1T2HA

Y81w mutant of rnase sa from streptomyces aureofaciens
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
96
Chain Sequence
b'DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYWTGDHYATFSLIDQTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease Sa
publication title Contribution of single tryptophan residues to the fluorescence and stability of ribonuclease sa.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 26
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1t2hA00
2KF3A 5BIRA 1B20A 1GSPA 1IYYA 1BU4A 1UCJA 2AADA 3D5IA 1B2SA 1BAOA 1PYLA 1R4YA 1BNIA 1HYFA 1BNJA 4GHOA 5BU4A 1RGAA 1RGGA 7GSPA 1YGWA 9RNTA 1BSAA 1FW7A 3BU4A 3GSPA 1BRJA 2RBIA 2HOHA 1TRPA 3A5EA 4J5KA 1T2HA 5RNTA 1BVIA 1I2GA 1G02A 1YNVX 1I8VA 1TTOA 1JBRA 1X1XA 1BSDA 1AY7A 3URPA 1RSNA 1BNFA 1LRAA 2F4YA 1DE3A 4HOHA 1I2EA 4BU4A 3DGYA 1GMPA 1BOXA 2RNTA 4GSPA 1Q9EA 1SARA 1B2ZA 1FYSA 1I70A 4J5GA 1RGEA 1RN1A 1BNSA 1FUSA 1A2PA 1MGWA 1BGSA 3SYUA 2ZA4A 3DH2A 1JBTA 1GMQA 1I3IA 1UCKA 1B2MA 3AGNA 1RCLA 2BIRA 3AHWA 1LOWA 1BSCA 1RGHA 1RNTA 1LOVA 3BIRA 1RGFA 1BIRA 1I2FA 1RGLA 3D5GA 1ZGXA 1RNBA 6GSPA 1RGKA 1TRQA 3WHOA 5HOHA 8RNTA 1HZ1A 2C4BA 1RLSA 1X1YA 1GOUA 1RGCA 4HAAA 1B3SA 3WR2A 1T2IA 1JBSA 1BNGA 1GOVA 1UCIA 6RNTA 1RDSA 1PY3A 2F56A 1BRGA 1LOYA 1UCLA 1I0XA 1I0VA 2KF6A 4BIRA 1MGRA 1BRKA 1BNRA 1BSBA 2BU4A 1BRIA 1FZUA 2SARA 1C54A 4RNTA 3AHSA 3KCHA 1BRHA 2F5MA 1BRSA 1BNEA 1BUJA 1BSEA 1CH0A 1GMRA 2KF5A 3AGOA 1RN4A 1AQZA 1B2XA 1FUTA 1I3FA 1LNIA 1BANA 1YVSA 3D4AA 1RTUA 3Q3FA 1RMSA 1X1WA 3RNTA 1RHLA 2GSPA 1B2UA 1B21A 1BRNL 2AAEA 2KAAA 1DETA 1X1UA 2F5WA 1B27A 2KF4A 3HOHA 1RCKA 1GOYA 7RNTA 5GSPA
chains in the Genus database with same CATH superfamily
4R4KA 2Z77A 4XM4A 5LC6A 1B20A 3NHXA 1S723 1VQ83 3ALAA 1GSPA 1O7MB 3MHEA 1IYYA 3SVAA 1ULJB 3D5IA 1D6YA 3B7CA 1IVVA 1JZDA 1OACA 1R4YA 5M19A 4GHOA 1IQXA 1O7PB 1OHPA 1EQKA 1RGAA 3D79A 3J7Yd 1KQS2 4RNZA 1VQP3 5I97A 2H0IA 3BU4A 3FSDA 2GEXA 3B4OA 3MWZA 1IT8A 1NO3A 2CK3H 1TRPA 2IA7A 4KT3B 4J8TA 1DVDA 1EKMA 2OOVA 3NXJA 4XBTA 1DVCA 2GEYA 2YFJB 1T2HA 4JF8A 3MG3A 4FR9A 1I2GA 2CH9A 3JUOA 4PEJA 3EN8A 4HM8B 1I8VA 5STDA 4HM6B 4FCMA 3EHCA 3WA2X 1TU5A 3IPTA 4FMDA 1YHQ3 3CD63 2XFSA 3HI7A 4HM0B 4R9KA 3NBBA 5DREA 3F14A 1JBRA 3FG4A 4BL3A 1OGXA 4CCVA 1BSDA 2P0MA 3N54B 5IG3A 1LRAA 4HBRA 4WHAA 4HOHA 3VF1A 2GU1A 3ER7A 4N3VA 3AMOB 1CYVA 3UB1A 1SARA 2W56B 3CNXA 1W6GA 2WO0A 1FYSA 3EE1A 2IY2A 4J5GA 1RGEA 5BXQA 5AYSC 1BNSA 3DGNA 2E2UA 5EQLA 1FUWA 1JN5A 1A2PA 1LQGC 1YVBI 3EBYA 1BGSA 3SYUA 4L8OA 1ROAA 4N6OB 1VQL3 1SIHA 1Q7HA 2W6JH 4X2HA 1GMQA 1I3IA 5M18A 2QGUA 1B2MA 3AGNA 1JB4A 2BIRA 3ZG0A 3AHWA 1LOWA 3DM8A 4HM4B 1RGHA 1WQLB 1RNTA 4LSOA 5AEWB 2BT3A 3BIRA 3S28A 1RGLA 4AKYA 1FGMA 1G96A 2IMJA 2RFRA 3MG1A 5EVHA 4EW5A 5JBSA 3UNLA 1KD14 1QALA 3KKGA 4N6LA 3OWYA 