA 4I08A 3GMDA 2FWMX 4LSWA 2AE1A 4R5HA 1UZNA 3KB6A 4BMSA 2HJRA 3OM9A 5BT9A 4CMAA 1IOLA 2PLAA 1U3TA 3H9QA 4D79A 3DOCA 4MKXA 2D0IA 3V2HA 1SOVA 4WLOA 4BNFA 1DDOA 4IMRA 2X9VA 3BTSA 2WWRA 4EBFA 1UXGA 4JGBA 1E7SA 2X58A 3N7UA 2ZQZA 5DP2A 2DQ4A 5IXYA 1B8VA 3QJ5A 5CHEA 3RFXA 1VRWA 4EJ6A 5DDIP 2B4TO 1U9JA 4JJFA 2GUGA 1DRUA 4J1TA 5G4LA 3DMTC 1HDGO 5HRUA 3PFWO 4HADA 3GGOA 3BMOA 3JD0A 1R4NB 1QYWA 3AWDA 4IM7A 4LISA 1HTBA 1N7HA 4BO6A 3E5RA 4FQ8A 1K2WA 2C5AA 2FOIA 3AM3A 3DAFA 4G81A 4XYMA 3NT2A 4PLVA 2NU9A 3G49A 3ZWNA 2Q2WA 3D3WB 1ZK2A 3L9WA 2GN8A 3T4XA 3W4KA 4AJEA 3ETDA 4CM6A 4H15A 2O3TA 3DBLA 4B3HA 1TLTA 1LRJA 2VYVD 1PJLA 1L7DA 2IEBA 3WR5A 1VL6A 4IQGA 2G17A 1H94A 4NI5A 1UJMA 4J7XA 1Y8QB 2BHLA 2C29D 1MFPA 1ULUA 1AHIA 5THQA 1Q0QA 3FCOA 4I8XA 3PLRA 4IXWA 4XR4A 1X15A 2EXXA 4EJ0A 1KEWA 3OF2A 2YW9A 4WEQA 4DQUA 4MIOA 2PKQO 3KRTA 3TF5A 1U3VA 2EKPA 3RAJA 1OOEA 3GPIA 1QLHA 2YY7A 4L74A 3S55A 3LSYA 5LCXA 4MVJE 1VL8A 3K6JA 2G0TA 1IUKA 1LNQA 3C1AA 3PQDA 3KETA 1N9GB 4J49A 1D8AA 1U4SA 1YRLA 4R1NA 1PS0A 5JBIA 5TS3A 1NNUA 2YJZA 1F06A 3JTMA 3MEQA 4NNJA 2Q3EA 1PEDA 3DBRA 2A94A 4WJZA 4L76A 3FI9A 1PGPA 2E82A 5TQVA 4R1TA 1Z7EA 3GEMA 1PL8A 2Q50A 3B1FA 3BZUA 3H5AA 4W6ZA 1ZFNA 3BTOA 1R66A 4HP8A 3L9XA 4B8ZA 3HFSA 4IDEA 1Y9EA 2HDHA 2NVUB 1WZIA 4E13A 4ND4A 2O4CA 4II2A 1UXIA 2R00A 4CMHA 2NADA 5LC1A 4WCFA 3OQ1A 1M6WA 3QVOA 4N18A 2H9IA 1R12A 5ITVA 3JCZA 2W2KA 1P45A 1JKIA 4UUNA 1LSUA 4WLUA 5JC1A 1LSSA 3W1VA 3WLEA 4EEXA 4DWVA 3DONA 1F0YA 4Y8VA 1HE5A 3GT0A 2QIOA 1UAYA 3F1LA 1VLLA 2ZTVA 3JQ7A 1J49A 2LDXA 3PPIA 2GZ1A 3CH6A 9LDBA 1NHWA 1Y9AA 4KUEA 3BHJA 1ENOA 3H7AA 3WFJA 1DIGA 2AEFA 4M1QA 1G0OA 2RH4A 5JAZA 3AJRA 3DMTA 1RYEA 1ZSYA 2CY0A 1ISFA 2BF7A 5I7SA 3DAGA 1EBFA 5FYDA 4EW6A 3ZU2A 3K92A 3F6YA 4BKUA 1E1MA 2OP1A 4XZ3A 4E2ZA 3DQPA 3ITDA 1UUFA 1I3NA 3EZLA 4CMEC 1NFRA 2GSDA 1P44A 3KM0A 1FDUA 2E6UX 2CZCA 1U3WA 1JWAB 4B4WA 1L7EA 1MC5A 1HE2A 4J1NA 1PJCA 4G2NA 4A27A 1R15A 3HWRA 4JCOA 1R6DA 5JDCA 5JLAA 3KYBA 5F1OA 4R16A 4XJTA 4YJGB 1DC5A 3W4IA 3A1NA 4IXTA 2VT2A 3M2PA 1VC2A 3JQAB 4DBVO 4BNIA 3AM5A 1Y8RB 4BGIA 1B26A 1T2EA 5A3VA 4DYVA 2YHIB 2C07A 3BHMA 3VDQA 4YVFA 4DMMA 1E1NA 1T2FA 1PX0A 2FZWA 3MJVA 1EFKA 3K2BA 3RVDA 1E3WB 4IDBA 5GMOA 1XG5A 5KCZA 2SCUA 2BH9A 3H3JA 2YUTA 3C1OA 4OXYA 3HHPA 4ZQFA 1TA4A 1GUZA 3P19A 4J1SA 1C3VA 4CJXA 1H2BA 1DFIA 3CZMA 3NX4A 5KWEA 1U2GA 4E32A 1LU9A 2ZCVA 5L7YA 4E4YA 4BO8A 4B4UA 3U9LA 3GQVA 5BSEA 5IDQA 2BGLA 2UDPA 4DLAA 4P4NA 4GAEA 3PIIA 1N7GA 1D7OA 1LJ8A 2NVWA 5H82A 4Q3DA 1R4MB 3QVTA 4E5PA 3LC2O 2EJVA 2JD0A 3EW7A 3L07A 4ID9A 4R3NA 4ZQBA 2EW2A 3I9MA 3BMOB 3PXXA 3CIFA 4CL3A 2P5UA 4I1IA 1PJSA 3TJRA 4E2WA 3GY0A 4WNIA 5A9SA 2X8LA 1JDJA 4E5NA 4CMJA 3F1KA 3DFZA 3GZ4A 3DBRB 3B1KA 3E82A 3IP1A 3ZWAA 3ONDA 3NAQA 3Q3CA 1NX6A 1X14A 3IL2A 4XDYA 2O50A 1KEPA 3LVFO 4F46A 1R16A 3OQ6A 1NVTA 4Y67A 3DXFA 2GASA 5GZ3A 4WKGA 3AY3A 4RQUA 3H4VA 3SC4A 2GERA 4N54A 3E9NA 2ZYGA 3BMNB 3GFBA 3UVEA 1YO6A 1TB4A 3QIVA 4J1QA 4BNNA 2NQTA 2AQKA 3EVTA 4P4LA 2NQ8A 2OGUA 3WGQA 2VYND 2TMGA 2GF2A 1GU7A 4OO3A 4GH5A 1E7MA