2J8XB 4HAAA 5ELJA 1B3SA 1OCVA 1T2IA 3DGOA 3SOAA 3UJMA 3WR2A 1BNGA 1Q40A 2XR8B 4NPBA 1UUWB 3KSED 4XDVA 1BRGA 1MNLA 2Y74A 1UI7A 3PGBA 2CFGA 4RZMA 3NUVA 4HM5B 1UI8A 2OOVC 3Q90A 4R80A 1O7WB 4U13A 4OUQA 3ECFA 3WOEB 1BNRA 1BRIA 1TUHA 1FGOA 2C10A 4ZM8A 3RGAA 1E3VA 1EG9B 1Q42A 3KCHA 5CF2A 3LMLA 1BRSA 1SQWA 1KWIA 1FGTA 3EQQB 3AGOA 3PCSA 4O02B 3V99A 1LNIA 2CFLA 3Q3FA 3D4AA 1ZX2A 1W7CA 1RTUA 2CWTA 5ELUA 2FXTA 4EV5A 1RMSA 5KP1A 3H51A 2WOHA 3HK4A 3EBTA 1RHLA 2P05A 1YJN3 1YIJ3 5AIFA 2QEX3 1MWTA 1O7NB 3BNBA 3GZBA 2AAEA 2K3DA 3KE7A 3N9HA 7STDA 3CCL3 2F86B 7RNTA 1X1UA 1V57A 1KSIA 3Q2PA 3CCS3 2CWVA 1W5ZA 5KP3A 5HGRA 2CX0A 2KF3A 2STDA 2KCDA 3DY5A 2F98A 1NB3I 4N6MA 4WYKA 2K54A 1JRQA 2D42A 2AADA 1T3BA 1JNQA 2L1SA 1BAOA 1Y4KA 4H3UA 2UGIA 2Z6BA 1OPYA 3FF2A 4KFDA 2HMMB 3CU3A 1IT7A 7GSPA 3CC43 1YGWA 4MMXB 2W04A 2H0GA 3OX9A 3PYJA 1FW7A 1V74A 3AMOA 2CG1A 2HOHA 4I5QA 4J9AA 1IQYA 3I0YA 4EV2A 1C7HA 3BB9A 3BLZA 2CW9A 3DZLA 4J5KA 1Q864 1BVIA 3M8CA 1W6CA 3MSOA 1JB5A 1YNVX 3KFQC 1EEJA 5IG0A 1A67A 1MWUA 2ZHXB 3FG1A 4XDWA 3PS8A 3V92A 1IU7A 1LQMB 1U5OA 2HMOB 3LOYA 2RGQA 2FNQA 1X1XA 2GXFA 1RJOA 3URPA 1RSNA 1BNFA 2F4YA 5IG4A 3MYTA 3LTBA 3NQYA 4ILFA 1IK3A 1W01A 5JPUA 1VQM3 3G16A 4MJDA 4L7KA 1B2ZA 3FF0A 1QJGA 5IG5A 1YJW3 3G4S3 1J2BA 3SEDA 2OTJ3 3WMDA 1STDA 3CC23 2BMQB 3I563 2YFIB 1ASKA 5IEOA 4WYKB 1IDPA 5AIIA 1BSCA 8CHOA 3CCU3 1NJI4 3G6E3 4X2OA 1IVXA 2CHCA 3F7XA 1I2FA 3D3LA 4RBNA 1EUIC 1W02A 2CFDA 4K61A 2CFKA 6GSPA 2YFLB 1M9GA 1PFPA 1JKGA 3U1WA 2O9UX 3WHOA 2B24B 8RNTA 5HOHA 1GS3A 2C4BA 3EC9A 1RLSA 1X1YA 3PXMA 1GY5A 1VQO3 1GYBA 1MOLA 1Z1SA 3SLUA 1VQ63 2BMRB 1JBSA 1UCIA 4FMBA 1RDSA 2F56A 2BNGA 3BNCA 1DMQA 3T0UA 1LOYA 1Q7Y4 1QMAA 1RRLA 1UCLA 2QIYA 2UUGC 3EF8A 4BIRA 4I4KA 4FMAA 5AYRB 5CLKA 5FW5A 1DMMA 4EXRA 2INXA 3K63A 1U8CB 2F5MA 4CJNA 1BNEA 4HJLB 4N6UA 2XSOB 5LC7A 2GBXB 1L5GB 3PZWA 3X3YA 1YIT3 1T5YA 3GZRA 5AIGA 1WMNA 2KF5A 1N9JA 3NM7A 1AQZA 2WGOA 1FUTA 1YVSA 3OXAA 3UL6A 1A90A 2C11A 1X1WA 3F8HA 4LEHA 1UDII 3QRDA 5AEUB 1JJ22 1O7GB 1B21A 2FGTA 3D9RA 2XGLA 5CXOA 2W9PA 3LTCA 2KAAA 4HKVB 3SXXA 3CCV3 1S5AA 2KF4A 2MF7A 3HOHA 1VQ93 2YX9A 1JZOA 1GOYA 3OV4A 3CME3 1GD3A 5GSPA 3BNDA 3VSYA 3X42A 3B8LA 3LTDA 1W2B2 2Y73A 3X3ZA 2K0MA 1CYUA 1W00A 4H61A 2CIUA 4HVNA 1UCJA 3NX0A 3EJVA 1OF5A 3H3HA 3LT9A 1B2SA 1JKGB 3IJEB 1PYLA 1W2ZA 4MEIA 3WOFB 3G713 1QVG2 1HYFA 2XGNA 1BNJA 4GL6A 1UW1A 2OQEA 1YJ93 1RN7A 2GU3A 2BHMA 3KN4A 2RBIA 3S67A 1O7HB 3ROBA 5BVBA 1W4NA 4K1UA 3NV0A 1UGHI 3QK9A 2V1LA 4FCZA 2O3OA 4BL2A 5RNTA 2RCDA 3CPW2 1M904 3SOYA 3FG3A 1RKYA 5IENA 1K9M4 1G02A 4L8PA 2ML5A 4BTWA 1K8A4 3CMA3 1E97A 4EC6A 1V58A 4MMYB 5M1AA 3FLJA 4AEQA 2WGQA 1DE3A 4BU4A 2Z76A 1BOXA 2RNTA 1Q9EA 1AVLA 4HM1B 1CEWI 3FGYA 2M7OA 4LZIA 3S29A 4DKIA 3Q1CA 1GY7A 3F7SA 2GBWB 2W03A 3DGMA 3GZYB 4BTXA 4RNYA 5IERA 3GZXB 4ORLA 1GY6A 