chains in the Genus database with same CATH superfamily
4I5GA 3KPWA 1R6VA 3NXSA 3GPCA 3N5KA 3GLHA 4REQA 3UN1A 4DDHA 2WTBA 1MC8A 2JZCA 3FNQA 3E9MA 2FPLA 1DQRA 2QD5A 4QFDA 1DRVA 5KKCA 1PNRA 2QDXA 4LZZA 1CQXA 3F7TA 5BNIA 2YBEA 2QGFA 3LY9A 4AMUA 4H0FA 4KN9S 5FV7A 1S02A 3AF2A 3SF8A 4M1YA 1UWKA 3PXCX 3CR3C 1AMNA 1YGYA 2ERCA 2VRCA 4TTRA 4EO7A 1QGOA 2CDNA 2XYPA 3IDAA 1YI1A 1G2OA 2ZG6A 1U31A 4N8EA 2SHKA 4EPXA 1Q57A 1YS7A 1E58A 1U2RA 1W8IA 4FR5A 1I9CA 2AMFA 1GILA 1Z4OA 5E4FA 3HDQA 4LRSB 4PSUA 4I1YA 5G4KB 5IYZA 3CM0A 1RJWA 3NJRA 1DX9A 4QARA 2O9JA 2Z0MA 3ITEA 2JFZA 2EFEB 2P9EA 2MTBA 2QRMA 1P1IA 1IXRC 1RKQA 3WAKA 5ABPA 3VZPA 1PQ4A 1QP8A 1DAMA 1QGUA 2ZWPA 3AI7A 4AF8A 4PSKA 2H31A 4CKYA 3CUEF 1YMVA 2C0CA 1KZYC 4M9ZA 3A2KA 2VCYA 4W5WA 3QLVA 4CQMA 4D3FA 2I9PA 1R0YA 1ZO8A 2N3ZA 3BWYA 3OM0A 2ALJA 4UVHA 1I2ZA 3ZOKA 5JJIA 4JEIA 1RRFA 2O59A 4XYBA 3TM5A 4EG4A 3ZHBA 2WJYA 2HK7A 3AUFA 3SFZA 1PWZA 2BFBA 3U3MA 3ACBA 2C7VA 4X8MA 2O0JA 2VTVA 1GY8A 4K1LA 2WY2D 1N6RA 3WB1A 4A6EA 4J0DA 3F6RA 3VVCA 3J81k 5CVVA 1BXZA 4ZAXA 3IBFA 5ES3A 5EMLA 2HDOA 5JWOA 1IVYA 5EOVA 4TTQA 5JZ9A 3BPSA 2LTAA 2G76A 1QAMA 4ZO4A 1DC3A 4MGYR 4XA8A 3LZ6A 1F0KA 4Q1BA 4HNAA 4K9QA 2BJWA 4NONA 2VJDA 5H02A 1K4YA 2CVQA 3MLBA 4G6ZA 1WL8A 1YAHA 3IQXA 4QQFA 4EPRA 1HBJA 4LJRA 4IFEA 5C9ZA 2NTJA 1D3AA 2G1UA 4CTMA 2ZI9A 3MYRA 3L1IA 3HJAA 5F7XA 2QE6A 2ZSAA 2PWBA 4CM4A 1NZFA 4PZYA 3PIDA 4KAFA 4RE5A 3B1ZA 4YCBA 2X4IA 5FPPA 1Z5UA 4MQEA 2I4IA 2Q99A 2ZRFA 3IUYA 3N7AA 5DPMA 3DE2X 3T7DA 3URMA 4BO9A 3U5ZB 4S12A 3ZCVA 4R9SA 2C96A 2D74A 4OX9B 1B14A 3KR9A 1BE6A 2H6EA 3AHEA 2DTDA 3JVVA 4JT2A 1GZUA 2VDKB 3LHFA 4L4XA 3I01A 3KAPA 1M1UA 4BJ5A 4NVRA 2FPKA 1SCUA 2OENG 4F3RA 3K9HA 5HQ3B 3TGPA 4C0SA 3ZZTA 5EXPA 3O2QB 3EB9A 2DPLA 1NUQA 5D3MA 5DTEA 4ZQEA 8LDHA 5A06A 1VMAA 5LDGA 3WGNA 1C2TA 4I66A 1GQ2A 4PHFA 1Z4IA 2LDBA 4HGNA 4GI3A 2BFFB 5HF9A 5REQB 4F21A 3RYFA 2CSXA 2UZAA 4Q4JB 1F0NA 3TLKA 1WV0A 3HUUA 5U4XA 1C3OB 1T2NA 1KMIY 2FFAA 3DMNA 1P3Y1 1RYDA 3SQWA 4PW0A 3MERA 2PJZA 2A1UA 3P9CA 3KT0A 4R2LA 1SZDA 1TAQA 3LBYA 1Y8AA 1VJDA 2FE4A 3ODGA 5EIBC 3WGUA 4JV5B 2C82A 3UKJA 2Y68A 3O83A 1E2UA 4M7RA 4NSNA 2CNNA 4NHEA 4N40A 3STVA 1KU6A 2OCPA 5DTIA 3VKGA 3CKMA 3HCRA 4NYIR 2OT3B 3K53A 1ATZA 3JYQA 5D86A 2EJTA 4QICA 1KDYA 5E38A 3TCXB 1U1FA 3EYAA 1LC3A 1X92A 3EASA 3S27A 4K9NA 5I9LA 2HBZA 1XVTA 5FNVA 2IPOA 1LBEA 3NKVA 1RYZA 4RHYA 3RJ5A 1VGRA 1I4TD 3L3BA 2VAPA 3O2NA 4HH4A 3V80A 4ARBA 5AW7A 1BW9A 1P5FA 2FRXA 1HMPA 3DHWC 4GI7A 4IIJF 5F3RA 5L3VA 4B3TB 3U9SA 3ESXA 1GPJA 2QTNA 2CJYA 4IF4A 1ISMA 2Q9BA 2WT8A 3M4JA 1UZAA 4NCJA 5J4KA 1QBKC 3LF1A 1PK8A 1V5IA 4F6CA 5KNCD 4DUZB 3V4RA 3PXBA 1KO1A 1F2DA 2JIDA 3KZCA 4AY4A 4JOBA 4I81A 2XSZD 4JKOA 4F8JA 2EKZA 4L9WA 5LWQA 4AO6A 2QI9F 5TDHA 1OB5A 1ZJ6A 1GNQA 4G8BA 2ZJ4A 4IINA 1TFRA 3BCUA 2OAEA 4HVCA 3RAFC 4KLZA 1C80A 1NQ5A 1V47A 1USVA 1GAJA 2JEOA 3NNDA 3RH0A 1MJNA 1ZRHA 3TRHA 1JA0A 3HDJA 3ZE0B 2D1SA 3D43A 4BO5A 2O8FB 1WEKA 1O9BA 2BEWA 1BHJA 4PQRA 2WUFA 3HB0A 1GQQA 4QGAA 1QIEA 1J6UA 1WKVA 1MA0A 2WJHA 3NCHA 4IJ6A 4ZODA 4EJSB 4MAMA 4LWZA 2VEOA 4LY6A 1MPTA 3QE2A 4QYXA 3IIIA 4MJ3A 3CG4A 1U2EA 1NUSA 3H04A 4OFBA 4EFKA 2GZ3A 4LXUA 1E3JA 5JI2E 3LOUA 5KU1A 3N2ZB 2H59A 4CQMB 4UQOA 1DIRA 1S2MA 1Z4MA 1QRRA 3K1AB 3V1NA 1TO1E 1JDTA 1I13A 4PPQA 1E2LA 2BELA 1T36A 4MV3A 3GQBB 3WGZA 3DZIA 2QL7A 4E30A 4X62B 2HJ9A 5GM2A 5I4BA 2ZJ3A 3ZWOA 3UB3A 1CZOA 2R1VB 1KQPA 2R3SA 3WIDA 4CU2A 3EHDA 3OT5A 4DB4A 3K72B 3FSGD 1A0OA 4V0SA 5INTA 4Y2UA 2IS6A 3VOAA 1Z0SA 3UXYA 2V3CC 1GEEA 3FDZB 3EVAA 1MORA 3LM8A 3TLGB 3HYCA 3LQ4A 4KFSA 6PFKA 2BDTA 5CGZA 5CPFA 3ND9A 2M6KA 2VHEA 4FC6A 3CEPB 2A0WA 1BH6A 2VUHB 5B7QA 1N2XA 3KSDO 5BRNA 3E9YA 1BFDA 3PNKA 5FJJA 3FWNA 4FFSA 3BH0A 1TVKA 2I7DA 1EEXB 1NW6A 5ER9A 3V9PA 1TKBA 4JVMA 4M0PA 1T8UA 4QPDA 3SQLA 4PLGA 1Q21A 3PSAA 3VISA 4B3JA 5K05A 4DDKA 3BXPA 1PX2A 3W6UA 2PKQP 2K7FA 5IVPA 3K94A 4FS3A 3EBPA 4H3HB 2OBNA 4D99A 4UUBA 3PX7A 2Y1OA 4CEJA 2AC7A 3S1LA 1A8QA 5A9SB 4WNAB 3M5PA 1JIQA 2HB6A 1SNYA 4FGKA 4ENQA 2KPOA 2C8LA 2G04A 1XMOB 3QUTA 3RT1A 1FW6A 1CHNA 1SBYA 2G70A 3EC7A 2XQIA 4DKJA 4TYWA 3SSAA 3OUTA 2IX3A 1V8OA 2UXCB 2WF5A 2WVJA 2XI4A 3L7LA 3QW2A 5DLPA 4ZT5A 1M2NA 4ESVA 5DHTA 2OZVA 1V4BA 1JAYA 3CWZA 4JGGA 1QPGA 3T3NA 2E48A 1YJ5A 2JLBA 4NMLA 5G0WA 3FJOA 5JVDF 5IKOA 3HI4A 2YYSA 1SA0B 4DLZA 3FUWA 4R9VA 3I61A 4FSDA 2V7XA 3DUFA 3IEMA 1CHDA 4JP5A 5JAIA 1R4ZA 3QFTA 4JDPA 4RULA 1RZVA 4A82A 4B82A 3B6IA 3MGCA 4OJNA 2WPDA 4HNAB 4CW7A 4D9EA 1WA5A 3LBFA 4HNGA 4ZHQF 1GSOA 3IPYA 4X00A 4WY8A 1N2GA 1JI0A 1A9XB 1I2AA 1BOFA 1YCGA 3K32A 4TS9A 3ZKWB 3EAQA 4D8TA 4DV6B 4AUEA 1R9GA 2O1WA 2PUGA 5FBZA 3IAUA 3U26A 3PLAE 3G3EA 5FNVB 3CNHA 2V6FA 2VVTA 4N0QA 1CLUA 3DM9B 3CZRA 1A5BB 4R5MA 3ZLUA 1F7UA 2YY5A 4RF3A 4WSOA 3CY6A 1RQRA 4GKAA 1NULA 3SE7A 2PZAA 5D00A 4DDTA 4GSLA 4AX4A 4P93A 1E66A 4BVLA 1PT5A 1TW2A 1KK2A 3N8KA 3SDSA 1Z18A 4RFSA 1QHIA 1W85B 1G8PA 2AF4C 5AK5A 4IZ6A 2NO9A 1BYIA 4LKOA 1DKOA 3W5AA 1XQWA 5LZ4A 4HYQA 3NCTA 4XX0A 3KJHA 2JLCA 2FY8A 3SJBA 2WZBA 4KFUA 3EA5A 1G2PA 4BMPB 1OXMA 5BN4B 1I6LA 4RVDA 4E7PA 1G5FA 1N8KA 2VJOA 1LV8A 3ESQA 4BB0A 3TKLA 4HDSA 3LS2A 4WN9A 3MJRA 3ZTTA 1BX0A 3V2UA 5BV0A 1AE1A 3QNUA 1PYDA 4ETMA 1C3OA 1P80A 3Q0EA 3STUA 2V58A 3IUPA 1DTWA 3AOEA 2BHRA 2W93A 2GI4A 5FQOA 4I6JA 4FW8A 3O1JC 5J2UA 2AFVA 1EGQA 1AMOA 1KKUA 2IF0A 5E1OA 2AEMA 