1MGWA 3S5CA 3KIIA 4N6NB 3E99A 3IMAB 2ZA4A 3TDGA 3WDGB 1ZS7A 1A2VA 2BO9B 1OHSA 1IQ8A 1UCKA 5IF6A 2OTL3 4R9LA 1OHOA 3UL5A 1RCLA 4TX4A 2W2CA 1TFOA 5KP4A 5JPPA 1SIIA 2XF3A 1LOVA 1OF5B 3JUQA 4EBGA 2I9WA 3F8XA 5D83A 1BIRA 1KC84 3D5GA 1CQSA 2PNCA 3MKIA 5EEOA 1HKXA 4K1VA 2IUJA 1TRQA 2KRTA 3G8ZA 4STDA 3LYGA 3HIIA 1OGZA 1SJWA 1GOUA 1VZZA 2IYJA 2R4IA 3JVCA 2OQEC 2XH9A 3DUKA 3NV0B 3V98A 1JV2B 1N9EA 3K7CA 3FCSB 1Q814 6RNTA 3KSPA 3GWRA 4FMCA 4IPBA 4LGQA 1JB2A 1MWRA 2UX0A 5D81A 1I0VA 1TJDA 3CCM3 1UUGB 4FCJA 1BRKA 2MC8A 3LZAA 1R4CA 3FH1A 2BU4A 4KVHA 1YGEA 4O2HA 4N6V0 3WODG 1US1A 4XB5A 1F8NA 3RGRA 2SARA 2XFTA 2L4VA 4RNTA 1LVNA 2JQ5A 4HM2B 3KZTA 2HMKB 1BSEA 1K28A 1STFI 3PCRA 1UGIA 3EB8A 1N5PA 1RN4A 1B2XA 2OWPA 2F99A 1I3FA 1LOXA 3MG2A 1BANA 3OWSA 4WFOA 1YI23 1BUQA 4CPKA 1K734 4QWTA 3CPOA 2CWUA 3ZG5A 5IEPA 2CKFB 1SPUA 2PZVA 3LT8A 1BRNL 4Q53A 4HZ9B 4XBXA 1IV9A 1N8QA 2F5WA 1B27A 4KZ1A 1RCKA 3GRDA 4HM7B 2B1XB 3VGNA 3I553 3CXC2 1QAFA 5AIHA 3X3XA 1G0TA 5BIRA 3JUMA 1BU4A 1WNHA 2P38A 1VQ73 3CCJ3 2Z7AA 1AV4A 3DGLA 2HMLB 4IIAA 2Q07A 5FGOA 1BNIA 5BU4A 4IT7A 1RGGA 2BMOB 2A15A 4KFEA 3X41A 9RNTA 1BSAA 1MWSA 5AI1A 3WA3A 3GSPA 1IVUA 1BRJA 4HM3B 4WP5A 2CG0A 1UUVB 2H0HA 5CF1A 4N6TA 3NBJA 1RRHA 2XRXB 4EYCA 2LQVA 1K41A 2OCTA 2RSXA 1AR0A 2W0QA 3A5EA 5D82A 3HX8A 1WTHA 4R1KA 4OVMA 4MMZB 1IVWA 5IW9A 1TTOA 4LMIA 1FGQA 1D6UA 3G0KA 2LYXA 4GB5A 4HZBB 1VQQA 3HIGA 1VQK3 4BTYA 4OK0A 1Q824 4WWUC 1DYUA 5DRVA 1VQ53 1NNVA 1AY7A 2IUKA 3A76A 3DMCA 1I2EA 1NWWA 3STDA 3DGYA 1GMPA 3GAXA 1NU3A 3FKAA 3NBRA 4GSPA 1N8R4 3K9MC 3F9SA 4LYLB 4XBYA 4KFFA 2E2TA 2ML6A 4O8SA 1GD4A 4CDLA 1I70A 2WOFA 5G1LA 3SX1A 2XSHB 3LTAA 1RN1A 1VQN3 1FUSA 3K5TA 3ZFZA 3JUNA 1EA2A 1WMPA 3DH2A 3K0ZA 2QA43 1JBTA 1N5HA 3MPHA 3CC73 4NHFA 3U97A 1M1K4 5G1KA 5A0OB 3DXOA 3B4PA 1W6YA 1NB5I 1FA3A 3CNMA 1RGFA 4HYZA 1A2KA 2R41A 2P0XA 3CCQ3 1ZGXA 1TP6A 2ZL8A 1RNBA 4JRFA 1RGKA 1E3RA 2CX1A 1LXEA 1HZ1A 1AVKA 1ROVA 4K90B 1RGCA 1LNHA 2D1WA 1JN5B 2SBLA 3OWUA 1TIJA 3LH4A 1FGRA 1GOVA 3S27A 3EX9A 1NDOB 1HU9A 1OUNA 1PY3A 3LXUX 3NM2A 1I0XA 1ZO2A 2KF6A 1ULIB 3EN1B 1MGRA 2ZDJA 5TGNA 4AKZA 1TFKA 3JUPA 3T8NA 1BSBA 3HZPA 3OW22 2P09A 1D6ZA 3T8UA 1FZUA 2HMNB 1C54A 3BNEA 2CC3A 1QAKA 3AHSA 1BRHA 3N8BA 4NREA 2W9QA 5CK6A 1BUJA 3L0RA 5G2GA 1VQ43 2HMJB 2XEPA 6STDA 1CH0A 1GMRA 3F40A 3FZWA 4O3VA 1DMNA 1QVF2 2E2VA 4G1MB 3O8YA 1ISKA 1Q40B 1OH0A 3NQZA 2W56A 3RNTA 1WMOA 2GSPA 2JDIH 3RDEA 1B2UA 1M1XB 3CCE3 2CFWA 1DETA 1IV7A 3CCR3 3X40A 1PU4A 2KXGA
chains in the Genus database with same CATH topology
2KF3A 5BIRA 1B20A 1GSPA 1IYYA 1BU4A 1UCJA 2AADA 3D5IA 1B2SA 1BAOA 1PYLA 1R4YA 1BNIA 1HYFA 1BNJA 4GHOA 5BU4A 1RGAA 1RGGA 7GSPA 1YGWA 9RNTA 1BSAA 1FW7A 3BU4A 3GSPA 1BRJA 2RBIA 2HOHA 1TRPA 3A5EA 4J5KA 1T2HA 5RNTA 1BVIA 1I2GA 1G02A 1YNVX 1I8VA 1TTOA 1JBRA 1X1XA 1BSDA 1AY7A 3URPA 1RSNA 1BNFA 1LRAA 2F4YA 1DE3A 4HOHA 1I2EA 4BU4A 3DGYA 1GMPA 1BOXA 2RNTA 4GSPA 1Q9EA 1SARA 1B2ZA 1FYSA 1I70A 4J5GA 1RGEA 1RN1A 1BNSA 1FUSA 1A2PA 1MGWA 1BGSA 3SYUA 2ZA4A 3DH2A 1JBTA 1GMQA 1I3IA 1UCKA 1B2MA 3AGNA 1RCLA 2BIRA 3AHWA 1LOWA 1BSCA 1RGHA 1RNTA 1LOVA 3BIRA 1RGFA 1BIRA 1I2FA 1RGLA 3D5GA 1ZGXA 1RNBA 6GSPA 1RGKA 1TRQA 3WHOA 5HOHA 8RNTA 1HZ1A 2C4BA 1RLSA 1X1YA 1GOUA 1RGCA 4HAAA 1B3SA 3WR2A 1T2IA 1JBSA 1BNGA 1GOVA 1UCIA 6RNTA 1RDSA 1PY3A 2F56A 1BRGA 1LOYA 1UCLA 1I0XA 1I0VA 2KF6A 4BIRA 1MGRA 1BRKA 1BNRA 1BSBA 2BU4A 1BRIA 1FZUA 2SARA 1C54A 4RNTA 3AHSA 3KCHA 1BRHA 2F5MA 1BRSA 1BNEA 1BUJA 1BSEA 1CH0A 1GMRA 2KF5A 3AGOA 1RN4A 1AQZA 1B2XA 1FUTA 1I3FA 1LNIA 1BANA 1YVSA 3D4AA 1RTUA 3Q3FA 1RMSA 1X1WA 3RNTA 1RHLA 2GSPA 1B2UA 1B21A 1BRNL 2AAEA 2KAAA 1DETA 1X1UA 2F5WA 1B27A 2KF4A 3HOHA 1RCKA 1GOYA 7RNTA 5GSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KF3 A;  5BIR A;  1B20 A;  1GSP A;  1IYY A;  1BU4 A;  1UCJ A;  2AAD A;  3D5I A;  1B2S A;  1BAO A;  1PYL A;  1R4Y A;  1BNI A;  1HYF A;  1BNJ A;  4GHO A;  5BU4 A;  1RGA A;  1RGG A;  7GSP A;  1YGW A;  9RNT A;  1BSA A;  1FW7 A;  3BU4 A;  3GSP A;  1BRJ A;  2RBI A;  2HOH A;  1TRP A;  3A5E A;  4J5K A;  1T2H A;  5RNT A;  1BVI A;  1I2G A;  1G02 A;  1YNV X;  1I8V A;  1TTO A;  1JBR A;  1X1X A;  1BSD A;  1AY7 A;  3URP A;  1RSN A;  1BNF A;  1LRA A;  2F4Y A;  1DE3 A;  4HOH A;  1I2E A;  4BU4 A;  3DGY A;  1GMP A;  1BOX A;  2RNT A;  4GSP A;  1Q9E A;  1SAR A;  1B2Z A;  1FYS A;  1I70 A;  4J5G A;  1RGE A;  1RN1 A;  1BNS A;  1FUS A;  1A2P A;  1MGW A;  1BGS A;  3SYU A;  2ZA4 A;  3DH2 A;  1JBT A;  1GMQ A;  1I3I A;  1UCK A;  1B2M A;  3AGN A;  1RCL A;  2BIR A;  3AHW A;  1LOW A;  1BSC A;  1RGH A;  1RNT A;  1LOV A;  3BIR A;  1RGF A;  1BIR A;  1I2F A;  1RGL A;  3D5G A;  1ZGX A;  1RNB A;  6GSP A;  1RGK A;  1TRQ A;  3WHO A;  5HOH A;  8RNT A;  1HZ1 A;  2C4B A;  1RLS A;  1X1Y A;  1GOU A;  1RGC A;  4HAA A;  1B3S A;  3WR2 A;  1T2I A;  1JBS A;  1BNG A;  1GOV A;  1UCI A;  6RNT A;  1RDS A;  1PY3 A;  2F56 A;  1BRG A;  1LOY A;  1UCL A;  1I0X A;  1I0V A;  2KF6 A;  4BIR A;  1MGR A;  1BRK A;  1BNR A;  1BSB A;  2BU4 A;  1BRI A;  1FZU A;  2SAR A;  1C54 A;  4RNT A;  3AHS A;  3KCH A;  1BRH A;  2F5M A;  1BRS A;  1BNE A;  1BUJ A;  1BSE A;  1CH0 A;  1GMR A;  2KF5 A;  3AGO A;  1RN4 A;  1AQZ A;  1B2X A;  1FUT A;  1I3F A;  1LNI A;  1BAN A;  1YVS A;  3D4A A;  1RTU A;  3Q3F A;  1RMS A;  1X1W A;  3RNT A;  1RHL A;  2GSP A;  1B2U A;  1B21 A;  1BRN L;  2AAE A;  2KAA A;  1DET A;  1X1U A;  2F5W A;  1B27 A;  2KF4 A;  3HOH A;  1RCK A;  1GOY A;  7RNT A;  5GSP A; 
#chains in the Genus database with same CATH topology