4Q19A 2GO1A 4JWKA 1FNCA 5L4NA 3BIWA 1IATA 3PFBA 4WE3A 3QVUA 1O97C 2G7MC 4JFAA 2HWKA 2C78A 1LQTA 1BMFA 2O1EA 4FNAA 5FOTA 2BIFA 5TF0A 4DLTA 3TLEA 4X65B 4IAOA 3FOEC 4X7MA 3LUGA 3NR2A 4LTMA 1Y4DE 1M2OA 4UNIA 1DJOA 3FZGA 5HJ2A 3RLFA 3MAJA 3LJKA 4U7PB 1AURA 1HYHA 1S6YA 1UODA 1QNFA 4XFDA 5DM4A 4D82A 4WOJA 1CUUA 3MWEA 1Z15A 2J85A 4OMCA 3SJAA 4L4SA 1K5HA 3HBAA 4P7FA 4L73A 5DNAA 1KBQA 1Q74A 3I32A 2HU7A 2REOA 4ZV7A 2Y92A 3AF4A 3GJ0A 2GB4A 1P4JA 4K6FA 3WB9A 4UAJA 1EWVA 3L0SA 2PX8A 3HB9A 4QVGA 2Q3CA 3TNLA 2XUKA 1C9MA 3CX4A 3FYUB 2HLNA 4RIHA 1JG1A 1YZVA 2VHTA 4JEUA 3UGKA 1BW9B 1N6IA 3CEHA 4KBYA 3AQIA 4LWQA 5AM3A 4WGGA 1XJCA 2IYSA 4A36A 3K1ZA 3O4VA 3GXBA 4ZWNA 2NWQA 3ACDA 2QMUA 5JISA 4KO2S 1T2DA 4N7JA 3FYCA 1EX9A 1U90A 2A2ZA 1KFKB 3SN6A 1E62A 1FTWA 4Q1VA 4CM8B 1GCIA 3K0FA 1GM5A 1ODTC 1L4UA 1OVMA 3Q6IA 1WP9A 2BPOA 2CMHA 2H3HA 3KJGA 4X41A 4WXPA 4EY4A 1NQTA 1VZ3A 1JVNA 3TIVA 1VCNA 2YOHA 2VJBA 5EN4A 2O0HA 2J5RA 3CTPA 3U1BA 2NYUA 4PQYA 2VRNA 3K0BA 1KDOA 2CWDA 1M2VA 4MCHA 1II8B 2VPWA 5B3AA 3PGVA 5MDHA 2RBKA 2H1SA 1BU8A 2HXYA 2V5VA 1GN8A 2EGUA 2FN4A 1F1BA 1OI3A 3LUKA 3W3AA 3HSKA 3KB1A 4FMDF 4OH7A 3FUUA 5C4GB 3ZU5A 1TT5A 2JI6A 4H31A 4LTDA 3RT9A 4E7OA 2L18A 4EJSA 2VPQA 5IP5A 1EWYA 5F98A 3SX0A 3GIWA 1UDWA 1UJNA 2H2FA 5IANA 3W6NA 1A8UA 2JVIA 4P92A 3AV0B 1A8SA 2FR8C 4LRUA 3R7AA 4MRPA 2H63A 2NO6A 2OE2A 3DEJA 1XEWX 1TT7A 2QSUA 2RG1A 1GRCA 1SKQA 3HNOA 2BGJA 4U2GA 3PJGA 3DUFB 1E2HA 3NBMA 4IOLA 5BVHA 3G0DA 2J3QA 2Q9AA 4YRPA 3TQHA 2PD3A 1D9XA 3L93A 2HLDD 1E4EB 4GEGA 2BZSA 1UBUS 4JGIA 3B3GA 2BBSA 3QTLA 3QXGA 5U4QA 3GPLA 1GA6A 1K5DA 4DIMA 3K20A 5ESWA 1MC4A 2J9ZB 5ERGB 3QE9Y 3TBKA 3ZNPA 2ZREA 4AB1A 5HTOA 3E4CA 5ALMA 2QTVA 5B1SA 2P67A 5CCXA 4P1ZA 1YTLA 4MKFA 3BKXA 1NATA 3MINB 1XDWA 1ISRA 5JR3A 4F56A 3TL6A 2R66A 1RHUA 2XYGA 3E9QA 3ZKWA 5JVDA 2IP4A 3M81A 4EOGA 1AS2A 2H8GA 3AC0A 1EG2A 3OBIA 4ZDWA 2B0JA 1PYGA 3QA9A 3JD3A 4LYDA 3X1JA 1EFDN 2HL6A 5JXWA 2X1HA 5JPIA 4CEIB 3ESDA 1L4EA 2QE7D 2IEAA 5FLYA 3NTUA 1OTHA 1QS0B 3E84A 3SVTA 1J8FA 4NOJA 3G7UA 1GP2A 1B6TA 2P2NA 2DUWA 2R6R1 2WE8A 3G0IA 4BKPA 1T9GR 2F1RA 4RK4A 2VYFA 2K2WA 4LYHA 5FCDA 1LEHA 3PUIA 4OQYA 3VPAA 4ACBA 3VTFA 1R8XA 2HK9A 1M1NB 4W5JA 3D4NA 2JFGA 4Z0PA 4TV8A 2XQVA 1JS1X 2BMAA 3QPCA 3SBDA 5I7EA 3HCBA 3CINA 4AM8A 3EX7C 4D9KA 4E15A 1O6CA 3LFUA 3S4YA 4RL4A 3O2JA 4ZYUA 3HJCA 1SJ9A 3E1SA 5DTMA 1GV0A 4RV9A 2GM9A 3ZLJA 2B9VA 5CDUA 5KNBH 3G2OA 5H68A 2FEMA 2JAWA 3FZQA 4FYIA 1U2GC 2O8VA 3EZXA 3N6RA 5BWBA 3JQ9C 4MPPA 3V7NA 1WMEA 2HIAA 4KR2A 1Z28A 2FUG1 2HSDA 2NO0A 3HUTA 1VG0B 2WJPA 2R60A 1LI7A 4X6LA 1O95D 2ISCA 1Z75A 4IIFA 2VWHA 3PGLA 3E0XA 1ZIPA 2L69A 1AHHA 3GQBA 4Z7NB 2XUDA 1XVUA 1WXQA 4FDMA 5K7SA 3J7AC 7REQA 5IN4A 4IICA 1KJWA 2CYBA 4QBKA 4DCJA 5BOVA 5EJFA 4ZHSA 4C7MA 5A03A 1PTKA 5JE8A 2O1SA 