 4R4K A;  2Z77 A;  4XM4 A;  5LC6 A;  1B20 A;  3NHX A;  1S72 3;  1VQ8 3;  3ALA A;  1GSP A;  1O7M B;  3MHE A;  1IYY A;  3SVA A;  1ULJ B;  3D5I A;  1D6Y A;  3B7C A;  1IVV A;  1JZD A;  1OAC A;  1R4Y A;  5M19 A;  4GHO A;  1IQX A;  1O7P B;  1OHP A;  1EQK A;  1RGA A;  3D79 A;  3J7Y d;  1KQS 2;  4RNZ A;  1VQP 3;  5I97 A;  2H0I A;  3BU4 A;  3FSD A;  2GEX A;  3B4O A;  3MWZ A;  1IT8 A;  1NO3 A;  2CK3 H;  1TRP A;  2IA7 A;  4KT3 B;  4J8T A;  1DVD A;  1EKM A;  2OOV A;  3NXJ A;  4XBT A;  1DVC A;  2GEY A;  2YFJ B;  1T2H A;  4JF8 A;  3MG3 A;  4FR9 A;  1I2G A;  2CH9 A;  3JUO A;  4PEJ A;  3EN8 A;  4HM8 B;  1I8V A;  5STD A;  4HM6 B;  4FCM A;  3EHC A;  3WA2 X;  1TU5 A;  3IPT A;  4FMD A;  1YHQ 3;  3CD6 3;  2XFS A;  3HI7 A;  4HM0 B;  4R9K A;  3NBB A;  5DRE A;  3F14 A;  1JBR A;  3FG4 A;  4BL3 A;  1OGX A;  4CCV A;  1BSD A;  2P0M A;  3N54 B;  5IG3 A;  1LRA A;  4HBR A;  4WHA A;  4HOH A;  3VF1 A;  2GU1 A;  3ER7 A;  4N3V A;  3AMO B;  1CYV A;  3UB1 A;  1SAR A;  2W56 B;  3CNX A;  1W6G A;  2WO0 A;  1FYS A;  3EE1 A;  2IY2 A;  4J5G A;  1RGE A;  5BXQ A;  5AYS C;  1BNS A;  3DGN A;  2E2U A;  5EQL A;  1FUW A;  1JN5 A;  1A2P A;  1LQG C;  1YVB I;  3EBY A;  1BGS A;  3SYU A;  4L8O A;  1ROA A;  4N6O B;  1VQL 3;  1SIH A;  1Q7H A;  2W6J H;  4X2H A;  1GMQ A;  1I3I A;  5M18 A;  2QGU A;  1B2M A;  3AGN A;  1JB4 A;  2BIR A;  3ZG0 A;  3AHW A;  1LOW A;  3DM8 A;  4HM4 B;  1RGH A;  1WQL B;  1RNT A;  4LSO A;  5AEW B;  2BT3 A;  3BIR A;  3S28 A;  1RGL A;  4AKY A;  1FGM A;  1G96 A;  2IMJ A;  2RFR A;  3MG1 A;  5EVH A;  4EW5 A;  5JBS A;  3UNL A;  1KD1 4;  1QAL A;  3KKG A;  4N6L A;  3OWY A;  2J8X B;  4HAA A;  5ELJ A;  1B3S A;  1OCV A;  1T2I A;  3DGO A;  3SOA A;  3UJM A;  3WR2 A;  1BNG A;  1Q40 A;  2XR8 B;  4NPB A;  1UUW B;  3KSE D;  4XDV A;  1BRG A;  1MNL A;  2Y74 A;  1UI7 A;  3PGB A;  2CFG A;  4RZM A;  3NUV A;  4HM5 B;  1UI8 A;  2OOV C;  3Q90 A;  4R80 A;  1O7W B;  4U13 A;  4OUQ A;  3ECF A;  3WOE B;  1BNR A;  1BRI A;  1TUH A;  1FGO A;  2C10 A;  4ZM8 A;  3RGA A;  1E3V A;  1EG9 B;  1Q42 A;  3KCH A;  5CF2 A;  3LML A;  1BRS A;  1SQW A;  1KWI A;  1FGT A;  3EQQ B;  3AGO A;  3PCS A;  4O02 B;  3V99 A;  1LNI A;  2CFL A;  3Q3F A;  3D4A A;  1ZX2 A;  1W7C A;  1RTU A;  2CWT A;  5ELU A;  2FXT A;  4EV5 A;  1RMS A;  5KP1 A;  3H51 A;  2WOH A;  3HK4 A;  3EBT A;  1RHL A;  2P05 A;  1YJN 3;  1YIJ 3;  5AIF A;  2QEX 3;  1MWT A;  1O7N B;  3BNB A;  3GZB A;  2AAE A;  2K3D A;  3KE7 A;  3N9H A;  7STD A;  3CCL 3;  2F86 B;  7RNT A;  1X1U A;  1V57 A;  1KSI A;  3Q2P A;  3CCS 3;  2CWV A;  1W5Z A;  5KP3 A;  5HGR A;  2CX0 A;  2KF3 A;  2STD A;  2KCD A;  3DY5 A;  2F98 A;  1NB3 I;  4N6M A;  4WYK A;  2K54 A;  1JRQ A;  2D42 A;  2AAD A;  1T3B A;  1JNQ A;  2L1S A;  1BAO A;  1Y4K A;  4H3U A;  2UGI A;  2Z6B A;  1OPY A;  3FF2 A;  4KFD A;  2HMM B;  3CU3 A;  1IT7 A;  7GSP A;  3CC4 3;  1YGW A;  4MMX B;  2W04 A;  2H0G A;  3OX9 A;  3PYJ A;  1FW7 A;  1V74 A;  3AMO A;  