1C30B 5DYIA 4AS1A 1PSWA 3AL3A 2R97A 4ZO9A 2YTZA 3GGSA 3VSDA 1QP0A 3DOJA 1VJ0A 3RS9A 4BDTA 4FOOA 3VDMA 1PJ4A 1JKXA 1WNFA 3SS7X 4CLRB 3S81A 4CTJA 1MRSA 1YBMA 5E0OA 1RFGE 1G8HA 4P84A 1JG6A 3CXRA 1F17A 2J5BA 1NMQA 4IKEA 4JXJA 4RCYA 5BQOA 1ZL2A 3D7SA 3BD8A 1B16A 1T6BY 4LBVA 5IJ0B 4YCCA 1RKXA 3LQQA 1LQUA 3ABOB 3RHZA 1T25A 4KBFA 3H9EO 3Q15C 4WL0A 2ODEA 3KVOA 1WW8A 1IULA 1MOQA 4K40A 4EB8A 3HO8A 4DC9A 2A58A 5ERYA 1AQ6A 2WTNA 1YIOA 1HPLA 3GCDA 1BXRB 4P82A 1G9TA 1JG7A 4P4TA 4CTKA 5JAUA 2QQ0A 4HVTA 4JP3A 4IF6A 2X2OA 3F8TA 1TO2E 4IG9A 4KQHA 4MUGA 4D3XA 4QO7A 4LNHA 5CAEA 1QGDA 2O5EA 1G5IA 3IUNA 1EFAA 3TMKA 3CNEA 4XSHA 2C5EA 2O3QA 2YXPX 2C59A 1TT5B 3IP9A 4ZEXA 4II3A 2JIPA 4Q39A 2XJ4A 4QRIA 2YHIA 1OBVA 4P3KA 3UT0A 4DG8A 1ZD1A 3FR7A 3H2SA 3P52A 3B3AA 4OQLA 1JKJB 2Q4EA 1TQ2A 4DTIA 2CDCA 4IRMA 3TVTA 1U0EA 3M2TA 1ML3A 2IU6A 2WZDA 3HGQA 4XB1A 1ZNYA 5IK2D 2Q07A 2A5FA 2DBYA 1UR5A 4F5ZA 2ZS9A 5T64A 1BIFA 3EH2A 2XXBA 4KLRA 2NU8A 3ZIUA 4OMDA 1F2TB 2WRZA 1E2IA 1E4EA 2FN7A 3A9CA 3FWZA 3LBAA 4K3VA 4M8IA 4KI7A 5EKUA 4EVQA 4ZQCB 5EZYB 1NN0A 2ACEA 2WJAA 1L5RA 1V25A 4IXMA 4JN6B 1JLLB 3AI1A 1HYEA 4H6PA 4REQB 1MVOA 2Y1WA 3R3JA 4V0MA 4CM3A 2FOXA 1FIUA 1JEQA 1EVZA 1ZK3A 2HI0A 2YINC 3WLNA 2WJ6A 3N2KB 1PR9A 3F2IA 3F9RA 4PHTA 4X44A 5TC4A 3C3BA 3M1AA 2QXTA 3HKDB 4KXLA 1XD9A 5KQGA 1XZQA 5KOYA 1Z4JA 4HFMA 5DBHX 8MHTA 3PYXA 5JASA 2DHCA 1XP5A 3VPCA 1NBWB 3VDNB 5JD3A 2OKCA 4RDCA 4AKHA 4AW9A 1DIAA 4W9MC 1MQ8B 3FPEA 3GZNB 3JARA 2E4WA 2H8KA 4WXRA 4H7DA 4HDKA 4A0QA 1J8YF 1G8JA 1NOIA 1W35A 4HZIA 1UEIA 3ULKA 1Y82A 3C8UA 3D3NA 4H7IA 5K6TA 1Z17A 3I8OA 2RI0A 2IXGA 1DXYA 3OSZA 1LRLA 4OPMA 5IEJA 2JDID 3DMFA 1SUAA 5TLSA 2O07A 3MELA 3I9LA 3WP0A 1G66A 3SQMA 5LQMA 3CZ4A 3DWFA 3L7DA 1X1AA 1E2JA 4LI0A 2XKKA 1YRBA 2X5XA 1U1CA 3UWKA 1WHSB 3B6MA 2CXTA 3ONWA 2WD8A 5IKMA 2IS2A 221PA 2X9NA 5CT4A 2XWPA 1VL0A 3TQRA 1FMTA 4FFVA 1WLYA 5B64A 1AO0A 1EM8B 3ZU6A 2J4CA 2XR1A 2QU8A 1G3MA 1TXGA 1G6Q1 1Q0UA 2BFBB 3BE6A 5G40A 4P38A 5J4VA 5KDDA 1KSHA 1UPBA 3I01M 1CB7A 3PC2A 1OPXA 5GOZA 4AJOA 5GZ1A 1FDWA 2WQZA 3Q12A 2PKRA 4UHKA 1YSCA 4RJIA 4O6VA 1D2AA 1OLUB 1X2BA 2VF4X 3EEFA 5CW1A 1PU2A 3BRQA 4TZ6A 4OJKA 5KZMB 4I5IA 3DW1X 1B7GO 4R8LA 5AT1A 2J4DA 3NIWA 4RF4A 4X1KB 4AECA 1IHXA 3C5VA 3KL2A 1PR1A 3FAKA 1MQ9A 3IT3A 4PRZA 3SFVA 5JZVA 3KQMA 2PIAA 2MSDB 4F4JA 2QK4A 4FFBA 5EMJA 2XKJE 4FVTA 2CYAA 1QKKA 4DYHA 2HJWA 3R3HA 4KQWA 4OA8A 2WB4A 5D84A 3EWAA 4Z9YA 1OB2A 3NOQA 4QAQA 3NEAA 1VRVA 4TN5A 3U0BA 5B2EA 3MWKA 3ZGYA 1R64A 1JPJA 1QC5B 1QS0A 4JUIA 1WDWB 4PINA 5ALDA 3UV3A 2JFQA 5FOWA 1RRGA 1HEYA 1HG1A 4BLOA 4DPLA 2H3EA 5SY9A 3ZCUA 4UHHA 1B74A 2OZEA 2D0DA 3GOQA 1ISPA 2IEGA 3O95A 5K01A 3W2EA 5KTYA 1C3LA 1EH5A 1FYFA 1ODJA 4LQ4A 4TVBA 4FQ7A 1JHPA 4M1KA 5KX5A 4DTCA 5DIFA 2QENA 3EA0A 2Z2XA 1RYNA 5LU9A 