2CG1 A;  2HOH A;  4I5Q A;  4J9A A;  1IQY A;  3I0Y A;  4EV2 A;  1C7H A;  3BB9 A;  3BLZ A;  2CW9 A;  3DZL A;  4J5K A;  1Q86 4;  1BVI A;  3M8C A;  1W6C A;  3MSO A;  1JB5 A;  1YNV X;  3KFQ C;  1EEJ A;  5IG0 A;  1A67 A;  1MWU A;  2ZHX B;  3FG1 A;  4XDW A;  3PS8 A;  3V92 A;  1IU7 A;  1LQM B;  1U5O A;  2HMO B;  3LOY A;  2RGQ A;  2FNQ A;  1X1X A;  2GXF A;  1RJO A;  3URP A;  1RSN A;  1BNF A;  2F4Y A;  5IG4 A;  3MYT A;  3LTB A;  3NQY A;  4ILF A;  1IK3 A;  1W01 A;  5JPU A;  1VQM 3;  3G16 A;  4MJD A;  4L7K A;  1B2Z A;  3FF0 A;  1QJG A;  5IG5 A;  1YJW 3;  3G4S 3;  1J2B A;  3SED A;  2OTJ 3;  3WMD A;  1STD A;  3CC2 3;  2BMQ B;  3I56 3;  2YFI B;  1ASK A;  5IEO A;  4WYK B;  1IDP A;  5AII A;  1BSC A;  8CHO A;  3CCU 3;  1NJI 4;  3G6E 3;  4X2O A;  1IVX A;  2CHC A;  3F7X A;  1I2F A;  3D3L A;  4RBN A;  1EUI C;  1W02 A;  2CFD A;  4K61 A;  2CFK A;  6GSP A;  2YFL B;  1M9G A;  1PFP A;  1JKG A;  3U1W A;  2O9U X;  3WHO A;  2B24 B;  8RNT A;  5HOH A;  1GS3 A;  2C4B A;  3EC9 A;  1RLS A;  1X1Y A;  3PXM A;  1GY5 A;  1VQO 3;  1GYB A;  1MOL A;  1Z1S A;  3SLU A;  1VQ6 3;  2BMR B;  1JBS A;  1UCI A;  4FMB A;  1RDS A;  2F56 A;  2BNG A;  3BNC A;  1DMQ A;  3T0U A;  1LOY A;  1Q7Y 4;  1QMA A;  1RRL A;  1UCL A;  2QIY A;  2UUG C;  3EF8 A;  4BIR A;  4I4K A;  4FMA A;  5AYR B;  5CLK A;  5FW5 A;  1DMM A;  4EXR A;  2INX A;  3K63 A;  1U8C B;  2F5M A;  4CJN A;  1BNE A;  4HJL B;  4N6U A;  2XSO B;  5LC7 A;  2GBX B;  1L5G B;  3PZW A;  3X3Y A;  1YIT 3;  1T5Y A;  3GZR A;  5AIG A;  1WMN A;  2KF5 A;  1N9J A;  3NM7 A;  1AQZ A;  2WGO A;  1FUT A;  1YVS A;  3OXA A;  3UL6 A;  1A90 A;  2C11 A;  1X1W A;  3F8H A;  4LEH A;  1UDI I;  3QRD A;  5AEU B;  1JJ2 2;  1O7G B;  1B21 A;  2FGT A;  3D9R A;  2XGL A;  5CXO A;  2W9P A;  3LTC A;  2KAA A;  4HKV B;  3SXX A;  3CCV 3;  1S5A A;  2KF4 A;  2MF7 A;  3HOH A;  1VQ9 3;  2YX9 A;  1JZO A;  1GOY A;  3OV4 A;  3CME 3;  1GD3 A;  5GSP A;  3BND A;  3VSY A;  3X42 A;  3B8L A;  3LTD A;  1W2B 2;  2Y73 A;  3X3Z A;  2K0M A;  1CYU A;  1W00 A;  4H61 A;  2CIU A;  4HVN A;  1UCJ A;  3NX0 A;  3EJV A;  1OF5 A;  3H3H A;  3LT9 A;  1B2S A;  1JKG B;  3IJE B;  1PYL A;  1W2Z A;  4MEI A;  3WOF B;  3G71 3;  1QVG 2;  1HYF A;  2XGN A;  1BNJ A;  4GL6 A;  1UW1 A;  2OQE A;  1YJ9 3;  1RN7 A;  2GU3 A;  2BHM A;  3KN4 A;  2RBI A;  3S67 A;  1O7H B;  3ROB A;  5BVB A;  1W4N A;  4K1U A;  3NV0 A;  1UGH I;  3QK9 A;  2V1L A;  4FCZ A;  2O3O A;  4BL2 A;  5RNT A;  2RCD A;  3CPW 2;  1M90 4;  3SOY A;  3FG3 A;  1RKY A;  5IEN A;  1K9M 4;  1G02 A;  4L8P A;  2ML5 A;  4BTW A;  1K8A 4;  3CMA 3;  1E97 A;  4EC6 A;  1V58 A;  4MMY B;  5M1A A;  3FLJ A;  4AEQ A;  2WGQ A;  1DE3 A;  4BU4 A;  2Z76 A;  1BOX A;  2RNT A;  1Q9E A;  1AVL A;  4HM1 B;  1CEW I;  3FGY A;  2M7O A;  4LZI A;  3S29 A;  4DKI A;  3Q1C A;  1GY7 A;  3F7S A;  