1G3UA 4EZBA 1E94E 3NTOA 5L7TA 4UUOA 2YW2A 1DX4A 5AXDA 3OBBA 4B0PA 5KJ1A 5JSZB 4L0CA 2JNWA 2H65A 4I3FA 4ND7A 5C51B 4RTQA 1I6KA 5HP4A 1E0SA 1YJXA 1I32A 5L3ZA 3G23A 5AQEA 4A0RA 3ND5A 2QVZX 3C48A 1DJMA 2H1FA 2QTMA 1UFKA 1Y5NA 4PR3A 4D25A 5BNFA 4CCSA 1RAHA 4N0PA 5EUMA 1VSTA 4M83A 1GGHA 1MC1A 4HGYA 4Y2XA 2WHXA 3Q9NA 3PGMA 4BV9A 2UYCA 2DX7A 2AVDA 3CZ5A 1JEAA 2ID4A 3DZGA 5AOVA 1X94A 1L5HA 1S2GA 3MGKA 1ZOLA 5T4FA 5GJVC 3COVA 4UXJA 1V3VA 3LX8A 4OGWA 4RK7A 3PEEA 4CLRA 4D9IA 2GUWA 2RKOA 2P0YA 3DF7A 3M6IA 4UMDA 2FCAA 1B8NA 3VBCA 4NL4H 4C0KA 5I47A 5CVJA 2AN4A 2EP7A 3FYDA 3P71T 4OBEA 1U5CA 2EW8A 4ZKDA 3S1AB 3DLPX 5BSKA 5K8VA 1OLXB 5KHLB 1GIAA 3JQFA 4P6VF 4AZ0B 4AXXA 2UKDA 5DNUA 4NU0A 3MJEA 4ALMA 2LBPA 2OUIA 5CB8A 3QVSA 5A4MS 1QVZA 2OL4A 5EMMA 5BMVB 5I4KA 3G5MA 4KVFA 1W88A 5FUWA 4F5DA 5C5DA 5CFRA 2V65A 3W06A 2SICE 2GN9A 4JJZA 3KOUA 4OHZA 5LQCA 1O6GA 4CYMA 4FZ5A 4MUEA 1HG0A 3A36A 3PWTA 4FGSA 1A9PA 1QHFA 2XMPA 2EWMA 4PLWA 3ANLA 3JD2A 1ZD5A 2P3SA 2Q7DA 1NF2A 1U0NA 2B1GA 2X0RA 5JAMA 2ETVA 4ERXA 3UJNA 2Z2JA 3WFZA 5LZ9A 3WX0A 1HRDA 1IZ8A 2ZBRA 1QQ6A 3E4DA 3Q10A 10MHA 2IYUA 1U2DA 5GVSA 1E1DA 1SXJA 5H70A 1HFJA 1KAGA 3IV6A 4O4HA 3ZS9A 3KOZA 4HB0A 1KJNA 4AZ3A 1VYTA 4BE4A 2ZUCA 4TUYA 4BLSA 1YJCA 1KNXA 4M38A 1Y5LA 3O92A 3E8MA 2PT5A 2UV8A 4NBTA 4P2GA 5BORA 3EYWA 3AJ8A 1NXTA 1HDCA 3ET5A 4LYJA 9ABPA 2Q62A 2MR5A 3PTZA 4G1FA 1YMUA 5SZHB 4LVCA 4MB0A 1J5EB 1IUOA 3T3IA 1EWQA 1M76A 1Z82A 1JXOA 1EHYA 1ZQ9A 3EUFA 5JY1A 1K9VF 3KB2A 2XV1A 5CG1A 3OX3A 4QQRA 3LIIA 3RAGA 3RABA 1OVGA 1U7HA 1QF7A 1EAYA 3O3CA 4YRZA 5NLLA 3UUFA 1VQ1A 3PD7A 2DQYA 4GLJA 3V7WA 1ZOIA 3DDSA 3I28A 1XDZA 3VPFA 3HXTA 4KX5A 1SBHA 2YZNA 5I6DA 1OGJA 1UDCA 2QX7A 1VIAA 4JODA 5CFLA 1E18A 2JAPA 2QT1A 3KTFA 4CKEA 5HIJA 2FUG6 1NDQA 2WYUA 4Q05A 5J2UF 3VPGA 5A5EA 2FSFA 1WY5A 3MT0A 4ACAA 5LN1A 1KQGA 3PHGA 4KUGA 7MHTA 1E7QA 1PLLA 1JLRA 2I67A 2BFDB 3B9QA 4EABA 4IWNA 4L2IB 1WD5A 4QPJC 5JAQA 2LCQA 3BJIC 4PLCA 1NSYA 4G5RA 4FCCA 5LZ2A 4MW9A 1KDVA 4DWOA 5FTKA 3WK4A 2ZWAA 4EQZA 5F2EA 1L4NA 2NW6A 3I42A 1D6JA 1K75A 3KEQA 1BDJA 3LVRE 4L51A 3BJEA 4B40A 5CG2A 3KYDA 3CC8A 2QG9A 1C0LA 2GMWA 3V8MA 3IH5A 3RIHA 2X15A 4RV4A 4GPEA 4WKGA 1I4WA 3I12A 2Z8XA 2VHWA 3EJWA 1V7QA 1GCUA 1ESCA 2OGWA 3BWEA 2VYCA 3U4CA 4PYIA 4DZZA 4H6WA 4S3MA 1BH2A 1QMPA 4NIMA 3RCBA 4JZYA 4L95C 1UOPA 3AM1A 3GDWA 4OGGA 4MOWA 5AM1A 3DE5X 1PIWA 2XQGA 3A8TA 4JU8A 4D46A 4YI3A 3K5HA 2BTQA 2OXEA 1E1YA 3ZQ6A 3ZE6A 3KCQA 1Y63A 3MS2A 1TYCA 5CMLA 4G1CA 4WKNA 2G1PA 4F3TA 3A9SA 5D7BA 1Y6FA 5KVAA 3CNNA 3EFEA 4ZU1X 5ECDA 3TO5A 3ZI0A 2ZUUA 1KWGA 1RADA 2WWYA 3BWBA 4ZP1A 4YMGA 1VZ2A 1ECLA 5IWCA 4RABA 2XB2A 1B15A 4CMIB 5TEVA 5A04A 1NR7A 4JYMA 3M9XA 2YVUA 2QD4A 3H17A 2F43B 4LV8B 1AMUA 1FP7A 1X13A 4NG5A 2VZEA 3T5GA 3ZGXA 5A4AA 5JDCC 1FLVA 1NKSA 