2GBW B;  2W03 A;  3DGM A;  3GZY B;  4BTX A;  4RNY A;  5IER A;  3GZX B;  4ORL A;  1GY6 A;  1MGW A;  3S5C A;  3KII A;  4N6N B;  3E99 A;  3IMA B;  2ZA4 A;  3TDG A;  3WDG B;  1ZS7 A;  1A2V A;  2BO9 B;  1OHS A;  1IQ8 A;  1UCK A;  5IF6 A;  2OTL 3;  4R9L A;  1OHO A;  3UL5 A;  1RCL A;  4TX4 A;  2W2C A;  1TFO A;  5KP4 A;  5JPP A;  1SII A;  2XF3 A;  1LOV A;  1OF5 B;  3JUQ A;  4EBG A;  2I9W A;  3F8X A;  5D83 A;  1BIR A;  1KC8 4;  3D5G A;  1CQS A;  2PNC A;  3MKI A;  5EEO A;  1HKX A;  4K1V A;  2IUJ A;  1TRQ A;  2KRT A;  3G8Z A;  4STD A;  3LYG A;  3HII A;  1OGZ A;  1SJW A;  1GOU A;  1VZZ A;  2IYJ A;  2R4I A;  3JVC A;  2OQE C;  2XH9 A;  3DUK A;  3NV0 B;  3V98 A;  1JV2 B;  1N9E A;  3K7C A;  3FCS B;  1Q81 4;  6RNT A;  3KSP A;  3GWR A;  4FMC A;  4IPB A;  4LGQ A;  1JB2 A;  1MWR A;  2UX0 A;  5D81 A;  1I0V A;  1TJD A;  3CCM 3;  1UUG B;  4FCJ A;  1BRK A;  2MC8 A;  3LZA A;  1R4C A;  3FH1 A;  2BU4 A;  4KVH A;  1YGE A;  4O2H A;  4N6V 0;  3WOD G;  1US1 A;  4XB5 A;  1F8N A;  3RGR A;  2SAR A;  2XFT A;  2L4V A;  4RNT A;  1LVN A;  2JQ5 A;  4HM2 B;  3KZT A;  2HMK B;  1BSE A;  1K28 A;  1STF I;  3PCR A;  1UGI A;  3EB8 A;  1N5P A;  1RN4 A;  1B2X A;  2OWP A;  2F99 A;  1I3F A;  1LOX A;  3MG2 A;  1BAN A;  3OWS A;  4WFO A;  1YI2 3;  1BUQ A;  4CPK A;  1K73 4;  4QWT A;  3CPO A;  2CWU A;  3ZG5 A;  5IEP A;  2CKF B;  1SPU A;  2PZV A;  3LT8 A;  1BRN L;  4Q53 A;  4HZ9 B;  4XBX A;  1IV9 A;  1N8Q A;  2F5W A;  1B27 A;  4KZ1 A;  1RCK A;  3GRD A;  4HM7 B;  2B1X B;  3VGN A;  3I55 3;  3CXC 2;  1QAF A;  5AIH A;  3X3X A;  1G0T A;  5BIR A;  3JUM A;  1BU4 A;  1WNH A;  2P38 A;  1VQ7 3;  3CCJ 3;  2Z7A A;  1AV4 A;  3DGL A;  2HML B;  4IIA A;  2Q07 A;  5FGO A;  1BNI A;  5BU4 A;  4IT7 A;  1RGG A;  2BMO B;  2A15 A;  4KFE A;  3X41 A;  9RNT A;  1BSA A;  1MWS A;  5AI1 A;  3WA3 A;  3GSP A;  1IVU A;  1BRJ A;  4HM3 B;  4WP5 A;  2CG0 A;  1UUV B;  2H0H A;  5CF1 A;  4N6T A;  3NBJ A;  1RRH A;  2XRX B;  4EYC A;  2LQV A;  1K41 A;  2OCT A;  2RSX A;  1AR0 A;  2W0Q A;  3A5E A;  5D82 A;  3HX8 A;  1WTH A;  4R1K A;  4OVM A;  4MMZ B;  1IVW A;  5IW9 A;  1TTO A;  4LMI A;  1FGQ A;  1D6U A;  3G0K A;  2LYX A;  4GB5 A;  4HZB B;  1VQQ A;  3HIG A;  1VQK 3;  4BTY A;  4OK0 A;  1Q82 4;  4WWU C;  1DYU A;  5DRV A;  1VQ5 3;  1NNV A;  1AY7 A;  2IUK A;  3A76 A;  3DMC A;  1I2E A;  1NWW A;  3STD A;  3DGY A;  1GMP A;  3GAX A;  1NU3 A;  3FKA A;  3NBR A;  4GSP A;  1N8R 4;  3K9M C;  3F9S A;  4LYL B;  4XBY A;  4KFF A;  2E2T A;  2ML6 A;  4O8S A;  1GD4 A;  4CDL A;  1I70 A;  2WOF A;  5G1L A;  3SX1 A;  2XSH B;  3LTA A;  1RN1 A;  1VQN 3;  1FUS A;  3K5T A;  3ZFZ A;  3JUN A;  1EA2 A;  1WMP A;  3DH2 A;  3K0Z A;  2QA4 3;  1JBT A;  1N5H A;  3MPH A;  3CC7 3;  4NHF A;  3U97 A;  1M1K 4;  5G1K A;  5A0O B;  3DXO A;  3B4P A;  1W6Y A;  1NB5 I;  1FA3 A;  