1XU4A 5HKAA 4U6NA 2GRAA 1VLQA 3CRVA 4H59A 5TIIA 1WULS 1QYXA 1PN3A 3VYWA 2JFYA 2HNKA 3QLUA 3D4OA 4OA5A 5G3YA 3AVXA 3GHYA 3Q87B 2AHRA 2WVGA 1ICEA 1BG6A 1E6UA 3D7MA 4AZWA 1BEZA 3D64A 2I4OA 1IZZA 1Z6AA 3LQYA 2FFBA 3Q0IA 3ZHSA 3SC6A 2D7DA 4DIUA 1FK8A 3U13A 3ROGA 5I7WA 1IK6A 2QT0A 3IEPA 4ZZ0A 3M3PA 2QX9A 1SELA 2IYAA 4KVGA 5TQJA 3B6KA 1U0RA 1Q0LA 4GBGA 5IDWA 2OR3A 2R4TA 3PA6A 3GDGA 2DRIA 2Q28A 1JNYA 4RH0A 5CYGA 1CTQA 3AVQA 4W5TA 1GVHA 1L4KA 1QYCA 2FCRA 3C45A 1IQ0A 3HUEA 2F8SA 5DTQA 1LPSA 1SHKA 3OKCA 3ZV6A 2XMGA 5AXAA 1G2QA 3H8VA 3GV0A 4N6NA 3DBHB 1TM7E 5EP2A 1UANA 2A4KA 4B4DA 5IDXA 4HRYA 3BHNA 2O8BA 1EK2A 4CM5A 2JVKA 2PH5A 1D9ZA 5HCIA 1JN0A 1OWLA 2A57A 2FJPA 4AY6A 3S5UA 3EZGA 3ZHCA 4FOSA 4BMDA 3PXAA 1EVJA 3IP3A 2R8RA 3H8WA 2VZ9A 1ZYUA 1SG6A 5A2GA 3GUYA 4PYOA 1XWFA 4UCQA 5K3FA 1X8KA 3QUCA 1A9XA 3GRYA 3OU6A 3WDLA 2GHIA 4E88A 1Y1LA 4YRBA 2EF1A 1NTOA 1KK0A 1NI4A 1Q7TA 2XDQA 2OLKA 2E49A 2J3IA 5CT6A 3BMNA 1YRQA 4P32A 1HE4A 4FT4A 4IRUB 1FBNA 4YIHA 3U7GA 5BW4A 2ARKA 1GITA 2G0NA 3KE8A 3TVDA 4A6XA 4RHTA 2GAOA 3F9IA 4JUDX 2NSJA 3OA0A 1CY0A 5SICE 1Z8NA 4G0NA 4BO3A 3EZ6A 4FR0A 4ZAWA 1IZ9A 3N2IA 1LLCA 5M3BA 2CL7X 4N3AA 4X84A 5ADVA 2GBLC 4KKVA 2ZS7A 3NT5A 2JKYA 2E7ZA 4M8NE 4MQFA 4RZIA 3FF4A 2J6BA 8AT1A 5E6UA 4F7DA 5DHSA 5THKA 1KRWA 2EP8A 2ZSDA 1FTYA 2J9GA 1GPDG 2COUA 3FKSD 4MKZA 2X42A 4RADA 4TRRA 1N2ZA 2R6DA 4Y98A 3T0FA 3D0OA 2ORED 4BFWA 1KC1A 4NLLA 4KR9A 3D8TA 1Y48E 3EG9B 3L8YA 3PC8C 5TMPA 2HBQA 3UANA 3COWA 4JA0A 4YJ3A 2JD1A 4GBJA 1XRLA 5T6BA 3RDPA 2VPYA 3FNHA 5FI5A 3NC1C 5H59A 2PXHA 2IZ5A 2MT9A 1C0PA 3OESA 4A10A 1BEUB 3JRXA 2G63A 2JGDB 5JNVA 4ZARA 1ODCA 3PFFA 1TJ5A 4ECAA 1E8DA 3A6LA 1RE0A 5EHGA 3QTTA 3WGTA 3FHJA 4K46A 1UKCA 2PX3A 5FBLB 1YZ3A 3RKRA 2BI7A 2HUPA 4QXPA 3IQFA 2I2CA 1UT6A 4BYMA 3HEAA 1DOHA 3RW9A 1SUDA 3NBKA 4C6TB 2P8JA 2DLDA 2FDXA 4ME6A 4DMHA 4D3YA 2RB4A 5GOTA 3NC0C 2WIFA 3DZJA 3FYSA 4MV4A 4QOHA 1PDVA 4NV0A 1CUGA 3BKWA 2JJ2D 5COAA 5A0VA 2FEKA 1XLUA 3V6MA 4BEWA 2R4QA 1OXXK 4KGVA 4HNUA 3A2MA 5HZMA 3HZZA 3W2TA 1LQ2A 4C6HA 4Q24A 3OZBA 5E1BA 3VC3A 3MTGA 4JBIA 2ORVA 3O5AA 1P5HA 1W34A 4PZDA 2AG5A 4B79A 4XSGA 2EL7A 4ECEA 4XJXA 1G42A 1Z4KA 1X7XA 2OV6A 4TLBA 4BB5A 4CT5A 4DFDA 2BBOA 5A1JA 1U63A 4KTTE 3B1XA 1ID8A 3I30X 3AR7A 2PZBA 1G20A 1UFQA 4K26A 5I4IA 1K63A 3EQ8A 5AVJA 3GOHA 3HGMA 4KCGA 4NATA 1TM3E 4BNUA 4WK2B 2PWYA 1TCCA 4DMLA 1N8TA 1XC7A 2CCGA 1T4CA 2C2OA 3JASB 4OFZA 1WXXA 5EWMB 4R81A 1A1SA 4LS3A 4PVCA 1UBJS 1UK8A 3MB5A 4IRXA 4B0OA 1R00A 2YX1A 3ZHRA 2YOGA 2Y99A 3INGA 4Z4IA 1H9CA 1T5LA 1L8AA 3O03A 4JBGA 2Y9MB 5HBGA 4AJ1A 2YJNA 5LIRA 2PX6A 5AUPB 4OIFA 1HE1C 1ZR2A 5DLQC 3Q5GA 4MLZA 1SZCA 2RGDA 3KQTA 1LUAA 1MO2A 3LX6A 1C29B 1I3CA 1TD9A 1W94A 4MVWA 3SHVA 4OLBA 4HEJA 1I7DA 1GV1A 1OU0A 1YL6A 1FTNA 2WTMA 3EZ7A 4TV8B 2XCSB 