3CNM A;  1RGF A;  4HYZ A;  1A2K A;  2R41 A;  2P0X A;  3CCQ 3;  1ZGX A;  1TP6 A;  2ZL8 A;  1RNB A;  4JRF A;  1RGK A;  1E3R A;  2CX1 A;  1LXE A;  1HZ1 A;  1AVK A;  1ROV A;  4K90 B;  1RGC A;  1LNH A;  2D1W A;  1JN5 B;  2SBL A;  3OWU A;  1TIJ A;  3LH4 A;  1FGR A;  1GOV A;  3S27 A;  3EX9 A;  1NDO B;  1HU9 A;  1OUN A;  1PY3 A;  3LXU X;  3NM2 A;  1I0X A;  1ZO2 A;  2KF6 A;  1ULI B;  3EN1 B;  1MGR A;  2ZDJ A;  5TGN A;  4AKZ A;  1TFK A;  3JUP A;  3T8N A;  1BSB A;  3HZP A;  3OW2 2;  2P09 A;  1D6Z A;  3T8U A;  1FZU A;  2HMN B;  1C54 A;  3BNE A;  2CC3 A;  1QAK A;  3AHS A;  1BRH A;  3N8B A;  4NRE A;  2W9Q A;  5CK6 A;  1BUJ A;  3L0R A;  5G2G A;  1VQ4 3;  2HMJ B;  2XEP A;  6STD A;  1CH0 A;  1GMR A;  3F40 A;  3FZW A;  4O3V A;  1DMN A;  1QVF 2;  2E2V A;  4G1M B;  3O8Y A;  1ISK A;  1Q40 B;  1OH0 A;  3NQZ A;  2W56 A;  3RNT A;  1WMO A;  2GSP A;  2JDI H;  3RDE A;  1B2U A;  1M1X B;  3CCE 3;  2CFW A;  1DET A;  1IV7 A;  3CCR 3;  3X40 A;  1PU4 A;  2KXG A; 
#chains in the Genus database with same CATH homology
 2KF3 A;  5BIR A;  1B20 A;  1GSP A;  1IYY A;  1BU4 A;  1UCJ A;  2AAD A;  3D5I A;  1B2S A;  1BAO A;  1PYL A;  1R4Y A;  1BNI A;  1HYF A;  1BNJ A;  4GHO A;  5BU4 A;  1RGA A;  1RGG A;  7GSP A;  1YGW A;  9RNT A;  1BSA A;  1FW7 A;  3BU4 A;  3GSP A;  1BRJ A;  2RBI A;  2HOH A;  1TRP A;  3A5E A;  4J5K A;  1T2H A;  5RNT A;  1BVI A;  1I2G A;  1G02 A;  1YNV X;  1I8V A;  1TTO A;  1JBR A;  1X1X A;  1BSD A;  1AY7 A;  3URP A;  1RSN A;  1BNF A;  1LRA A;  2F4Y A;  1DE3 A;  4HOH A;  1I2E A;  4BU4 A;  3DGY A;  1GMP A;  1BOX A;  2RNT A;  4GSP A;  1Q9E A;  1SAR A;  1B2Z A;  1FYS A;  1I70 A;  4J5G A;  1RGE A;  1RN1 A;  1BNS A;  1FUS A;  1A2P A;  1MGW A;  1BGS A;  3SYU A;  2ZA4 A;  3DH2 A;  1JBT A;  1GMQ A;  1I3I A;  1UCK A;  1B2M A;  3AGN A;  1RCL A;  2BIR A;  3AHW A;  1LOW A;  1BSC A;  1RGH A;  1RNT A;  1LOV A;  3BIR A;  1RGF A;  1BIR A;  1I2F A;  1RGL A;  3D5G A;  1ZGX A;  1RNB A;  6GSP A;  1RGK A;  1TRQ A;  3WHO A;  5HOH A;  8RNT A;  1HZ1 A;  2C4B A;  1RLS A;  1X1Y A;  1GOU A;  1RGC A;  4HAA A;  1B3S A;  3WR2 A;  1T2I A;  1JBS A;  1BNG A;  1GOV A;  1UCI A;  6RNT A;  1RDS A;  1PY3 A;  2F56 A;  1BRG A;  1LOY A;  1UCL A;  1I0X A;  1I0V A;  2KF6 A;  4BIR A;  1MGR A;  1BRK A;  1BNR A;  1BSB A;  2BU4 A;  1BRI A;  1FZU A;  2SAR A;  1C54 A;  4RNT A;  3AHS A;  3KCH A;  1BRH A;  2F5M A;  1BRS A;  1BNE A;  1BUJ A;  1BSE A;  1CH0 A;  1GMR A;  2KF5 A;  3AGO A;  1RN4 A;  1AQZ A;  1B2X A;  1FUT A;  1I3F A;  1LNI A;  1BAN A;  1YVS A;  3D4A A;  1RTU A;  3Q3F A;  1RMS A;  1X1W A;  3RNT A;  1RHL A;  2GSP A;  1B2U A;  1B21 A;  1BRN L;  2AAE A;  2KAA A;  1DET A;  1X1U A;  2F5W A;  1B27 A;  2KF4 A;  3HOH A;  1RCK A;  1GOY A;  7RNT A;  5GSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...