3LHDA 4KXYA 5CLFA 1DJNA 1RLJA 3VH1A 2JCSA 3DKVA 1Z4NA 3T1TA 3DDNA 3GEPA 1UDBA 3TINA 3U80A 3OZDA 1KOGA 1DPFA 2PFGA 4Z1OA 1ZX1A 3QHQA 1HOTA 3GR6A 4DCNA 3BORA 1WABA 3SYLA 9GPBA 1MRZA 3PUWA 5HBRA 2PH7A 1S7GA 4DE5A 4ZZ2A 7ADHA 2JEZA 2NZ8A 4R84A 5I7RA 2C3PA 1H0KA 3HDYA 3JR7A 3OE7D 2I91A 1Q44A 4RH3A 3WNVA 2RGBA 4OYRA 1QTRA 4EI9A 5G1PA 4D4GA 1KYVA 1BE8A 1W1WA 3VR4H 4QGSA 3AKZA 2Z56A 4Y18A 5AVRA 3WJAA 4EF6A 2LKDA 2OQVA 2DUJA 2VL7A 2AFIB 2PLNA 3P4UA 1BJKA 2YCLA 5CJPA 4L3VA 1J97A 2ST1A 1BYUA 1AF7A 1C30A 3MB8A 2QN2A 3BGDA 3RIYA 1FX0B 3TGLA 2JI4A 2O06A 4XB2A 5KTNA 4HT3B 3HG7A 1V16A 1WEHA 3L77A 5CFZA 3CVWA 2YICA 3UEOA 2OBYA 2VSQA 3MGAA 3I2GA 4J6FA 1TAHA 3AF5A 3L8EA 3VR4A 1EIZA 3GNQA 4CQLA 4CV0A 3B2EA 5KNDD 5ETJA 4JYAB 3TSYA 3HO6A 3PUYA 4QUBA 1IQRA 2PS9A 3INNA 5DZSA 3ROXA 3T8YA 2QRNA 1P2GA 3DA8A 3JWJA 1ZM3A 3N59A 3HFRA 4QYIA 3SYTA 1QIMA 5JH7B 4V39A 1FMJA 1PJQA 5CEFA 4N9WA 1PLJA 1XKXA 4GLLA 3ZBPA 3PUKA 3QF4A 5LSAA 4PZZA 1BQ3A 1OYVA 1P1HA 2AZ4A 3CW2A 2ODBA 3E9CA 2LIVA 5CM2Z 4B3CA 2BMEA 4BVKA 1HNZB 2F62A 1SD1A 2H16A 1JA1A 2O2SA 3CV3A 4OI2A 4YB8A 2IUUA 2BFDA 1R7RA 1VHTA 2WF6A 3RARA 1G2IA 3T7EA 1V5WA 1MXHA 2IW3A 3CF4A 3HVHA 4Q3AA 2I8CA 2RHLA 2YJ6A 3NANA 4FE3A 4R3UC 3EARA 1BMQA 5B7NA 2OPBA 1HE8B 1Q1GA 1XSEA 1D1SA 1X2EA 2AOVA 3KLPX 1IEVA 3OFVA 4I2NA 3GFFA 2VKTA 1O94C 4I99A 4GQBA 4K9DA 1G3IA 4P80A 4XCQA 4FGWA 2BEWB 1BWRA 2O52A 5JTTA 1ODSA 4S0XA 4D0RA 4BX9A 1HETA 4OY3A 2YC2C 3I2YX 2F59A 4R41A 3DVAA 5U1PA 3W05A 4RQBA 3AVTA 4NU5A 3CPHA 1NG1A 5BVGA 3RIEA 4DZTA 1S4MA 4UTRA 5F1KA 2R7NA 3SBXA 3DKRA 1V9SA 1JUDA 1EXWA 1EZZA 1FRNA 1X70A 4NMMA 5HCNA 2PT9A 4CG3A 3F49S 1PAUA 2ZXFA 4F6RB 1MW8X 1S7CA 4MGKR 4HNTA 3CZ9A 1NUAA 4BFSA 1DC7A 2FUKA 3DLTA 4CGZA 1BEEA 2YYAA 1RJEA 1DQPA 4OUDA 3EXG1 1KH3A 1J42A 1T36B 5GQSA 1R5NA 4YYZA 4KZPA 1KQ3A 1NXOA 2COKA 2PL9A 3QVWA 3KXPA 4RA6B 2IUYA 3H2ZA 3BBPA 1IE3A 1P7WA 4KQEA 1V43A 4URHA 1YFKA 4J0CA 5FT9A 2VG8A 1PFQA 4IDAA 1SOAA 4RAOA 4RDIA 2DCMA 3UA3A 4BQIA 3UWSA 5C7OO 4YASA 5I7HA 2GD0A 4IHJB 3TFWA 2I2AA 3EDRA 1V1JA 3MJSA 4KQ6A 2DFDA 5JS8A 4ZOAA 2P8SA 2ZCJA 1N1DA 2PVCA 5YASA 4HRXA 3TZHA 3CMCO 2AI1A 1OSNA 3K8YA 4IVPA 2ONKA 3Q3JB 5TSDA 4Q1FA 1BXGB 1URPA 2WSSA 2OECA 2P2DA 2WIGA 5HUQA 1E2KA 1GLNA 2B5VA 3L8FA 4FDAA 3C70A 5DNDA 1I7LA 4UNNA 2YV4A 1C14A 3F7NA 4JXKA 5JSYA 121PA 3TM4A 1QYRA 5KYGA 1WX1A 3G89A 2CVOA 3O91A 5D5PA 3L04A 5AKGA 3EMVA 1RWBA 2R68A 5LYJB 3U7IA 3KPYA 1MNAA 2LR0A 4XYEA 4G0ZA 4TMFA 4ZAVA 1X87A 3HYSA 1L3IA 3TEFA 2I87A 3HFJA 4DPKA 3TRIA 4UTZA 1A27A 2PFKA 1WZUA 4YRMA 4YAKA 3ZD7A 1JLHA 2GEFA 5AM5A 2I7TA 4ZO6A 1RQ7A 3L06A 4M8SA 2Q0SA 3IUJA 1S1MA 1FS6A 2JF0A 2XKBA 1ORHA 3A1VA 2D4AA 3HEMA 1VA5A 2P75A 2LPMA 3GFTA 3HQ4O 4CG2A 3C6YA 4YHBA 2VC2B 1DAFA 4Z54A 3P7MA 4D9JA 3H8SA 3ZWKA 4HQNA 1FFXA 4J2OA 1YJ8A